Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E21099g5.433ON22422411841e-167
SAKL0G02508g5.433ON2282285883e-76
Ecym_47625.433ON2212225205e-66
AER256C5.433ON2392235112e-64
Suva_2.5395.433ON2272275051e-63
KAFR0E039305.433ON2112165031e-63
KNAG0C049205.433ON2172184952e-62
YDR367W (KEI1)5.433ON2212234927e-62
NCAS0F033705.433ON2112214752e-59
Smik_4.6335.433ON2212234735e-59
CAGL0A02794g5.433ON2162204701e-58
Skud_4.6365.433ON2342334616e-57
Kwal_55.214325.433ON2072074561e-56
TDEL0E019205.433ON2202234572e-56
TPHA0E017705.433ON2172174502e-55
Kpol_1062.305.433ON2142224188e-51
ZYRO0F10010g5.433ON2081984032e-48
KLTH0F16082g5.433ON2062063882e-46
TBLA0A065205.433ON2062163832e-45
TBLA0G020105.433ON2132003804e-45
NDAI0B056605.433ON1611763565e-42
TPHA0G008502.307ON78227692.2
Smik_10.781.191ON69977683.4
CAGL0B02431g8.854ON52469665.0
NCAS0B068402.184ON32856648.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E21099g
         (224 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   460   e-167
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   231   3e-76
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   204   5e-66
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   201   2e-64
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   199   1e-63
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   198   1e-63
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   195   2e-62
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   194   7e-62
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   187   2e-59
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   186   5e-59
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   185   1e-58
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   182   6e-57
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   180   1e-56
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   180   2e-56
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   177   2e-55
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   165   8e-51
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   159   2e-48
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   154   2e-46
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   152   2e-45
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   150   4e-45
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   141   5e-42
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    31   2.2  
Smik_10.78 Chr10 complement(124678..126777) [2100 bp, 699 aa] {O...    31   3.4  
CAGL0B02431g Chr2 (232347..233921) [1575 bp, 524 aa] {ON} highly...    30   5.0  
NCAS0B06840 Chr2 complement(1303696..1304682) [987 bp, 328 aa] {...    29   8.5  

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  460 bits (1184), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 224/224 (100%), Positives = 224/224 (100%)

Query: 1   MQQQSNMVHLPQTFLSYPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIW 60
           MQQQSNMVHLPQTFLSYPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIW
Sbjct: 1   MQQQSNMVHLPQTFLSYPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIW 60

Query: 61  SIFCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDL 120
           SIFCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDL
Sbjct: 61  SIFCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDL 120

Query: 121 KSAGTALGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQ 180
           KSAGTALGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQ
Sbjct: 121 KSAGTALGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQ 180

Query: 181 QLLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
           QLLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL
Sbjct: 181 QLLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  231 bits (588), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 159/228 (69%), Gaps = 10/228 (4%)

Query: 4   QSNMVHLPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSI 62
           ++ MVHLP++FL + PLYIGVE+ LG+  FNKFSG YG+LALFTGHPLDF+QW FY  S+
Sbjct: 3   KAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSV 62

Query: 63  FCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQE------GSTD 116
             L+V++SG+ Q+ KPN L  S V  VF++DT+++C + +WF+A WFS E      G+  
Sbjct: 63  LTLLVYLSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVG 122

Query: 117 VTDLKSAGTALGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIII 176
            + L+SAG ALGPA E      S     S+SAS GYE+ + +L T++ LAVRFYFNFI+ 
Sbjct: 123 TSKLQSAGRALGPAKELNRRNNSL---ASQSASQGYEYTMTMLFTVLTLAVRFYFNFILA 179

Query: 177 AFQQQLLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
           AF QQ+LR  K+  D++D+E +L N+++  +   K EKWC+  C+R L
Sbjct: 180 AFVQQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  204 bits (520), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 148/222 (66%), Gaps = 5/222 (2%)

Query: 7   MVHLPQTFLSYPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLV 66
           MV+LPQ+F   PLYIGVE++LGV  FNKF G+YG+LALFTG PLD +QW FY+WS   L+
Sbjct: 1   MVYLPQSFFGLPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALL 60

