Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E18613g2.530ON37437418460.0
Skud_8.492.530ON4473657199e-91
KLTH0D06776g2.530ON4094467142e-90
Suva_8.582.530ON4523637172e-90
YHR004C (NEM1)2.530ON4463587083e-89
SAKL0A09416g2.530ON3853416982e-88
TDEL0A030502.530ON3553346882e-87
AGL070W2.530ON3433136793e-86
Kpol_348.82.530ON4224416863e-86
Smik_8.532.530ON4463586859e-86
NCAS0F009302.530ON4224326812e-85
Ecym_72572.530ON3523226743e-85
Kwal_26.80012.530ON4134376784e-85
CAGL0K02959g2.530ON4643546791e-84
ZYRO0B01958g2.530ON3362986523e-82
NDAI0H014202.530ON4483536572e-81
KAFR0A018302.530ON4423516543e-81
KNAG0C058502.530ON4433586343e-78
TBLA0I014602.530ON3933526261e-77
TPHA0G035002.530ON3923495903e-72
NDAI0I021705.202ON3911832532e-23
Suva_10.995.202ON3851902513e-23
Kpol_478.165.202ON3501892477e-23
CAGL0D05610g5.202ON4471922509e-23
NCAS0D027405.202ON3982252489e-23
CAGL0D03234g5.202ON4101902481e-22
YLR019W (PSR2)5.202ON3971902472e-22
ZYRO0B10428g5.202ON4821932482e-22
Skud_12.875.202ON3921882435e-22
SAKL0G12870g5.202ON3991892435e-22
AAL158W5.202ON4781712446e-22
Smik_12.825.202ON3921902418e-22
TBLA0C060905.202ON4842032439e-22
Ecym_71045.202ON4922102421e-21
TBLA0H019905.202ON6881842431e-21
KLLA0F15620g5.202ON4141792392e-21
Kwal_33.151405.202ON4101692382e-21
NDAI0D018605.202ON5141792403e-21
Kpol_2002.1005.202ON4771722393e-21
KNAG0M017405.202ON4812292393e-21
Smik_12.535.202ON4141912356e-21
KLTH0B03388g5.202ON4091812357e-21
TPHA0E030705.202ON4941812359e-21
KAFR0J009905.202ON4831892351e-20
TDEL0E042705.202ON4531812331e-20
YLL010C (PSR1)5.202ON4271902312e-20
TPHA0N006705.202ON4522502286e-20
Skud_12.575.202ON4151902251e-19
Suva_10.655.202ON4151702223e-19
NCAS0A068005.202ON4731812234e-19
YPL063W (TIM50)8.527ON4761141666e-12
TDEL0B031908.527ON4771141658e-12
Smik_16.1728.527ON4771141622e-11
Suva_16.2498.527ON4801141586e-11
SAKL0H10296g8.527ON4781151586e-11
ZYRO0F09130g8.527ON4891151578e-11
Skud_16.2188.527ON4801141542e-10
Kpol_457.58.527ON4891141532e-10
KLTH0E12254g8.527ON4761151515e-10
Kwal_27.119908.527ON4741151515e-10
NCAS0C022108.527ON4911151497e-10
NDAI0E029108.527ON4411141498e-10
TPHA0I020008.527ON4781161489e-10
KLLA0E23101g8.527ON4801141462e-09
CAGL0H05159g8.527ON4851141443e-09
TBLA0A005408.527ON4851081435e-09
KAFR0E010208.527ON4481151354e-08
Ecym_11778.527ON4901081345e-08
KNAG0A020608.527ON4501161311e-07
ADR045W8.527ON4761101132e-05
KLTH0C03278gna 1ON59959780.44
Suva_2.1singletonON29658668.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E18613g
         (374 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   715   0.0  
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   281   9e-91
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   279   2e-90
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   280   2e-90
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   277   3e-89
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   273   2e-88
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   269   2e-87
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   266   3e-86
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   268   3e-86
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   268   9e-86
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   266   2e-85
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   264   3e-85
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   265   4e-85
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   266   1e-84
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   255   3e-82
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    257   2e-81
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   256   3e-81
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   248   3e-78
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   245   1e-77
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   231   3e-72
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202    102   2e-23
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...   101   3e-23
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...   100   7e-23
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...   100   9e-23
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...   100   9e-23
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...   100   1e-22
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...   100   2e-22
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...   100   2e-22
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    98   5e-22
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    98   5e-22
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    99   6e-22
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    97   8e-22
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    98   9e-22
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    98   1e-21
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    98   1e-21
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    97   2e-21
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    96   2e-21
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     97   3e-21
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    97   3e-21
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    97   3e-21
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    95   6e-21
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    95   7e-21
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    95   9e-21
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    95   1e-20
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    94   1e-20
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    94   2e-20
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    92   6e-20
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    91   1e-19
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    90   3e-19
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    91   4e-19
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    69   6e-12
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    68   8e-12
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    67   2e-11
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    65   6e-11
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    65   6e-11
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    65   8e-11
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    64   2e-10
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    64   2e-10
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    63   5e-10
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    63   5e-10
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     62   7e-10
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    62   8e-10
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    62   9e-10
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    61   2e-09
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    60   3e-09
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    60   5e-09
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    57   4e-08
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    56   5e-08
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    55   1e-07
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    48   2e-05
KLTH0C03278g Chr3 (285155..286954) [1800 bp, 599 aa] {ON} simila...    35   0.44 
Suva_2.1 Chr2 complement(1..888) [888 bp, 296 aa] {ON} YGR287C (...    30   8.9  

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/374 (93%), Positives = 349/374 (93%)

Query: 1   MNAISFLSNALPAPQEVPIKEKEGILVDPTPTNTQPNKVKNKXXXXXXXXXXXXXXXXXN 60
           MNAISFLSNALPAPQEVPIKEKEGILVDPTPTNTQPNKVKNK                 N
Sbjct: 1   MNAISFLSNALPAPQEVPIKEKEGILVDPTPTNTQPNKVKNKTTTASTTTSTTTTSTATN 60

Query: 61  KRNRPFMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQGNKGLIQVGSETDSR 120
           KRNRPFMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQGNKGLIQVGSETDSR
Sbjct: 61  KRNRPFMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQGNKGLIQVGSETDSR 120

Query: 121 TEKLSKYVVEEDLSPTDEIIINQDKMKPRPITEYLGKFHFPKKLVPQSMLLSTSRKLLVL 180
           TEKLSKYVVEEDLSPTDEIIINQDKMKPRPITEYLGKFHFPKKLVPQSMLLSTSRKLLVL
Sbjct: 121 TEKLSKYVVEEDLSPTDEIIINQDKMKPRPITEYLGKFHFPKKLVPQSMLLSTSRKLLVL 180

Query: 181 DLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQ 240
           DLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQ
Sbjct: 181 DLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQ 240

Query: 241 QTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVAT 300
           QTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVAT
Sbjct: 241 QTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVAT 300

Query: 301 QIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHVTDSR 360
           QIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSE        KAMRHVTDSR
Sbjct: 301 QIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSELLHLLPLLKAMRHVTDSR 360

Query: 361 CILALKSGRASISN 374
           CILALKSGRASISN
Sbjct: 361 CILALKSGRASISN 374

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  281 bits (719), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 152/365 (41%), Positives = 212/365 (58%), Gaps = 64/365 (17%)

Query: 64  RPFMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQ---------GNKGLIQV- 113
           R     +W IL+FLP YL+IKP++++W+V TFPL+++E   +         GN G +   
Sbjct: 90  RKIASILWTILLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRHKEPGNSGNVSST 149

Query: 114 --GSETDSRTEKLSK--------YVVEEDLSPTDEIIINQDKMKPRPI------------ 151
             G+  DS  +  SK          V++DL+ +DEII+ +D +K   +            
Sbjct: 150 SSGNGNDSNEKAGSKNGNLNTIPETVDDDLNASDEIILQRDNVKGSLLKAQSVKSRSRSY 209

Query: 152 ------------------TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNS 193
                             T+ +G+F FPKKL+P+S+L +  +K LV+DLDETLIHS S S
Sbjct: 210 SKSDVSLTNHSNTNTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRS 269

Query: 194 RSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTA 253
            +  N +           HLVEV+F  + I TLY + KRPYCD FL + S+WYD+ IFTA
Sbjct: 270 TTHSNSSQG---------HLVEVKFGISGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTA 320

Query: 254 SMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSR-----DL 308
           SMKEYADPVIDWL+ +    F  R+YR DC LR GVGY+KD+  + +  E  +      L
Sbjct: 321 SMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSL 380

Query: 309 SQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHVTDSRCILALKSG 368
             +IIIDNSP+SYAM++DNAIQV GWI+DP+D++        +AMR+ TD R ILALK G
Sbjct: 381 DDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHG 440

Query: 369 RASIS 373
             + +
Sbjct: 441 EKAFN 445

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  279 bits (714), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 167/446 (37%), Positives = 232/446 (52%), Gaps = 110/446 (24%)

Query: 1   MNAISFLSN---------ALPAPQEVPIKEKEGILVDPTPTNTQPNKVKNKXXXXXXXXX 51
           MNAIS+L+N         +   P  V   EK    +D  P   Q                
Sbjct: 1   MNAISYLTNNILPPKHEESTATPHRVEDSEKANARIDVAPKEAQ---------------- 44

Query: 52  XXXXXXXXNKRNRPFMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLME-TNTQGNKGL 110
                    KR R     +W +L FLPN +++KP++ +W+VITFPL+L+E  ++  N+G+
Sbjct: 45  ---------KRKRARWTLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIERASSSENQGM 95

Query: 111 IQVGSETDSRTE------------KLSKYVVEEDLSPTDEIIINQDKMK----------P 148
               +E DS++E            ++S    EED    +E+I+  D +K           
Sbjct: 96  GFDNAEGDSKSEASAGTISPKNSSRISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKE 155

Query: 149 RP----------------------------------------ITEYLGKFHFPKKLVPQS 168
           RP                                         +  +G+F FPKKL+PQS
Sbjct: 156 RPQDKGRRQPLQPQQQQPKTSRQSLKTSSVRSGASSSAGTALGSRRMGRFLFPKKLIPQS 215

Query: 169 MLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYN 228
           +L    R+ LVLDLDETLIHSMS     G  +  +  G     H+VEV+F  + ISTLY+
Sbjct: 216 VLNRRKRRTLVLDLDETLIHSMSR----GTSSSNSSQG-----HMVEVKFATSGISTLYH 266