Query: 67  VFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTA 126
           VF  G+ QVYKP ++    V  V+S+DT+++C + + FT  WFS+E ++  ++  S G  
Sbjct: 61  VFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVS-GKG 119

Query: 127 LGPAHEGTTST----ISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQL 182
           +G    G + T        VD ++SAS+ YE+   ILLTL+  A+RFY NFII +F +++
Sbjct: 120 IGVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRM 179

Query: 183 LRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
           ++  ++  + +D+E +L N ++ ++     ++WC+Y C+RYL
Sbjct: 180 MKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  201 bits (511), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 94/223 (42%), Positives = 147/223 (65%), Gaps = 4/223 (1%)

Query: 2   QQQSNMVHLPQTFLSYPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWS 61
           +  SNM HLP++F   PLYIGVE++LG+  FNKF G++G+LALFTGHPLD +QW FY+WS
Sbjct: 21  KSHSNMNHLPKSFFGLPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWS 80

Query: 62  IFCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLK 121
              L+V++ G+ Q+Y+P +     V  V+S DTI++C+Y LWFT  WF  +G   VT   
Sbjct: 81  FVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFI-DGDVGVT--A 137

Query: 122 SAGTALGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQ 181
           +A      A +G+  T+  +  + +SAS  YE+   +  TL  L++RFY NF+I +F Q+
Sbjct: 138 TAKEDDADATQGSV-TVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQR 196

Query: 182 LLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
           + +  KF    +D+E +L ++++ ++   K ++WC++LC+RYL
Sbjct: 197 MFQHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  199 bits (505), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 104/227 (45%), Positives = 148/227 (65%), Gaps = 8/227 (3%)

Query: 4   QSNMVHLPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSI 62
           +S++V LP++FL + PLY+ VE+ LG+   NK SG YG+LALFTGHPLDF+QW  Y+WS+
Sbjct: 2   RSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSV 61

Query: 63  FCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTD-VTDLK 121
           F L+VF  G+  ++KPN+L+ S +  +++VDTI +C + LWFT  WF+ EG+   V D  
Sbjct: 62  FTLIVFAQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADAS 121

Query: 122 SAGTAL---GPAHEGTTSTISTKVDTS-KSASSGYEFFLIILLTLVPLAVRFYFNFIIIA 177
           S  T      P   G  +  ST  DTS + AS  YE+ + IL+TLV L  RFYFNFI+ +
Sbjct: 122 STATQTINYNPIATGKLTARST--DTSGQGASESYEYSITILITLVSLIFRFYFNFILAS 179

Query: 178 FQQQLLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
           F Q+LL   K+  D++D+E +L N+ I  +   K +K C+ LCK  L
Sbjct: 180 FVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  198 bits (503), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 100/216 (46%), Positives = 139/216 (64%), Gaps = 14/216 (6%)

Query: 10  LPQTFLS-YPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLVVF 68
           LP++FL   PLY+ VE+ LG+  FNK SG +G+LALFTGHPL F+QW FY+WS   L VF
Sbjct: 8   LPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVF 67

Query: 69  ISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTALG 128
             G+ +++KPNIL  S +   +S+DT+ +C + LWFT  WF+ E  T+            
Sbjct: 68  AQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTE------------ 115

Query: 129 PAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSGKF 188
            A  G+T T  T+  +S+ AS GYE+ + I +TL  L  RFYFNFI+ +F Q+LLR  K+
Sbjct: 116 -AAVGSTITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKY 174

Query: 189 TFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
            FDQ+DIE +L N++I  +W  K +K C+ LCK  L
Sbjct: 175 MFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  195 bits (495), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 94/218 (43%), Positives = 141/218 (64%), Gaps = 12/218 (5%)

Query: 10  LPQTFLS-YPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLVVF 68
           LP+TF   +PLYIGVE+ LGV   NK SG +G+LALFTGHPLD +QW  Y+WS+F LVV+
Sbjct: 8   LPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVY 67

Query: 69  ISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTALG 128
             G+ Q++KP +L  S +  VFS+DT+++C++ LWFT VWF++E +TD         A+G
Sbjct: 68  AQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTD--------AAMG 119

Query: 129 PAHEGTTSTIS--TKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSG 186
            A       +    ++DT + A+  YE+   I++T+V L  R YFNF++ +F Q+LLR  
Sbjct: 120 TAASAVARLVKRGAEIDT-QGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHP 178

Query: 187 KFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
           ++  DQ+DIE +L N+  L +W    +K  + +C+  L
Sbjct: 179 QYLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  194 bits (492), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 144/223 (64%), Gaps = 6/223 (2%)

Query: 4   QSNMVHLPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSI 62
           +S+++ LP++FL + PLY+ VE+ LG+   NK SG YG+LALFTGHPLDF+QW  Y+WS+
Sbjct: 2   RSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSV 61

Query: 63  FCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKS 122
           F L+VF  G+  ++KPN+L+ S +  ++++DTI +C + LWFT  WF+ E + ++     
Sbjct: 62  FTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANI----D 117

Query: 123 AGTALGPAHEGTTSTISTKVDTSK-SASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQ 181
              AL      T       +D SK SA+  YE+ + IL+TLV L  RFYFNFI+ +F Q+
Sbjct: 118 GNNALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQE 177

Query: 182 LLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
           LL   K+  D++D+E NL N+ I  +   K +K C+ LCK  L
Sbjct: 178 LLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  187 bits (475), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 92/221 (41%), Positives = 134/221 (60%), Gaps = 20/221 (9%)

Query: 8   VHLPQTFLSY----PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIF 63
           + LP+ F S+    PLY+GVE+ LG+  FNK SG YG+LALFTGHPLDFVQW FY+WSIF
Sbjct: 6   ITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIF 65

Query: 64  CLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSA 123
            L++F  G+ +++KP +L  S +   +S+DTI +CI+ LWFT+ WF  E +     L+  
Sbjct: 66  TLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEEALQRR 125

Query: 124 GTALGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLL 183
             +L                 S+ A+  YE+ + I +TLV L  R YFN ++ AF Q+LL
Sbjct: 126 NESL----------------ESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELL 169

Query: 184 RSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
              K+  DQ+D+E +L N+ +  +W  K +KW + +C   L
Sbjct: 170 HHPKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  186 bits (473), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 95/223 (42%), Positives = 142/223 (63%), Gaps = 6/223 (2%)

Query: 4   QSNMVHLPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSI 62
           +S ++ LP++FL + PLY+ VE+ LG+   NK SG+YG+LALFTGHPLDF+QW  Y+WS+
Sbjct: 2   RSFLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWSV 61

Query: 63  FCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKS 122
           F L++F  G+  ++KPN+LL S +  ++++DT+ +C + LWFT  WF+ E +      +S
Sbjct: 62  FTLIIFSQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLEDTAGGVASQS 121

Query: 123 AGTALGPAHEGTTSTISTKVDTSK-SASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQ 181
             + L      T        D SK SA+  YE+ + IL+TLV L  RFYFN I+ +F Q+
Sbjct: 122 NNSNLISTERLTVR----NTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFVQE 177

Query: 182 LLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
           LL   K+  D++D+E NL N+ I  +   K +K C+ LCK  L
Sbjct: 178 LLHHPKYLVDRDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLL 220

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  185 bits (470), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 139/220 (63%), Gaps = 9/220 (4%)

Query: 6   NMVHLPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFC 64
           N +  P++F  + PLY+GVE+ LG+   NK SG YG+LALFTGHPLD++QW  Y+WS+F 
Sbjct: 4   NKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFT 63

Query: 65  LVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAG 124
           L+VF  G+  ++KP +++ S +   F+ DT+++C + LWF+A WF  + + +     SA 
Sbjct: 64  LIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWF--QSANEEKHETSAP 121

Query: 125 TALGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLR 184
             +   +  +T         S+ AS  YE+ + +L TLV L  R YFNFI+ +F Q+LLR
Sbjct: 122 VGVSQNYRRSTDL------ASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQELLR 175