Query: 229 VAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPG 288
           V KRPYCD+FL + ++WY++ +FTASMKEYADPVIDWL+ +   +F  R YR+DC LR G
Sbjct: 267 VHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDG 326

Query: 289 VGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSEXXXXXX 348
           VGY+KD+  V         LS + IIDNSP+SYAMH+DNAIQV GWI+DP+D++      
Sbjct: 327 VGYIKDLSVVVPNAS----LSDIFIIDNSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLP 382

Query: 349 XXKAMRHVTDSRCILALKSGRASISN 374
             +A+R  TD R +LALKSG  + +N
Sbjct: 383 LLEALRFTTDIRNVLALKSGEHAFTN 408

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  280 bits (717), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 149/363 (41%), Positives = 212/363 (58%), Gaps = 68/363 (18%)

Query: 70  IWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQ---------GNKGL---------I 111
           +W IL+FLP YL+IKP++++W+V TFPLN++E   +         G+ G           
Sbjct: 97  LWAILLFLPYYLIIKPLMSLWFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSG 156

Query: 112 QVGSETDSRTEKLS--KYVVEEDLSPTDEIIINQDKMKPRPI------------------ 151
               + D++   L+    +VE+DL+ +DEII+ +D +K   +                  
Sbjct: 157 DFNEKQDAKNRNLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHSAKSKSRRYSK 216

Query: 152 ----------------TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRS 195
                           T+ +G+F FPKKL+P+S+L +  +K LV+DLDETLIHS S   +
Sbjct: 217 SEASLTNHSTANTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTT 276

Query: 196 LGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASM 255
             N +           HLVEV+F  + ISTLY + KRPYCD+FL + S+WYD+ IFTASM
Sbjct: 277 HSNSSQG---------HLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASM 327

Query: 256 KEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSR-----DLSQ 310
           KEYADPVIDWL+ + +  F  R+YR DC LR GVGY+KD+  + +  E  +      L  
Sbjct: 328 KEYADPVIDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGSSLSSLDD 387

Query: 311 MIIIDNSPISYAMHLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHVTDSRCILALKSGRA 370
           +IIIDNSP+SYAM++DNAIQV GWI+DP+D++        +AMR+ TD R ILALK G  
Sbjct: 388 VIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEK 447

Query: 371 SIS 373
           + +
Sbjct: 448 AFN 450

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  277 bits (708), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 153/358 (42%), Positives = 212/358 (59%), Gaps = 63/358 (17%)

Query: 70  IWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQG----NKG-------LIQVGSETD 118
           +W +L+FLP YL+IKP++++W+V TFPL+++E   +     N+G       L    S  +
Sbjct: 96  LWALLLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRNRGSNASENELPVSSSNIN 155

Query: 119 SRTEKLSKY---------VVEEDLSPTDEIIINQD------------KMKPRPI------ 151
             +EK +            VE+DL+ +DEII+ +D            K +PR        
Sbjct: 156 DSSEKTNPKNCNLNTIPEAVEDDLNASDEIILQRDNVKGSLLRAQSVKSRPRSYSKSELS 215

Query: 152 ------------TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNP 199
                       T+ +G+F FPKKL+P+S+L +  +K LV+DLDETLIHS S S +  N 
Sbjct: 216 LSNHSSSNTVFGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNS 275

Query: 200 TDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYA 259
           +           HLVEV+F  + I TLY + KRPYCD+FL + S+WYD+ IFTASMKEYA
Sbjct: 276 SQG---------HLVEVKFGLSGIRTLYFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYA 326

Query: 260 DPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIE----TSRDLSQMIIID 315
           DPVIDWL+ +    F  R+YR DC LR GVGY+KD+  V    E    +S  L  +IIID
Sbjct: 327 DPVIDWLESSFPSSFSKRYYRSDCVLRDGVGYIKDLSIVKDSEENGKGSSSSLDDVIIID 386

Query: 316 NSPISYAMHLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHVTDSRCILALKSGRASIS 373
           NSP+SYAM++DNAIQV GWI+DP+D++        +AMR+ TD R ILALK G  + +
Sbjct: 387 NSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFN 444

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  273 bits (698), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 145/341 (42%), Positives = 205/341 (60%), Gaps = 48/341 (14%)

Query: 67  MRWIWCILIFLPNYLLIKPIITIWYVITFPLNLME---TNTQGNKGLIQVGSETDSRTEK 123
           +  +W I++FLPN+ +IKP++  WY+ITFPLNL+E    + +  +   +  S  D     
Sbjct: 58  LSLLWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPADDEDERNGEEGNSTGDEEKTP 117

Query: 124 LSKYVVEEDLS--PTDEIIINQDKMKPRPIT----------------------------- 152
               +VEED      DEII+  D +K    T                             
Sbjct: 118 SINIIVEEDEEDLAGDEIILQTDAVKGSLSTISESQQVKTIKASTRSSIRSGSTGTALGS 177

Query: 153 EYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIH 212
             +G+F FPKKL+PQS+L +  +K+LVLDLDETLIHSMS     G  +  +  G     H
Sbjct: 178 RRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHSMSR----GTSSSNSSQG-----H 228

Query: 213 LVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSV 272
           +VEV+F  + IS+LY V KRPYCD+FL + ++WY + +FTASMKEYADPVIDWL+ + S 
Sbjct: 229 MVEVKFAVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSG 288

Query: 273 QFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVH 332
            F  R YR+DC LR GVGY+KD+  +     + + L+++II+DNSPISYAM++DNAIQV 
Sbjct: 289 SFSQRLYRQDCILRDGVGYIKDLSLI-----SKKSLNEIIIVDNSPISYAMNVDNAIQVE 343

Query: 333 GWINDPSDSEXXXXXXXXKAMRHVTDSRCILALKSGRASIS 373
           GWI+DP+D++        +A+R  TD R +L+LKSG  + +
Sbjct: 344 GWISDPTDTDLLNLLPLLEALRFTTDIRNVLSLKSGEQAFN 384

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  269 bits (688), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 142/334 (42%), Positives = 201/334 (60%), Gaps = 51/334 (15%)

Query: 61  KRNRPFMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLME---------TNTQGNKGLI 111
           +R   F  + W +++F P +L+IKP   IW++I+ PL L+E          +T+ + G +
Sbjct: 37  RRRSKFTSYAWAVILFFPQWLIIKPTQLIWWIISLPLLLIEYGLKSRLQRKSTKRSTGTL 96

Query: 112 QVGSETDSRTEKLSKYVVEEDLSPTDEIIINQDKMKPRPI-------------------T 152
           Q  SE +           E+DL+  DEI + +D +K                       T
Sbjct: 97  QSISELE-----------EDDLAGGDEIFLQRDAVKGSLAPAKYRRSRSGSRSSTVMLGT 145

Query: 153 EYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIH 212
           + +G+F FPKKL+P+S+L +  RK LV+DLDETLIHS S + S  N             H
Sbjct: 146 KRMGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQG---------H 196

Query: 213 LVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSV 272
           +VE+RF  + +STLY V KRP+CD+FL + S+WYD+ +FTASM+EYADPVIDWL+ + S 
Sbjct: 197 MVEIRFAISGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSG 256

Query: 273 QFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVH 332
           +F  R YR +C LR GVGY+KD+  V     T   L ++I++DNSPISYAM++DNAIQV 
Sbjct: 257 RFSKRLYRNNCILRDGVGYIKDLSIVCGPTVT---LGEVILVDNSPISYAMNVDNAIQVE 313

Query: 333 GWINDPSDSEXXXXXXXXKAMRHVTDSRCILALK 366
           GWI+DPSD++        +A+R+ TD R ILALK
Sbjct: 314 GWISDPSDTDLLTLLPFLEALRYTTDVRDILALK 347

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  266 bits (679), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 149/313 (47%), Positives = 208/313 (66%), Gaps = 27/313 (8%)

Query: 69  WIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQGNKGLIQVGSETDSRTEKLSKYV 128
           W+W +L FLP +L++KP++ +W+V+TFPL+L+E  +  +K          +  E+L++ V
Sbjct: 49  WVWRVLFFLPKWLVVKPVVLVWFVLTFPLSLIEQTS--SKEADGAPGPEAAEEEQLAEAV 106

Query: 129 VEEDLSPTDEIIINQDKMKPRPITEY--------LGKFHFPKKLVPQSMLLSTSRKLLVL 180
            ++DL+  + +++ +D +K    +          LGKF FPKKL+PQS+L +  +KLLVL
Sbjct: 107 EDDDLA-GESMVLQEDSVKSSRPSTSRSSYTSTRLGKFLFPKKLIPQSILQTDRKKLLVL 165

Query: 181 DLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQ 240
           DLDETLIHSMS S S  + +           H+VEV F  + +STLY V KRPYCD+FL 
Sbjct: 166 DLDETLIHSMSRSTSSVSNSQG---------HMVEVTFAASGVSTLYYVHKRPYCDLFLS 216

Query: 241 QTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVAT 300
           + S+WYD+ IFTASMKEYADPVIDWL+   SV+F  R YR DC LR GVGYVKD+  +  
Sbjct: 217 RVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSII-- 274

Query: 301 QIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHVTDSR 360
               S++L  +II+DNSPISYAM++DNAIQV GWI+DP+D+         + +R  TD+R
Sbjct: 275 ----SKNLQDIIIVDNSPISYAMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTR 330

Query: 361 CILALKSG-RASI 372
            IL+LK+G RA I
Sbjct: 331 NILSLKNGERAFI 343

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  268 bits (686), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 168/441 (38%), Positives = 234/441 (53%), Gaps = 90/441 (20%)

Query: 1   MNAISFLSNALPAPQEVPIKEKEGILVDPTPTNTQPNKVK---NKXXXXXXXXXXXXXXX 57
           MNA+S++S+ L  P    I+E+E       P+ +Q   V+   N                
Sbjct: 1   MNALSYISSNLITP----IEEEE------LPSGSQSEDVQTYTNDVSDTCVSSQTQIISK 50

Query: 58  XXNKRNRPFMR-WIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQGNKGLIQVGSE 116
             +  N    R  +  +L+F P YLL+KPI  +W++ITFP+ L E   Q NK L +  + 
Sbjct: 51  VEDVLNEDNQRSTLVLVLLFFPKYLLVKPIFFLWFLITFPITLFE---QKNKKLPKSSAN 107