Query: 185 SGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
             K+  DQ+D+E +L N++ + +W  K +K+C+ LC+  L
Sbjct: 176 HPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  182 bits (461), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 95/233 (40%), Positives = 142/233 (60%), Gaps = 13/233 (5%)

Query: 4   QSNMVHLPQTFLS-----YPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFY 58
           +++ + LP+ F+       PLY+ VE+ LG+   NK SG YG+LALFTGHPLDF+QW  Y
Sbjct: 2   RTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAY 61

Query: 59  IWSIFCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVT 118
           +WS+F L+VF  G+  ++KPN+L+ S +  +++VDTI +C + LWFT  WF+ E  TD  
Sbjct: 62  LWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDFG 121

Query: 119 DL--KSAGTA-----LGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYF 171
            +   +A TA     L P   G  +  S    + +SA+  YE+ + I +TL  L  RFYF
Sbjct: 122 SIANSTADTALRTNGLSPIMAGKLTARSAD-KSGQSATENYEYSITIFITLASLIFRFYF 180

Query: 172 NFIIIAFQQQLLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
           N I+ +F Q+LL   K+  D++D+E +L N+ I  +   K +K C+ LCK  L
Sbjct: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  180 bits (456), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 131/207 (63%), Gaps = 4/207 (1%)

Query: 21  IGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLVVFISGIRQVYKPNI 80
           +GVE+ LG+   NK SG YG+L L TGH LDF+QW  Y+ SI  ++V+  G+  +YKP++
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 81  LLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTALGPAHEGTTST-IS 139
           L  S +   F+ DT+V+C + LWF+  WFS + S ++TD  S        +   +   IS
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNS-ELTDPNSTTLQSSAGNNSPSGNLIS 119

Query: 140 TKVDT--SKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSGKFTFDQNDIEV 197
            + DT  S+SAS G E+F  IL+T+  LA RFYFNFII+AF Q+LLR  K+  DQ+D+E 
Sbjct: 120 KRGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQ 179

Query: 198 NLHNRNILFKWRYKFEKWCFYLCKRYL 224
           +L +R  L +W  + E   + +C+RYL
Sbjct: 180 DLKHRGFLRRWWIRAETHSYKICRRYL 206

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  180 bits (457), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 143/223 (64%), Gaps = 10/223 (4%)

Query: 4   QSNMVHLPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSI 62
           +S  + LP++FL + PLYIGVE+ALG+   NK SG YG+LALFTGHPLD +QW  YIWSI
Sbjct: 5   RSKSMGLPKSFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWSI 64

Query: 63  FCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEG-STDVTDLK 121
           F L++ + G+ Q++KPN+L  S +   F +DT+ +  + LWFTA W++ EG S +V D K
Sbjct: 65  FTLIICVQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSNNVKDTK 124

Query: 122 SAGTALGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQ 181
           S       ++       S+K+   + AS G+E+ + + +T++ LA + YF FII +F Q+
Sbjct: 125 S-------SYSDAPVDYSSKI-AHQGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQE 176

Query: 182 LLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
           LL   ++  DQ+D+E +L +++   +W  K +K C+ + K  L
Sbjct: 177 LLLHPRYMLDQDDVEQDLKHQSFWKRWWIKSQKSCYKMSKSLL 219

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  177 bits (450), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 91/217 (41%), Positives = 133/217 (61%), Gaps = 19/217 (8%)

Query: 10  LPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLVVF 68
           LP++F  + PLYIGVE  LG+  FNK SG+YG+LALFTGHPL  +QW  Y+WS F L+++
Sbjct: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76

Query: 69  ISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTALG 128
             G+ QV+ PN+L    +   +S DTI +C + ++F + WF++E                
Sbjct: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEE---------------- 120

Query: 129 PAHEGTTSTISTKVDT-SKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSGK 187
            ++ G     ST VD  ++ AS   EFF  + LTL+ L  RFYFNFI+ +F QQL    K
Sbjct: 121 -SNAGDNINSSTTVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPK 179

Query: 188 FTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
           +  DQ+D+E +L N++I+ +W  K +K C+Y  KR+L
Sbjct: 180 YMIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  165 bits (418), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 133/222 (59%), Gaps = 20/222 (9%)

Query: 4   QSNMVHLPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSI 62
           +++  +LP++F  + PLYIGVE  LG+   NK SG YG+LALFTGHPL+  QW  Y+WS+
Sbjct: 11  KTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSV 70

Query: 63  FCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKS 122
           F L+++  G+ QV+ P++L  S +  VFS DT ++C++ + F++ WF++ GS       S
Sbjct: 71  FTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSG-----MS 125

Query: 123 AGTALGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQL 182
            G+ +    +G              AS  YE+   IL+T+V L  R YFNFI+ AF Q+L
Sbjct: 126 DGSGVDEYGQG--------------ASETYEYTFTILITVVALVSRMYFNFILAAFNQEL 171

Query: 183 LRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
               K+  D +D+E +L N+N + +W  K +K C+ L +  L
Sbjct: 172 FLHPKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  159 bits (403), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 121/198 (61%), Gaps = 16/198 (8%)

Query: 8   VHLPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLV 66
           ++LP+ FL + PLYIGVEVALGV   NK SG++G+LALFTGHPL+F+QW  Y+WSIF  V
Sbjct: 5   LNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFV 64

Query: 67  VFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTA 126
           V+  G+    KP++L+ S +   FS+DT ++C++ LWFT  W++ E +T  T    A  A
Sbjct: 65  VYAQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLEDNTP-TQKSIAAAA 123

Query: 127 LGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSG 186
           +   ++G              AS  +EF + I +TL  L  R YFNF++ +F Q LL+  
Sbjct: 124 MQEPNQG--------------ASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHP 169

Query: 187 KFTFDQNDIEVNLHNRNI 204
           ++  D  D+E  L  + +
Sbjct: 170 RYMVDYVDVEQELRTQPV 187

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  154 bits (388), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 128/206 (62%), Gaps = 3/206 (1%)

Query: 21  IGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLVVFISGIRQVYKPNI 80
           +GVE+ LG+   NK SG YG+L L TGH LDF+QW  Y+ S+F LVV+  G+  VYKP +
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 81  LLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTALGPAHEGTTSTIST 140
              + V   F+ DT+++C + LWF+ +WF+ + S +++D  SA           +  ++ 
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKES-ELSDPSSATQQTSGGISSGSKLLTA 119

Query: 141 KVDT--SKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSGKFTFDQNDIEVN 198
           + +T  S+SAS   E+F  IL++L+ L  RFYFNFII+AF Q+L R  K+  DQ+D++ +
Sbjct: 120 RGETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQD 179

Query: 199 LHNRNILFKWRYKFEKWCFYLCKRYL 224
           L ++ +  +W  + E W + +C  YL
Sbjct: 180 LKHKKLWQRWWIRAENWSYRVCHHYL 205

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  152 bits (383), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 79/216 (36%), Positives = 121/216 (56%), Gaps = 26/216 (12%)

Query: 10  LPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLVVF 68
           LP+ F    PLY+GVE+ LG+  FNK  G YG+LALF GHPL+F QW  Y WSI CL ++
Sbjct: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74

Query: 69  ISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTALG 128
             G+ +V++P +   S V   FSVDT+++C + ++FT  WF+   +T             
Sbjct: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTTTR-----------P 123

Query: 129 PAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSGKF 188
           PA +G              AS  YE+ + +L+TL  L  R YFNFI+ +F Q+L     +
Sbjct: 124 PAAQG--------------ASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAY 169

Query: 189 TFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
           T D +++E  L + ++L +   + + +C+ L +R L
Sbjct: 170 TLDTDEVETELRHSSLLRRLWLQNQHYCYILSRRIL 205

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  150 bits (380), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 120/200 (60%), Gaps = 12/200 (6%)

Query: 10  LPQTF-LSYPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLVVF 68
           LP +F + +PLY+GVE+ LG+   NK SG YG+LALFTGHPL  VQW  YIWSIF L+++
Sbjct: 13  LPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIY 72