Query: 117 TDSRTE-KLSKYVVEEDLSPTDEIIINQDKM-----KPRP-------------------- 150
            D+ ++ K    +VEEDLS   EII+ +D +     K R                     
Sbjct: 108 LDTMSKSKNLNILVEEDLSGGGEIILQRDTLNGSLLKSRANQQHSHQSRHAKSSSSSVGL 167

Query: 151 ITEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPM 210
           I++ +G+F FPKKL+P+S+L S  +K LVLDLDETLIHS+S S          P+     
Sbjct: 168 ISKKIGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRS---------TPNSNNAQ 218

Query: 211 IHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTC 270
            HLVEV+FP + ISTLY V KRPYCD+FL +  +WYD+ IFTASMKEYADPVIDWL+ + 
Sbjct: 219 AHLVEVKFPISGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSF 278

Query: 271 SVQFHYRWYREDCTLRPGVGYVKDIGTV-------------------------------- 298
              F  R+YR DC LR GVGY+KD+  V                                
Sbjct: 279 RGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPGSHAASTTSHNNHNNNNNSNTNSNDNND 338

Query: 299 ------ATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSEXXXXXXXXKA 352
                  T    +  LS++I+IDNSP+SYAM++DNAIQV GWI+DP+D +        ++
Sbjct: 339 NNDTNAHTHQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLES 398

Query: 353 MRHVTDSRCILALKSGRASIS 373
           +R+ TD R IL+LK+G  + +
Sbjct: 399 LRNTTDVRNILSLKNGERAFN 419

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  268 bits (685), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 147/358 (41%), Positives = 211/358 (58%), Gaps = 63/358 (17%)

Query: 70  IWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQGNKGLIQVGSETDSRT-------- 121
           +W +L+FLP YL+IKP++++WYV TFPL+++E   +      +  S+ ++ +        
Sbjct: 96  LWALLLFLPYYLVIKPLMSLWYVFTFPLSVIERRVKHTDKRNKESSDNENGSPTSSSSAG 155

Query: 122 ---EKLSKY---------VVEEDLSPTDEIIINQDKMKPRPI------------------ 151
              EK++            VE+DL+ +DEII+ +D +K   +                  
Sbjct: 156 DSSEKINSKNCNLNTISETVEDDLNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVS 215

Query: 152 ------------TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNP 199
                       T+ +G+F FPKKL+P+S+L +  +K LV+DLDETLIHS S S +  N 
Sbjct: 216 LTNHSSTNTVFGTKRMGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNS 275

Query: 200 TDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYA 259
           +           HLVEV+F  + I TLY + KRPYCD+FL + S+WY++ IFTASMKEYA
Sbjct: 276 SQG---------HLVEVKFGISGIRTLYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYA 326

Query: 260 DPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIE----TSRDLSQMIIID 315
           DPVIDWL+ +    F  R+YR DC LR GVGY+KD+  +    E    +S  L  +IIID
Sbjct: 327 DPVIDWLESSFPSSFSRRYYRSDCVLRDGVGYIKDLSIIKNSEENEKGSSSSLDDVIIID 386

Query: 316 NSPISYAMHLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHVTDSRCILALKSGRASIS 373
           NSP+SYAM++DNAIQV GWI+DP+D++        +AMR+ TD R ILALK G  + +
Sbjct: 387 NSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFN 444

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  266 bits (681), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 157/432 (36%), Positives = 232/432 (53%), Gaps = 73/432 (16%)

Query: 1   MNAISFLSNALPAPQEVPIKEKEGIL-VDPTPTNTQPNKVKNKXXX-------------- 45
           MNA+S++S+ L +P     K++  I+ V+  PTN    K+K+                  
Sbjct: 1   MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNNN-EKIKSHSKATTNNDEDYSTPMAD 59

Query: 46  -XXXXXXXXXXXXXXNKRNRPFMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNT 104
                          + R   F    W  ++F P +L++KP++ +W+++TFPL L+E   
Sbjct: 60  SSSSNTIEKSIAVYGSDRALRFSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLE--- 116

Query: 105 QGNKGLIQVGSETDSRTEKLSKYV-------------VEEDLSPTDEIIINQDKMKPRPI 151
           +G K    + ++ D  ++K ++ V              E+DL+  DEI + +D +K   +
Sbjct: 117 RGMKHRTLLKNKLDENSQKNAERVPTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSLL 176

Query: 152 -------------------------TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETL 186
                                    ++ +GKF FPKKL+P+S++ +  RK LVLDLDETL
Sbjct: 177 KATSAKQLSSSKTVKSISSNNTSFSSKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETL 236

Query: 187 IHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWY 246
           IHSMS   +  N +           H+VEV+F  + +STLY V KRPYCD FL + S+WY
Sbjct: 237 IHSMSRGTTHSNSSQG---------HIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWY 287

Query: 247 DIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSR 306
           D+ IFTASMKEYADPVIDWL+ +   +F  R YR DC LR GVGY+KD+  ++       
Sbjct: 288 DLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKN 347

Query: 307 ------DLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHVTDSR 360
                  L ++IIIDNSPISYAM+++NAIQV GWI+DP+D+         +A+R  TD R
Sbjct: 348 ISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDNALLNLLPLLEALRFTTDVR 407

Query: 361 CILALKSGRASI 372
            +LALK+G  + 
Sbjct: 408 NVLALKNGEKAF 419

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  264 bits (674), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 205/322 (63%), Gaps = 27/322 (8%)

Query: 60  NKRNRPFMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQGNKGLIQVGSETDS 119
           +K  RP   W+W ++ FLP +L+IKPI  IW+V+TFPLNL+E +T    G ++      +
Sbjct: 48  SKGGRP--SWVWRVVFFLPTWLIIKPIWLIWFVLTFPLNLIE-HTSSKDGSVEEEEVIPT 104

Query: 120 RTE-KLSKYVVEEDLSPTDEIIINQDKMKPRPITEY--------LGKFHFPKKLVPQSML 170
            ++      V+E+D    + +++++D +K    +          LGKF FPKKL+PQS+L
Sbjct: 105 NSQGSGGGEVIEDDDLVGESMVLHEDSIKSSRPSTSRSSYTSTRLGKFLFPKKLIPQSIL 164

Query: 171 LSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVA 230
            +  +K+LVLDLDETLIHSMS S S  N +           H+VEV F  + +S+LY V 
Sbjct: 165 QTDRKKVLVLDLDETLIHSMSRSTSSSNTSQG---------HMVEVTFSVSGVSSLYYVH 215

Query: 231 KRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVG 290
           KRPYCD+FL +  +WYD+ IFTASM+EYADPVIDWL+   S +F  R YR DC LR G+G
Sbjct: 216 KRPYCDLFLSRVCKWYDLVIFTASMREYADPVIDWLESGISARFTKRKYRSDCILRDGIG 275

Query: 291 YVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSEXXXXXXXX 350
           YVKD+  +      S++L   II+DNSP+SYAM++DNAIQV GWI+DP+D+         
Sbjct: 276 YVKDLTMI------SKNLQDTIIVDNSPVSYAMNVDNAIQVEGWISDPTDTGLLNLLPLL 329

Query: 351 KAMRHVTDSRCILALKSGRASI 372
           + +R  TD+R IL+LK+G  + 
Sbjct: 330 EGLRFTTDTRNILSLKNGEHAF 351

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  265 bits (678), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 165/437 (37%), Positives = 227/437 (51%), Gaps = 90/437 (20%)

Query: 1   MNAISFLSNALPAPQEVPIKEKEGILVDPTPTNTQPNKVKNKXXXXXXXXXXXXXXXXXN 60
           MNAIS+L+N    P+             P   ++ P  ++                    
Sbjct: 1   MNAISYLTNNALTPK-------------PEGPSSSPENIEGSADVNVSGNGKNPQLKVKK 47

Query: 61  KRNRPFMRW--IWCILIFLPNYLLIKPIITIWYVITFPLNLMETNT-----QGNKGLIQ- 112
            R    +RW  +W IL+FLPN L++KPI+ +W+VITFPL+L+E ++      G +  +Q 
Sbjct: 48  TRKSRGIRWAFLWSILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAGGTESSLQR 107

Query: 113 ---------VGSETDSRTEK--LSKYVVEEDLSPTDEIIINQDKMK-------------- 147
                    V + +DS   K  ++    E+D    DEI +  D +K              
Sbjct: 108 TGNLYSDEQVSTTSDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHS 167

Query: 148 ----------------PRPIT---------------EYLGKFHFPKKLVPQSMLLSTSRK 176
                           P+  +                 +G+F FPKKL+PQS+L     +
Sbjct: 168 QDLSRRQQHSKGSRQSPKAASVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKPR 227

Query: 177 LLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCD 236
            LVLDLDETLIHSMS     G  +  +  G     H+VEV+F  + ISTLY+V KRPYCD
Sbjct: 228 TLVLDLDETLIHSMSR----GTSSSNSSQG-----HMVEVKFAISGISTLYHVHKRPYCD 278

Query: 237 MFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIG 296
           +FL   + WY++ +FTASMKEYADPVIDWL+ +   +F  R YR+DC LR GVGY+KD+ 
Sbjct: 279 LFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLS 338

Query: 297 TVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHV 356
            VA        LS + IIDNSP+SYAMH+DNAIQV GWI+DP+D++        +A+R  
Sbjct: 339 AVAPNTL----LSDIFIIDNSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFT 394

Query: 357 TDSRCILALKSGRASIS 373
           TD R ILALKSG  + S
Sbjct: 395 TDVRNILALKSGEHAFS 411

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  266 bits (679), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 140/354 (39%), Positives = 209/354 (59%), Gaps = 52/354 (14%)

Query: 62  RNRPFMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQ------GNKGLIQ--V 113
           R   F   +W I+ F PNY+LIKP + +W+++TFPL+L+E + +       N+ L Q   
Sbjct: 117 RGLKFFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPA 176

Query: 114 GSETDSRTEKLS--KYVVEEDLSPTDEIIINQDKMKPRPI-------------------- 151
            ++ +S +++L+  +  +E+DL   + + + +D +K   +                    
Sbjct: 177 TNKDNSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTT 236

Query: 152 -----------TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPT 200
                      T+ +G+F FPKKL+P+S+L S  +K LV+DLDETLIHS+S   +  N +
Sbjct: 237 STPSHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSS 296

Query: 201 DKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYAD 260
                      H++EVRF  + +STLY V KRPYCD+FL +  +WY++ IFTASMKEYAD
Sbjct: 297 ---------QAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYAD 347

Query: 261 PVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRD--LSQMIIIDNSP 318
           PVIDWL+ + S  F  R YR  C  R GVGY+KD+G +      +    L+ ++IIDNSP
Sbjct: 348 PVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIPLTDVVIIDNSP 407

Query: 319 ISYAMHLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHVTDSRCILALKSGRASI 372
           +SYAMH+DNAIQV GWI+DP+D+E        +A+R+ TD R +LALK+   + 
Sbjct: 408 VSYAMHVDNAIQVEGWISDPTDTELLNLLPFLEALRYTTDVRNVLALKNSEKAF 461

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  255 bits (652), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 137/298 (45%), Positives = 195/298 (65%), Gaps = 25/298 (8%)

Query: 81  LLIKPIITIWYVITFPLNLMETNTQGNKGLIQVGSETDSRTEKLSKYVVEEDLSPTDEII 140
           + +KP   IW+VIT PL L+E   +  + +      T  + E + K  V++DL+  DE+ 
Sbjct: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQKV----ESTSRKGEIIRKKEVDDDLAE-DEMF 113

Query: 141 INQDKMK-----PRPITEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRS 195
           + +D +K         T+ +G+F FPKKLVPQS+L +  +K LV+DLDETLIHS + S S
Sbjct: 114 LQRDTVKGGLRGKAFGTKKMGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVS 173

Query: 196 LGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASM 255
             N         +   H+VEVRFP ++ISTLY V KRP+CD+FL + S+WYD+ IFTASM
Sbjct: 174 HSN---------SAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASM 224

Query: 256 KEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIID 315
           KEYADPVIDWL+ + + +F  R YR +C +R GVGY+KD+ +V T++     L ++++ID
Sbjct: 225 KEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDL-SVVTEV-----LDEVVLID 278

Query: 316 NSPISYAMHLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHVTDSRCILALKSGRASIS 373
           NSP SYA + DNAIQV GWI+DPSD++        +A+R+VTD R IL LK+G  ++ 
Sbjct: 279 NSPTSYARNEDNAIQVEGWISDPSDTDLLNLLPLLEALRYVTDVRSILGLKNGEKALG 336

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  257 bits (657), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 144/353 (40%), Positives = 205/353 (58%), Gaps = 58/353 (16%)

Query: 70  IWCILIFLPNYLLIKPIITIWYVITFPLNLMETNT---------------QGNKGLIQVG 114
           +W  L+F P  L+IKPI+ +WY++TFPL+L+E  T               + ++ L+   
Sbjct: 105 LWSFLLFFPKILIIKPILFLWYILTFPLSLIERGTKYRMRPFSQSKDSSPEKDETLVHNN 164

Query: 115 S---ETDSRTEKLSKYVVEEDLSPTDEIIINQDKMKPRPI-------------------- 151
           S   E  S+ + +++ + E+DL   D I + +D +K   +                    
Sbjct: 165 SFLPEEPSKLDAINE-LTEDDLVSGDGIYLQRDNVKGSLLKASSVRQPSLSRSMKTMVSN 223

Query: 152 -----TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSG 206
                ++ +GKF FPKKL+P+S+  +  RK LVLDLDETLIHS+S   +  N +      
Sbjct: 224 NTSFSSKRMGKFLFPKKLIPKSITQTERRKKLVLDLDETLIHSISRGTTHTNVSQG---- 279

Query: 207 TTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWL 266
                H+VEV+F  + +S LY V KRPYCD FL +  +WYD+ IFTASMKEYADPVIDWL
Sbjct: 280 -----HIVEVKFSSSGVSMLYYVHKRPYCDFFLSKVCKWYDLIIFTASMKEYADPVIDWL 334

Query: 267 QQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVA----TQIETSRDLSQMIIIDNSPISYA 322
           + +    F  R+YR DC  R GVGY+KD+  +       +  +  LS++II+DNSPISYA
Sbjct: 335 EASFQGTFTERYYRTDCIRRDGVGYIKDLTIIKDDSNVSVPQTSTLSEVIILDNSPISYA 394

Query: 323 MHLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHVTDSRCILALKSG-RASISN 374
           M+ DNAIQV GWI+DP+D+         +A+R+ TD R ILALK+G RA  +N
Sbjct: 395 MNADNAIQVEGWISDPTDTALLNLLPLLEALRYTTDVRSILALKNGERAFYAN 447

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  256 bits (654), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 142/351 (40%), Positives = 201/351 (57%), Gaps = 63/351 (17%)

Query: 73  ILIFLPNYLLIKPIITIWYVITFPLNLME-----------TNTQGNKGLIQVGSETDSRT 121
           I++F+P YL + P+I +W+++T PL L+E              +GN G     S   S +
Sbjct: 105 IILFVPRYLFLNPLIYVWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSIS 164

Query: 122 EKLSKYVVEEDLSPTDEIIINQDKMKPRPI------------------------------ 151
           E     V EEDLS +DE  + +D +K   +                              
Sbjct: 165 E-----VGEEDLSTSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFG 219

Query: 152 TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMI 211
           T+ +G+F FPKKL+P+S+L +  +K LV+DLDETLIHS+S   +  N +           
Sbjct: 220 TKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQG--------- 270

Query: 212 HLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCS 271
           HLVEV+F    ISTLY V KRP+CD+FL + S+WY+I IFTASMKEYADPVIDWL+ +  
Sbjct: 271 HLVEVKFSINGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQ 330

Query: 272 VQFHYRWYREDCTLRPGVGYVKDIGTV--ATQIETSR------DLSQMIIIDNSPISYAM 323
             F  R YR +C LR GVGY+KD+  +  A   + ++       L ++IIIDNSP+SYA+
Sbjct: 331 GNFAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYAL 390

Query: 324 HLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHVTDSRCILALKSGRASISN 374
           ++DNAIQV GWI+DP+D++        +A+R+ TD R +LALK+G     N
Sbjct: 391 NVDNAIQVEGWISDPTDTDLLNLLPILEALRYTTDVRNVLALKNGEKMFEN 441

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  248 bits (634), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 145/358 (40%), Positives = 209/358 (58%), Gaps = 70/358 (19%)

Query: 70  IWCILIF----LPNYLLIKPIITIWYVITFPLNLMETNTQGNKGLIQVGSETDSRTEKLS 125
           +W +L+F    LP YL+ KP++ +W+++T PL L+E         I++ +    +TEK+S
Sbjct: 100 VWNVLVFVIFFLPTYLIYKPLLLLWFLVTLPLALVERG-------IKLRNRPKMKTEKVS 152

Query: 126 KYV-------------VEEDLSPTDEIIINQDKMKPRPI--------------------- 151
           + V             VEEDL+  DE  + +D +K   +                     
Sbjct: 153 ELVLSDPSKLGSINEEVEEDLAAGDEFYLQRDIVKGSLLKATTNKHHTPLKSKKNSAQNQ 212

Query: 152 -------------TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGN 198
                        T+ +G+F FPKKL+P+S+L    +K LV+DLDETLIHS+S   +  N
Sbjct: 213 HGNETHPNSTVFGTKKMGRFLFPKKLIPKSILNREKKKTLVMDLDETLIHSVSRGTTHPN 272

Query: 199 PTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEY 258
            +           H+VEV+F  + +STLY V KRPYCD+FL + S+WYDI IFTASMKEY
Sbjct: 273 SSQG---------HIVEVKFSISGVSTLYYVFKRPYCDLFLTKVSKWYDIVIFTASMKEY 323

Query: 259 ADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTV--ATQIETSRD-LSQMIIID 315
           ADPVIDWL+ + + +F  R YR DC LR GVGY+KD+  V   + + TS D L  +II+D
Sbjct: 324 ADPVIDWLESSFAGKFSRRLYRNDCILRDGVGYIKDLKMVTRGSNLGTSPDRLEDVIIVD 383

Query: 316 NSPISYAMHLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHVTDSRCILALKSGRASIS 373
           NSP+SYA+++DNAIQV GWINDP+D++        +A+ + TD R IL+LK+G  + +
Sbjct: 384 NSPVSYALNVDNAIQVEGWINDPTDTDLLNLIPLLEALENTTDVRNILSLKNGEKAFN 441

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  245 bits (626), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 143/352 (40%), Positives = 196/352 (55%), Gaps = 78/352 (22%)

Query: 81  LLIKPIITIWYVITFPLNLMETNT----QGNKGLIQVGSETDSRTEKLSKYVVEEDLSPT 136
           +LIKP+I +WY+ TFPL L+E +T    +    LI     + S T+        +DL+  
Sbjct: 57  ILIKPLIFLWYIFTFPLLLIEQHTNRKYKDTPPLIDPKIASSSATDL-------DDLNSN 109

Query: 137 DEIIINQDKMK-----------------------PRPI---------------------T 152
           DEII+  D +K                       P P+                     +
Sbjct: 110 DEIILQTDSIKGSLLEKKNTSAAATPSATPPATSPSPLVIKQKKIQNKSVYSLTSNFIGS 169

Query: 153 EYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIH 212
           + +G+F FPKKL+P S+L +  RK L+LDLDETLIHSMS + S         S T    H
Sbjct: 170 KNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLIHSMSRNIS---------SSTISNYH 220

Query: 213 LVEVRFPQTN------------ISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYAD 260
           L+EV+FP               +S+LY V KRPYCD FL   S WYD+ IFTASMKEYAD
Sbjct: 221 LIEVKFPTPTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYAD 280

Query: 261 PVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPIS 320
           PVIDWL+ + +  F  R YR  C LR G+GY+KD+  + T  +++  L+++I+IDNSPIS
Sbjct: 281 PVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQST--LNELILIDNSPIS 338

Query: 321 YAMHLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHVTDSRCILALKSGRASI 372
           +AM++DNAIQV GWI+DP+D+E        +++RH TD R ILALK+G  + 
Sbjct: 339 FAMNVDNAIQVQGWISDPTDTELLTLLPFLESLRHTTDVRNILALKNGERAF 390

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  231 bits (590), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 139/349 (39%), Positives = 193/349 (55%), Gaps = 70/349 (20%)

Query: 84  KPIITIWYVITFPLNLMETNTQGN---KGLIQVGSETDS----------------RTEKL 124
           KP++  WY++TFPL L E N   N   +      S +D+                RTE+L
Sbjct: 51  KPLLFSWYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQL 110

Query: 125 SKY--VVEEDLSPTDEIIINQDKMKPRPI------------------------------- 151
                V+E+D+    E+I+ +D +K   +                               
Sbjct: 111 QNLDSVLEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFG 169