Query: 69  ISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTALG 128
             G+  + KPN+ L S +  +FS+DTI +    L+F   WFS + S      K +  +L 
Sbjct: 73  TQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSN-----KQSENSLQ 127

Query: 129 PAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSGKF 188
              +        ++   + ASS YE FLI+++TL  L  R Y+N ++ +F  +L  + KF
Sbjct: 128 RTEK------DIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKF 181

Query: 189 TFDQNDIEVNLHNRNILFKW 208
             DQ+D+E +L N++   K+
Sbjct: 182 IIDQDDVETDLKNKSFFKKF 201

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  141 bits (356), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 110/176 (62%), Gaps = 20/176 (11%)

Query: 53  VQWTFYIWSIFCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFS-Q 111
           +QW  Y+WSIFCL++F  G+ Q++KP +L  S +T  F++DT+ +C + LWFTA WF   
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWFQGS 60

Query: 112 EGSTDVTDLKSAGTALGPAHEGTTSTISTKVDTS---KSASSGYEFFLIILLTLVPLAVR 168
           EG + V                 TST   K DTS   + A++GYE+F+ +L+T + L  R
Sbjct: 61  EGESAVQ----------------TSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFR 104

Query: 169 FYFNFIIIAFQQQLLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224
           FYFN I+ +F Q+LL + KF  DQ+D+E +L N++++ +W  K EK+C+ LCK  L
Sbjct: 105 FYFNCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
           YDL122W
          Length = 782

 Score = 31.2 bits (69), Expect = 2.2,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 15/27 (55%)

Query: 190 FDQNDIEVNLHNRNILFKWRYKFEKWC 216
           FD N   +  +N  +LFK R+  E WC
Sbjct: 464 FDPNTYTIRKNNSRVLFKSRFNLEPWC 490

>Smik_10.78 Chr10 complement(124678..126777) [2100 bp, 699 aa] {ON}
           YJL156C (REAL)
          Length = 699

 Score = 30.8 bits (68), Expect = 3.4,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 3/77 (3%)

Query: 11  PQTFLSYPLYIGVEVALGVLTFNKFSG-MYGVLALFTGHPLDFVQWTFYIWSIFCLVVFI 69
           P T    PL + + ++L      K +G + G L   TG+   F Q+  Y ++I C  V +
Sbjct: 409 PYTVSENPLELPISMSLSTEASTKITGTLGGYLFPQTGNDTKFSQFASYSFAITCAHVVL 468

Query: 70  SGIRQVYKPNILLMSTV 86
           S  +Q Y PN+++ S V
Sbjct: 469 SE-KQDY-PNVMIPSNV 483

>CAGL0B02431g Chr2 (232347..233921) [1575 bp, 524 aa] {ON} highly
           similar to uniprot|P32340 Saccharomyces cerevisiae
           YML120c NDI1 NADH-ubiquinone oxidoreductase
          Length = 524

 Score = 30.0 bits (66), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 11/69 (15%)

Query: 3   QQSNMVHLPQTFLSYPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSI 62
           +++N      T L    Y+G E A+  +T       YG  +L+TG  L    +TFYIW +
Sbjct: 443 EENNFKPFKYTHLGALAYLGSERAIANIT-------YGKRSLYTGGGL----FTFYIWRL 491

Query: 63  FCLVVFISG 71
             L + +S 
Sbjct: 492 SYLAMLLSA 500

>NCAS0B06840 Chr2 complement(1303696..1304682) [987 bp, 328 aa]
          {ON} Anc_2.184
          Length = 328

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 37 GMYGVLALFTGHPLDFV----QWTFYIWSIFCLVVFISGIRQVYKPNILLMSTVTF 88
          G+ GV A+ TGHP D +    Q      +I  + + +   R +   N+L+ S   F
Sbjct: 44 GVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSVKGF 99

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.141    0.452 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,012,453
Number of extensions: 921234
Number of successful extensions: 3627
Number of sequences better than 10.0: 28
Number of HSP's gapped: 3682
Number of HSP's successfully gapped: 28
Length of query: 224
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 118
Effective length of database: 41,326,803
Effective search space: 4876562754
Effective search space used: 4876562754
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 63 (28.9 bits)