Query: 152 TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMI 211
           T+ +G+F FPKKL+P+S+L S  +K LVLDLDETLIHS+S S S         +      
Sbjct: 170 TKKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSNS---------NSNNAQA 220

Query: 212 HLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCS 271
           HLVEV+F  + ISTLY V KRPYCD+FL   S+WYD+ IFTASMKEYADPVIDWL+ +  
Sbjct: 221 HLVEVKFQISGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFV 280

Query: 272 VQFHYRWYREDCTLRPGVGYVKDIGTVATQ--------IETSRDLSQMIIIDNSPISYAM 323
             F  R+YR  C LR GVGY+KD+  +           +  +  L ++I+IDNSP+SYAM
Sbjct: 281 GNFSKRYYRNHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAM 340

Query: 324 HLDNAIQVHGWINDPSDSEXXXXXXXXKAMRHVTDSRCILALKSGRASI 372
           ++DNAIQV GWI+DP+D +        +++R+ TD R IL+LK+G  + 
Sbjct: 341 NVDNAIQVEGWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAF 389

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score =  102 bits (253), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 95/183 (51%), Gaps = 28/183 (15%)

Query: 162 KKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQT 221
           + L+P        +K LVLDLDETL+HS                 +   +H  +   P  
Sbjct: 208 RTLLPPQTNECFGKKCLVLDLDETLVHS-----------------SFKYLHTADFVLPVD 250

Query: 222 NISTLYNV--AKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWY 279
               ++NV   KRP  D FL++ +Q Y++ +FTAS+  Y DP++D L  + S+  H+R +
Sbjct: 251 IDDQIHNVYVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI--HHRLF 308

Query: 280 REDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPS 339
           RE C    G  YVK++  +       R LS+++I+DNSP SY  H  +AI +  W +D  
Sbjct: 309 REACYNYEG-NYVKNLAQIG------RPLSEIVILDNSPASYMFHPQHAIPISSWFSDTH 361

Query: 340 DSE 342
           D+E
Sbjct: 362 DNE 364

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score =  101 bits (251), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 98/190 (51%), Gaps = 30/190 (15%)

Query: 157 KFHFP--KKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLV 214
           ++H P    L+P  +L    +K L+LDLDETL+HS                 +   +H  
Sbjct: 195 QYHAPGYDTLLPPKLLPFQQKKCLILDLDETLVHS-----------------SFKYLHTA 237

Query: 215 EVRFPQTNISTLYNV--AKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSV 272
           +   P      ++NV   KRP  D FL + SQ Y++ +FTAS+  YA+P++D L    ++
Sbjct: 238 DFVLPVEIDDQVHNVYVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRTI 297

Query: 273 QFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVH 332
             H+R +RE C    G  Y+K++  +       R LS+ II+DNSP SY  H  +A+ + 
Sbjct: 298 --HHRLFREACYNYEG-NYIKNLSQIG------RPLSETIILDNSPASYIFHPQHAVPIS 348

Query: 333 GWINDPSDSE 342
            W +D  D+E
Sbjct: 349 SWFSDTHDNE 358

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 99.8 bits (247), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 100/189 (52%), Gaps = 25/189 (13%)

Query: 156 GKFHFP--KKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHL 213
            +FH P    L+P       +RK LVLDLDETL+HS     S           T   +  
Sbjct: 158 NQFHAPGCNTLLPPIQQSLQNRKCLVLDLDETLVHSSFKYVS-----------TADFVLP 206

Query: 214 VEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQ 273
           V++     N+     V KRP  D FLQ TS+ +++ IFTAS+++Y +P++D L  T  + 
Sbjct: 207 VDIDDQFQNVY----VIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDL- 261

Query: 274 FHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHG 333
            H+R +R+ C    G  Y+K++  +       R LS +II+DNSP SY  H ++AI +  
Sbjct: 262 VHHRLFRDACYNYNG-NYIKNLAQLG------RPLSDIIILDNSPTSYLFHPNHAIPISS 314

Query: 334 WINDPSDSE 342
           W +D  D+E
Sbjct: 315 WFSDAHDNE 323

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score =  100 bits (250), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 99/192 (51%), Gaps = 32/192 (16%)

Query: 156 GKFHFPKK---LVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIH 212
           G++H P     L P+       +K LVLDLDETL+HS                 +   +H
Sbjct: 256 GQYHAPGLDTLLSPKGDAFK-HKKCLVLDLDETLVHS-----------------SFKYLH 297

Query: 213 LVEVRFPQTNISTLYNV--AKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTC 270
             +   P      ++NV   KRP  D FLQ+  + Y++ +FTAS+  Y DP++D L ++ 
Sbjct: 298 TADFVLPVDIDDQIHNVYVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLDKSN 357

Query: 271 SVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQ 330
           ++  H+R +R+ C    G  Y+K++  +       R LS++II+DNSP SY  H  +AI 
Sbjct: 358 NI--HHRLFRDACYTYEG-NYIKNLSQIG------RPLSEIIILDNSPPSYIFHPQHAIP 408

Query: 331 VHGWINDPSDSE 342
           +  W +D  D+E
Sbjct: 409 ISSWFSDSHDNE 420

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score =  100 bits (248), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 113/225 (50%), Gaps = 34/225 (15%)

Query: 128 VVEEDLSPTDEIIINQDKMKPRPITEYL--------GKFHFP--KKLVPQSMLLSTSRKL 177
             + D+   +E + N +++ P    E L         ++H P  K L+       +++K 
Sbjct: 171 ATQNDIHQQNETVPNYNEIYPGDDNEDLIDLTILQPDQYHAPGFKTLLSPRKPEFSNKKC 230

Query: 178 LVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRPYCDM 237
           LVLDLDETL+HS                 T   +  VE+   +  I  +Y V KRP  D 
Sbjct: 231 LVLDLDETLVHSSFKYVR-----------TADFVLPVEI---EDQIHNVY-VIKRPGVDE 275

Query: 238 FLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGT 297
           FL++  + Y++ +FTAS+  Y DP+++ L Q+ SV  H+R +RE C    G  Y+K++  
Sbjct: 276 FLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV--HHRLFREACYNYEG-NYIKNLAQ 332

Query: 298 VATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSE 342
           +       R LS +II+DNSP SY  H  +AI +  W +D  D+E
Sbjct: 333 IG------RPLSDIIILDNSPASYMFHPQHAIPISSWFSDTHDNE 371

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score =  100 bits (248), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/190 (33%), Positives = 96/190 (50%), Gaps = 30/190 (15%)

Query: 157 KFHFP--KKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLV 214
           ++H P    L+P        +K LVLDLDETL+HS                 +   +   
Sbjct: 220 QYHAPGYNTLLPPQTEQFKGKKCLVLDLDETLVHS-----------------SFKYLRTA 262

Query: 215 EVRFPQTNISTLYNV--AKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSV 272
           +   P      ++NV   KRP  D FL++  + Y++ +FTAS+  Y DP++D L Q  S+
Sbjct: 263 DFVLPVNIDDQVHNVYVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQHKSI 322

Query: 273 QFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVH 332
             H+R +RE C    G  Y+K++  +       R LS++II+DNSP SY  H  +AI V 
Sbjct: 323 --HHRLFREACYNYEG-NYIKNLSQIG------RPLSEIIILDNSPASYIFHPQHAIPVS 373

Query: 333 GWINDPSDSE 342
            W +D  D+E
Sbjct: 374 SWFSDSHDNE 383

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 99.8 bits (247), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/190 (32%), Positives = 97/190 (51%), Gaps = 30/190 (15%)

Query: 157 KFHFP--KKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLV 214
           ++H P    L+P  +     +K L+LDLDETL+HS                 +   +H  
Sbjct: 207 QYHAPGYDTLLPPKLQEFQQKKCLILDLDETLVHS-----------------SFKYMHSA 249

Query: 215 EVRFPQTNISTLYNV--AKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSV 272
           +   P      ++NV   KRP  D FL + SQ Y++ +FTAS+  YA+P++D L    ++
Sbjct: 250 DFVLPVEIDDQVHNVYVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

Query: 273 QFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVH 332
             H+R +RE C    G  Y+K++  +       R LS+ II+DNSP SY  H  +A+ + 
Sbjct: 310 --HHRLFREACYNYEG-NYIKNLSQIG------RPLSETIILDNSPASYIFHPQHAVPIS 360

Query: 333 GWINDPSDSE 342
            W +D  D+E
Sbjct: 361 SWFSDTHDNE 370

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score =  100 bits (248), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 99/193 (51%), Gaps = 32/193 (16%)

Query: 155 LGKFHFPK---KLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMI 211
           LG++H       L PQS  LS  +K LVLDLDETL+HS                 +   +
Sbjct: 290 LGQYHAAGCNTLLPPQSKHLS-GKKCLVLDLDETLVHS-----------------SFKYL 331

Query: 212 HLVEVRFPQTNISTLYNV--AKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQT 269
              +   P      ++NV   KRP  D FL++    +++ IFTAS+  Y DP++D L + 
Sbjct: 332 KGADFVLPVDIDDQIHNVYVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKH 391

Query: 270 CSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAI 329
            SV  H+R +RE C    G  Y+K++  +       R LS++II+DNSP SY  H  +AI
Sbjct: 392 KSV--HHRLFREACYNYEG-NYIKNLSQIG------RPLSEIIILDNSPASYIFHPQHAI 442

Query: 330 QVHGWINDPSDSE 342
            +  W +D  D+E
Sbjct: 443 PISSWFSDTHDNE 455

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 98.2 bits (243), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 63/188 (33%), Positives = 97/188 (51%), Gaps = 26/188 (13%)

Query: 157 KFHFP--KKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLV 214
           ++H P    L+P  +     +K L+LDLDETL+HS                 T   +  V
Sbjct: 202 QYHAPGYNTLLPPKLQEFQQKKCLILDLDETLVHSSFKYMQ-----------TADFVLPV 250

Query: 215 EVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQF 274
           E+      +  +Y V KRP  D FL + SQ Y++ +FTAS+  YA+P++D L    ++  
Sbjct: 251 EI---DDQVHNVY-VIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI-- 304

Query: 275 HYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGW 334
           H+R +RE C    G  Y+K++  +       R LS+ II+DNSP SY  H  +A+ +  W
Sbjct: 305 HHRLFREACYNYEG-NYIKNLSQIG------RPLSETIILDNSPASYIFHPQHAVPISSW 357

Query: 335 INDPSDSE 342
            +D  D+E
Sbjct: 358 FSDSHDNE 365

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 98.2 bits (243), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 97/189 (51%), Gaps = 26/189 (13%)

Query: 156 GKFHFPK--KLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHL 213
           G+ H P    L+P    +   +K LVLDLDETL+HS                 T   +  
Sbjct: 208 GQSHAPGLVTLLPPKDPVFEGKKCLVLDLDETLVHSSFKYLR-----------TADFVIP 256

Query: 214 VEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQ 273
           VE+      +  +Y V KRP  D FL++  + Y++ +FTAS+  Y DP++D L    +V 
Sbjct: 257 VEI---DDQVHNVY-VIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAV- 311

Query: 274 FHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHG 333
            H+R +R+ C    G  Y+K++  +       R LS +II+DNSP SY +H  +AI +  
Sbjct: 312 -HHRLFRDSCYNYDG-NYIKNLSQIG------RPLSDLIILDNSPASYILHPQHAIPISS 363

Query: 334 WINDPSDSE 342
           W +D  D+E
Sbjct: 364 WFSDAHDNE 372

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 98.6 bits (244), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 90/171 (52%), Gaps = 28/171 (16%)

Query: 174 SRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNV--AK 231
            RK LVLDLDETL+HS                 +   +H  +   P    + ++NV   K
Sbjct: 307 GRKCLVLDLDETLVHS-----------------SFKYLHTADFVIPVEIDNQVHNVYVIK 349

Query: 232 RPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGY 291
           RP  D FL++  + +++ +FTAS+  Y DP++D L Q  +V  H+R +R+ C    G  Y
Sbjct: 350 RPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQYKAV--HHRLFRDSCYNYEG-NY 406

Query: 292 VKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSE 342
           +K++  +       R LS +II+DNSP SY  H  +A+ +  W +D  D+E
Sbjct: 407 IKNLSQIG------RPLSDLIILDNSPASYIFHPQHAVPISSWFSDAHDNE 451

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 97.4 bits (241), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 96/190 (50%), Gaps = 30/190 (15%)

Query: 157 KFHFP--KKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLV 214
           ++H P    L+P  +     +K L+LDLDETL+HS                 +   +H  
Sbjct: 202 QYHAPGCDTLLPPKLEKFQQKKCLILDLDETLVHS-----------------SFKYMHTA 244

Query: 215 EVRFPQTNISTLYNV--AKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSV 272
           +   P      ++NV   KRP  D FL +  Q Y++ +FTAS+  YA+P++D L    ++
Sbjct: 245 DFVLPVEIDDQVHNVYVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

Query: 273 QFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVH 332
             H+R +RE C    G  Y+K++  +       R LS+ II+DNSP SY  H  +A+ + 
Sbjct: 305 --HHRLFREACYNYEG-NYIKNLSQIG------RPLSETIILDNSPASYIFHPQHAVPIS 355

Query: 333 GWINDPSDSE 342
            W +D  D+E
Sbjct: 356 SWFSDTHDNE 365

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 98.2 bits (243), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 106/203 (52%), Gaps = 24/203 (11%)

Query: 157 KFHFP--KKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLV 214
           ++H P    L+P        +K L+LDLDETL+HS  + + + NP           I  +
Sbjct: 292 QYHAPGCSSLLPPKDSKDKHKKCLILDLDETLVHS--SFKFINNPD---------FILPI 340

Query: 215 EVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQF 274
           E+   Q  I  +Y V KRP  D FL++  +WY+I IFTAS+  YA+P++D L +  ++  
Sbjct: 341 EIEDGQ--IHNVY-VIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNL-I 396

Query: 275 HYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGW 334
           ++R +R+ C       ++K++  +       R L  +II+DNSP SY  H  +AI +  W
Sbjct: 397 NHRLFRDACYNYEN-NFIKNLSQIG------RPLHDIIILDNSPASYIFHPQHAIPISSW 449

Query: 335 INDPSDSEXXXXXXXXKAMRHVT 357
            +D  D+E        K + HV+
Sbjct: 450 FSDTHDNELIDILPLLKDLSHVS 472

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 97.8 bits (242), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 105/210 (50%), Gaps = 37/210 (17%)

Query: 137 DEIIINQDKMKPRPITEYLGKFHFP--KKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSR 194
           +++I++   ++P        + H P  + L+P        RK LVLDLDETL+HS     
Sbjct: 289 EDVILDLSALQPE-------QAHAPGFRTLLPPQFPQFYRRKCLVLDLDETLVHS----- 336

Query: 195 SLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNV--AKRPYCDMFLQQTSQWYDIAIFT 252
                       +   +H  +   P    + ++NV   KRP  D FL++  + Y++ +FT
Sbjct: 337 ------------SFKYLHTADFVIPVEIDNQVHNVYVIKRPGVDEFLRRVGELYEVVVFT 384

Query: 253 ASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMI 312
           AS+  Y DP++D L +   V  H+R +R+ C    G  Y+K++  +       R LS +I
Sbjct: 385 ASVSRYGDPLLDILDKHNVV--HHRLFRDSCYNYEG-NYIKNLSQIG------RPLSDLI 435

Query: 313 IIDNSPISYAMHLDNAIQVHGWINDPSDSE 342
           I+DNSP SY  H  +AI +  W +D  D+E
Sbjct: 436 ILDNSPASYIFHPHHAIPISSWFSDAHDNE 465

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 96/184 (52%), Gaps = 27/184 (14%)

Query: 160 FPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFP 219
           F   L PQ+ + S  +K L+LDLDETL+HS  + + L +     P      IH V V   
Sbjct: 504 FNTLLPPQNQIFS-GKKCLILDLDETLVHS--SFKYLTSADFVIPVDIDEQIHNVYV--- 557

Query: 220 QTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWL-QQTCSVQFHYRW 278
                      KRP  D FL+  S+ +++ +FTAS+  Y DP++D L +  C    H+R 
Sbjct: 558 ----------IKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLDKHRC---IHHRL 604

Query: 279 YREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDP 338
           +RE C    G  Y+K++  +       R LS++II+DNSP SY  H  +AI +  W +D 
Sbjct: 605 FREACYDYEG-NYIKNLSQIG------RPLSELIILDNSPASYIFHPQHAIPISSWFSDT 657

Query: 339 SDSE 342
            D+E
Sbjct: 658 HDNE 661

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 96/179 (53%), Gaps = 25/179 (13%)

Query: 164 LVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNI 223
           L+P++ +    +K LVLDLDETL+HS                 T   +  VE+      +
Sbjct: 234 LLPKADMFK-GKKCLVLDLDETLVHSSFKYLR-----------TADFVIPVEI---DNQV 278

Query: 224 STLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDC 283
             +Y V KRP  D FL++ ++ Y++ +FTAS+  Y DP++D L +  ++  H+R +R+ C
Sbjct: 279 HNVY-VIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKTI--HHRLFRDSC 335

Query: 284 TLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSE 342
               G  Y+K++  +       R LS MII+DNSP SY  H  +AI +  W +D  D+E
Sbjct: 336 YNYEG-NYIKNLSQIG------RPLSDMIILDNSPASYIFHPQHAIPISSWFSDAHDNE 387

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 96.3 bits (238), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 88/169 (52%), Gaps = 24/169 (14%)

Query: 174 SRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRP 233
            +K LVLDLDETL+HS                 T   +  VE+      I  +Y V KRP
Sbjct: 239 GKKCLVLDLDETLVHSSFKFLR-----------TADFVIPVEI---DNQIHNVY-VIKRP 283

Query: 234 YCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVK 293
             D FL+   Q Y++ +FTAS+  Y DP++D L QT  +  H+R +R+ C    G  Y+K
Sbjct: 284 GVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLDQTQCI--HHRLFRDSCYNYDG-NYIK 340

Query: 294 DIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSE 342
           ++  +       R LS +II+DNSP SY  H  +AI +  W +D  D+E
Sbjct: 341 NLSQIG------RPLSDLIILDNSPASYIFHPQHAIPISSWFSDVHDNE 383

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 91/179 (50%), Gaps = 23/179 (12%)

Query: 164 LVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNI 223
           L P+  +    +K LVLDLDETL+HS  + + L N     P      IH V V       
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHS--SFKYLPNADFNLPVNIDDQIHNVYV------- 382

Query: 224 STLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDC 283
                  KRP  D FL++  + +++ IFTAS+  Y DP++D L        H+R +RE C
Sbjct: 383 ------IKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGK-SIHHRLFREAC 435

Query: 284 TLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSE 342
               G  Y+K++  +       R LS++II+DNSP SY  H  +AI +  W +D  D+E
Sbjct: 436 YNYEG-NYIKNLSQMG------RPLSEIIILDNSPASYIFHPQHAIPISSWFSDSHDNE 487

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 96.7 bits (239), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 90/172 (52%), Gaps = 30/172 (17%)

Query: 174 SRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQT---NISTLYNVA 230
           ++K LVLDLDETL+HS                 +   I   +   P T       +Y V 
Sbjct: 306 NKKCLVLDLDETLVHS-----------------SFKYIDTADFVLPVTIDDQTHQVY-VI 347

Query: 231 KRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVG 290
           KRP  D FL++  + +++ +FTAS+  Y DP++D L  + S+  H+R +RE C +  G  
Sbjct: 348 KRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSSKSI--HHRLFRESCYIYDG-N 404

Query: 291 YVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSE 342
           YVK++  +       R LS +II+DNSP SY  H  +AI +  W +D  D+E
Sbjct: 405 YVKNLSQIG------RPLSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 450

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 96.7 bits (239), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 73/229 (31%), Positives = 108/229 (47%), Gaps = 38/229 (16%)

Query: 128 VVEEDLSPTDEIIINQDKMKPRPITEYL------------GKFHFP--KKLVPQSMLLST 173
           V+  D +P D+    QD    +P  E               ++H      L+P      +
Sbjct: 250 VIYSDGAPNDQTTDAQDYNMTQPFDEVDEDEFVDLTVLQPDQYHAAGYSTLLPPPSKAVS 309

Query: 174 SRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNVAKRP 233
            RK LVLDLDETL+HS  + + L +     P      IH V V              KRP
Sbjct: 310 HRKCLVLDLDETLVHS--SFKYLKSADFVLPVDIDDQIHNVYV-------------IKRP 354

Query: 234 YCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYVK 293
             D FL++  + Y++ +FTAS+  Y DP++D L +  S+  H+R +RE C    G  Y+K
Sbjct: 355 GVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKDKSI--HHRLFREACYNYEG-NYIK 411

Query: 294 DIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSE 342
           ++  +       R LS +II+DNSP SY  H  +AI +  W +D  D+E
Sbjct: 412 NLSQIG------RPLSNIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 454

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 95.1 bits (235), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 96/191 (50%), Gaps = 30/191 (15%)

Query: 156 GKFHFP--KKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHL 213
           G++H P  K L+P     +  +K L+LDLDETL+HS                 +   +  
Sbjct: 223 GQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHS-----------------SFKYLRS 265

Query: 214 VEVRFPQTNISTLYNV--AKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCS 271
            +   P      ++NV   KRP  + FL++  + +++ +FTAS+  Y DP++D L     
Sbjct: 266 ADFVLPVEIDDQVHNVYVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDADKV 325

Query: 272 VQFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQV 331
           +  H+R +RE C    G  Y+K++  +       R LS +II+DNSP SY  H  +AI +
Sbjct: 326 I--HHRLFREACYNYEG-NYIKNLSQIG------RPLSDIIILDNSPASYIFHPQHAIPI 376

Query: 332 HGWINDPSDSE 342
             W +D  D+E
Sbjct: 377 SSWFSDTHDNE 387

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 95.1 bits (235), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 91/181 (50%), Gaps = 28/181 (15%)

Query: 164 LVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNI 223
           L+P      + +K LVLDLDETL+HS                 +   +   +   P    
Sbjct: 228 LLPVKTEQFSGKKCLVLDLDETLVHS-----------------SFKFLRTADFVIPVEID 270

Query: 224 STLYNV--AKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYRE 281
           + ++NV   KRP  D FL+   Q Y++ +FTAS+  Y DP++D L Q   +  H+R +R+
Sbjct: 271 NQVHNVYVIKRPGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNHCI--HHRLFRD 328

Query: 282 DCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDS 341
            C    G  Y+K++  +       R LS +II+DNSP SY  H  +AI +  W +D  D+
Sbjct: 329 SCYNYDG-NYIKNLSQIG------RPLSDLIILDNSPASYIFHPQHAIPISSWFSDVHDN 381

Query: 342 E 342
           E
Sbjct: 382 E 382

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 95.1 bits (235), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 93/181 (51%), Gaps = 27/181 (14%)

Query: 164 LVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQT-- 221
           L P+ +     +K L+LDLDETL+HS                 +   +   +   P T  
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHS-----------------SFKYVDSADFVIPVTID 354

Query: 222 NISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYRE 281
           N +    V KRP  D FL++ S+ Y++ +FTAS+  Y DP+++ L    ++  H+R +RE
Sbjct: 355 NQTHHVYVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTI-IHHRLFRE 413

Query: 282 DCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDS 341
            C    G  YVK++  +       R L+++II+DNSP SY  H  +AI +  W +D  D+
Sbjct: 414 SCYTYEG-NYVKNLSQLG------RPLNEIIILDNSPASYIFHPQHAIPISSWFSDIHDN 466

Query: 342 E 342
           E
Sbjct: 467 E 467

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 97/189 (51%), Gaps = 26/189 (13%)

Query: 156 GKFHFP--KKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHL 213
            ++H P    L+P      + +K LVLDLDETL+HS  + + L +     P      IH 
Sbjct: 292 NQYHAPGYDTLLPPPEKSLSRKKCLVLDLDETLVHS--SFKYLKSADFVLPVDIDDQIHN 349

Query: 214 VEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQ 273
           V V              KRP  D FL++  + +++ +FTAS+  Y DP++D L +  S+ 
Sbjct: 350 VYV-------------IKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKGKSI- 395

Query: 274 FHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHG 333
            H+R +RE C    G  Y+K++  +       R LS +II+DNSP SY  H  +AI +  
Sbjct: 396 -HHRLFREACYNYEG-NYIKNLSQLG------RPLSDIIILDNSPASYIFHPQHAIPISS 447

Query: 334 WINDPSDSE 342
           W +D  D+E
Sbjct: 448 WFSDTHDNE 456

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 90/181 (49%), Gaps = 28/181 (15%)

Query: 164 LVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNI 223
           L+P        +K LVLDLDETL+HS                 +   +   +   P    
Sbjct: 272 LLPPRAPAFNGKKCLVLDLDETLVHS-----------------SFKYLRTADFVLPVDID 314

Query: 224 STLYNV--AKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYRE 281
             ++NV   KRP  D FL++    Y++ +FTAS+  Y DP++D L +  ++  H+R +RE
Sbjct: 315 DQIHNVYVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDKHKTI--HHRLFRE 372

Query: 282 DCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDS 341
            C    G  Y+K++  +       R LS +II+DNSP SY  H  +AI +  W +D  D+
Sbjct: 373 SCYNYEG-NYIKNLSQIG------RPLSDIIILDNSPASYIFHPQHAIPISSWFSDTHDN 425

Query: 342 E 342
           E
Sbjct: 426 E 426

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/190 (32%), Positives = 97/190 (51%), Gaps = 28/190 (14%)

Query: 156 GKFHFP--KKLVPQSMLLSTSRKLLVLDLDETLIHS-MSNSRSLGNPTDKNPSGTTPMIH 212
           G++H P    L+P     +  +K L+LDLDETL+HS     RS               + 
Sbjct: 236 GQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFKYLRS------------ADFVL 283

Query: 213 LVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSV 272
            VE+      +  +Y V KRP  + FL++  + +++ +FTAS+  Y DP++D L     +
Sbjct: 284 SVEI---DDQVHNVY-VIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKVI 339

Query: 273 QFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVH 332
             H+R +RE C    G  Y+K++  +       R LS +II+DNSP SY  H  +AI + 
Sbjct: 340 --HHRLFREACYNYEG-NYIKNLSQIG------RPLSDIIILDNSPASYIFHPQHAIPIS 390

Query: 333 GWINDPSDSE 342
            W +D  D+E
Sbjct: 391 SWFSDTHDNE 400

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 92.4 bits (228), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 114/250 (45%), Gaps = 46/250 (18%)

Query: 112 QVGSETDSRTEKLSKYVV--EEDLSPTDEIIINQDKM----KPRPITEYL--------GK 157
           +   ET+  T+  SK     E+  S  D +  N D+     +    TE+         G+
Sbjct: 203 RTSEETNGLTKNASKRTTTNEDSTSDNDSLSYNADEYSQGYEQNDNTEHFIDLTLLQEGQ 262

Query: 158 FHFP--KKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVE 215
            H P    L+P        RK LVLDLDETL+HS                 +   +++ +
Sbjct: 263 SHAPGFDTLLPPIEKKFADRKCLVLDLDETLVHS-----------------SFKYLNIAD 305

Query: 216 VRFP---QTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSV 272
              P      +  +Y V+KRP  D FL+     Y++ +FTAS+  Y +P++D L     +
Sbjct: 306 FVLPVDIDNQVQNVY-VSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDPHKYI 364

Query: 273 QFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVH 332
             H+R +R+ C +  G  YVK++  +       R L  +II+DNSP SY  H  +AI + 
Sbjct: 365 --HHRLFRDSCYVYEG-NYVKNLSQIG------RPLGDIIILDNSPASYIFHPQHAIPIS 415

Query: 333 GWINDPSDSE 342
            W +D  DSE
Sbjct: 416 SWFSDSHDSE 425

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 94/190 (49%), Gaps = 30/190 (15%)

Query: 157 KFHFPK--KLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLV 214
           ++H P    L+P     +  +K L+LDLDETL+HS                 +   +   
Sbjct: 225 QYHAPGYTTLLPPQGESTKGKKCLILDLDETLVHS-----------------SFKYLRSA 267

Query: 215 EVRFPQTNISTLYNV--AKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSV 272
           +   P      ++NV   KRP  + FL++  + +++ +FTAS+  Y DP++D L     +
Sbjct: 268 DFVLPVEIDDQVHNVYVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTNKVI 327

Query: 273 QFHYRWYREDCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVH 332
             H+R +RE C    G  Y+K++  +       R LS +II+DNSP SY  H  +AI + 
Sbjct: 328 --HHRLFREACYNYEG-NYIKNLSQIG------RPLSDIIILDNSPASYIFHPQHAIPIS 378

Query: 333 GWINDPSDSE 342
            W +D  D+E
Sbjct: 379 SWFSDTHDNE 388

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 90.1 bits (222), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 87/170 (51%), Gaps = 28/170 (16%)

Query: 175 RKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYNV--AKR 232
           +K L+LDLDETL+HS                 +   +   +   P      ++NV   KR
Sbjct: 245 KKCLILDLDETLVHS-----------------SFKYLRSADFVLPVEIDDQVHNVYVIKR 287

Query: 233 PYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGYV 292
           P  + FL++  + +++ +FTAS+  Y DP++D L     +  H+R +RE C    G  Y+
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKVI--HHRLFREACYNYEG-NYI 344

Query: 293 KDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSE 342
           K++  +       R LS++II+DNSP SY  H  +AI +  W +D  D+E
Sbjct: 345 KNLSQIG------RPLSEIIILDNSPASYIFHPQHAIPISSWFSDTHDNE 388

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 90.5 bits (223), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 91/181 (50%), Gaps = 27/181 (14%)

Query: 164 LVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNI 223
           L P++      +K LVLDLDETL+HS                 +   +   +   P    
Sbjct: 291 LPPKTEKKLIGKKCLVLDLDETLVHS-----------------SFKYLQTADFVLPVNID 333

Query: 224 STLYNV--AKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYRE 281
             ++NV   KRP  + FL++  + +++ +FTAS+  Y DP++D L     +  H+R +RE
Sbjct: 334 EQIHNVYVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQL-IHHRLFRE 392

Query: 282 DCTLRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDS 341
            C    G  Y+K++  +       R LS++II+DNSP SY  H  +AI +  W +D  D+
Sbjct: 393 ACYNYEG-NYIKNLSQMG------RPLSEIIILDNSPASYIFHPQHAIPISSWFSDSHDN 445

Query: 342 E 342
           E
Sbjct: 446 E 446

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 63/114 (55%), Gaps = 8/114 (7%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+Y+I +F+++   Y+D + + L    +    Y  ++E C  +
Sbjct: 213 WRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAF-VSYNLFKEHCVYK 271

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSD 340
            GV ++KD+  +      +RDLS++IIID  P SY +  +NAI +  W  +  D
Sbjct: 272 DGV-HIKDLSKL------NRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADD 318

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 62/114 (54%), Gaps = 8/114 (7%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP CD FL   SQ+Y+I +F+++   YA+ + + L    +    Y  ++E C  +
Sbjct: 204 WRTAKRPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAF-VSYNLFKEHCVYK 262

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSD 340
            GV ++KDI  +      +RDL +++ ID  P +Y +  +NAI +  W  +  D
Sbjct: 263 DGV-HIKDISKL------NRDLGKVVTIDTDPNTYKLQPENAIPMDPWTGEADD 309

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 63/114 (55%), Gaps = 8/114 (7%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+++I +F+++   Y+D + + L    +    Y  ++E C  +
Sbjct: 213 WRTAKRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAF-VSYNLFKEHCVYK 271

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSD 340
            GV ++KD+  +      +RDLS++IIID  P SY +  +NAI +  W  +  D
Sbjct: 272 DGV-HIKDLSKL------NRDLSKVIIIDTEPNSYKLQPENAIPMDPWNGEADD 318

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 63/114 (55%), Gaps = 8/114 (7%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+++I +F+++   Y++ + + L    +    Y  ++E C  +
Sbjct: 218 WRTAKRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAF-VSYNLFKEHCVYK 276

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSD 340
            GV ++KD+  +      +RDLS++IIID  P SY +  +NAI +  W  +  D
Sbjct: 277 DGV-HIKDLSKL------NRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADD 323

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 8/115 (6%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+Y+I +F+++   YA+ V + +    +    Y  Y+E C  +
Sbjct: 212 WRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKMDPIHAF-VTYNLYKEHCLYK 270

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDS 341
            GV ++KD+  +      +RDL + +IID  P SY +  +NAI V  W     D 
Sbjct: 271 DGV-HIKDLSKL------NRDLGKTMIIDTDPNSYKLQPENAIPVKPWEGTADDG 318

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 60/115 (52%), Gaps = 8/115 (6%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP CD FL   SQ+Y+I +F+++   Y+D + + L    +    Y  ++E C  +
Sbjct: 217 WRTAKRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLDPIHAF-ISYNLFKEHCVYK 275

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDS 341
            G+ ++KDI  +      +RD+ ++++ID  P  Y    +NAI    W   P D 
Sbjct: 276 DGI-HIKDISKM------NRDVGKVVMIDTDPNCYKSQPENAIPAKPWDGTPDDG 323

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 61/114 (53%), Gaps = 8/114 (7%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  + FL   SQ+Y+I +F+++   Y++   + L    +    Y  ++E C  +
Sbjct: 216 WRTAKRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDPIHAF-VSYNLFKEHCVYK 274

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSD 340
            GV ++KD+  +       RDLS++IIID  P SY +  +NAI +  W  +  D
Sbjct: 275 DGV-HIKDLSKL------KRDLSKVIIIDTDPNSYKLQPENAIPMDPWNGEADD 321

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 60/114 (52%), Gaps = 8/114 (7%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+Y++ +F+++   Y++ + + L    +    Y  Y+E C  +
Sbjct: 222 WRTAKRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKLDPIHAF-ISYNLYKEHCVYK 280

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSD 340
            G  ++KD+  +      +RDL ++II+D  P SY +  +NAI +  W     D
Sbjct: 281 EG-DHIKDLSKL------NRDLGKVIIVDTDPASYKLQPENAIPMQPWDGKADD 327

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 8/115 (6%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+Y+I +F+++   Y+D V + L    +    Y  ++E C  +
Sbjct: 209 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLDPIHAF-ITYNLFKEHCLYK 267

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDS 341
            GV ++KD+  +      +RDL + II+D  P +Y +  +NAI +  W     D 
Sbjct: 268 DGV-HIKDLSKL------NRDLGKTIIVDCDPNAYKLQPENAIPMRPWDGKADDG 315

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 60/115 (52%), Gaps = 8/115 (6%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+Y+I +F+++   Y+D V + L    +    Y  ++E C  +
Sbjct: 208 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLDPIHAF-ITYNLFKEHCLYK 266

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDS 341
            GV ++KD+  +      +RDL + +IID  P +Y +  +NAI +  W     D 
Sbjct: 267 DGV-HIKDLSKL------NRDLGKTVIIDCDPNAYKLQPENAIPMKPWDGKADDG 314

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 61/115 (53%), Gaps = 8/115 (6%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+Y+I +F+++   Y + + + L    +    Y  ++E C  +
Sbjct: 224 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHAF-ISYNLFKEHCVYK 282

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDS 341
            GV ++KD+  +      +RD+++++IID  P +Y +  +NAI V  W     D 
Sbjct: 283 DGV-HIKDLSKL------NRDVNKVLIIDTEPNNYKLQPENAIPVKPWDGKADDE 330

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 62/114 (54%), Gaps = 8/114 (7%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+Y+I +F+++   Y + + + L    +    Y  ++E C  +
Sbjct: 232 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHAF-ISYSLFKEHCVYK 290

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSD 340
            GV ++KD+  +      +RD+++++IID  P +Y +  +NAI +  W  +  D
Sbjct: 291 DGV-HIKDLSKL------NRDVNKVLIIDTDPNNYKLQPENAIPMEPWKGEADD 337

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 62/116 (53%), Gaps = 9/116 (7%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+Y+I +F+++   Y++ + + L    +    Y  Y+E C  +
Sbjct: 213 WRTAKRPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDPIHAF-VSYNLYKEHCVYK 271

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSE 342
            G  ++KD+  +      +RDL +++IID  P +Y    +NAI V  W N  +D E
Sbjct: 272 EGT-HIKDLSKL------NRDLDKVLIIDCDPNNYKFQPENAIPVKPW-NGQADDE 319

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 60/114 (52%), Gaps = 8/114 (7%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+Y+I +F+++   YA+ + + L    +    Y  ++E C  +
Sbjct: 216 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAF-ITYNLFKEHCLYK 274

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSD 340
            GV ++KD+  +      +RDL +++IID    S+ +  +NAI +  W     D
Sbjct: 275 DGV-HIKDLSKL------NRDLGKVLIIDTDENSFKLQPENAIYLEPWDGKADD 321

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 60/114 (52%), Gaps = 8/114 (7%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+Y+I +F+++   YA+ + + +    +    Y  ++E C  +
Sbjct: 219 WRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMDPIHAF-ISYNLFKEHCVYK 277

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSD 340
            GV ++KD+  +      +RDL +++IID    SY +  +NAI +  W     D
Sbjct: 278 DGV-HIKDLSKL------NRDLKKVMIIDTDENSYKLQPENAIPMDPWDGKADD 324

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 59/108 (54%), Gaps = 8/108 (7%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+Y+I +F+++   Y+D + + L    +    Y  ++E C  +
Sbjct: 217 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLDPIHAF-VSYNLFKEHCLYK 275

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGW 334
            GV ++KD+  +      +RD  +++IID  P SY +  +NAI +  W
Sbjct: 276 DGV-HIKDLSKL------NRDEKKVLIIDVDPNSYKLQPENAIPMKPW 316

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 60/115 (52%), Gaps = 8/115 (6%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+Y+I +F+++   Y++ + + L    +    Y  ++E C  +
Sbjct: 187 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDPIHAF-ISYNLFKEHCVYK 245

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDS 341
            G  ++KD+  +      +RD++++IIID    +Y +  +NAI +  W     D 
Sbjct: 246 KG-KHIKDLSKL------NRDVNKVIIIDTDKNNYKLQPENAIPMKPWSGTADDE 293

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 57/108 (52%), Gaps = 8/108 (7%)

Query: 227 YNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLR 286
           +  AKRP  D FL   SQ+Y+I +F+++   +++ + + L    +    Y  ++E C  +
Sbjct: 223 WRTAKRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKLDPIHAF-ITYNLFKEHCVYK 281

Query: 287 PGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGW 334
            G+ ++KD+  +      +RDL + IIID    ++ +  +NAI    W
Sbjct: 282 DGI-HIKDLSHL------NRDLGKTIIIDTDANAFKLQPENAIHAEPW 322

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 61/116 (52%), Gaps = 8/116 (6%)

Query: 225 TLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCT 284
           T +  AKRP  D FL   SQ+Y+I +F+++   Y++ + + L    +    Y  ++E C 
Sbjct: 205 TGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSERIAEKLDPLHAF-ISYNLFKEHCV 263

Query: 285 LRPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSD 340
            +  V ++KD+  +      +RD+ +++I+D    SY +  +NA+ +  W   P D
Sbjct: 264 YKDHV-HIKDLSKL------NRDVRKVVIMDTDANSYKLQPENALPMAPWDGKPDD 312

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 53/110 (48%), Gaps = 8/110 (7%)

Query: 232 RPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPGVGY 291
           RP  D  L   S +Y+  +F ++   Y+  V++ L    +    Y  +++ C  + G+ +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLDPIRAF-ITYNLFKDHCVYKDGI-H 274

Query: 292 VKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDS 341
           +KD+  +      +RDL + +IID  P S  + ++NAI    W     D+
Sbjct: 275 IKDLSHL------NRDLGKTLIIDTDPNSVKLQMENAILAEPWDGKADDA 318

>KLTH0C03278g Chr3 (285155..286954) [1800 bp, 599 aa] {ON} similar
           to uniprot|P00724 Saccharomyces cerevisiae YIL162W SUC2
          Length = 599

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 27/59 (45%), Gaps = 5/59 (8%)

Query: 161 PKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNP-----SGTTPMIHLV 214
           P K  P S +      L  L +   +  S SNSRS G  TD  P     SGT P++HL 
Sbjct: 23  PNKRKPFSKMQLLGSALGALVIAAGVTASQSNSRSRGKNTDSQPQFNASSGTRPLVHLT 81

>Suva_2.1 Chr2 complement(1..888) [888 bp, 296 aa] {ON} YGR287C
           (REAL)
          Length = 296

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 266 LQQTCSVQFHYRWYREDCTL---RPGVGYVKDIGTVATQIETSRDLSQMIIIDNSPIS 320
           L+  CS Q    W  EDC +      VGY  D G    +I+     S+++ + ++P++
Sbjct: 175 LRLFCSTQPDLNWENEDCRMAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVT 232

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,180,542
Number of extensions: 1648202
Number of successful extensions: 4684
Number of sequences better than 10.0: 82
Number of HSP's gapped: 4686
Number of HSP's successfully gapped: 94
Length of query: 374
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 263
Effective length of database: 40,753,473
Effective search space: 10718163399
Effective search space used: 10718163399
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)