Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E18569g2.532ON21521511481e-162
ZYRO0B01980g2.532ON1881501772e-15
KLTH0D06820g2.532ON2601651541e-11
TPHA0C041802.532ON2642081504e-11
KNAG0C058202.532ON2711491276e-08
CAGL0K02981g2.532ON2781661232e-07
Smik_13.2482.532ON2551691222e-07
Agos_YGOB_Anc_2.5322.532ON1871441184e-07
NDAI0I022702.532ON2771801204e-07
KAFR0A018502.532ON2562021205e-07
SAKL0A09460g2.532ON2401641125e-06
YMR069W (NAT4)2.532ON2851581046e-05
TBLA0G022202.532ON2781921021e-04
TDEL0A030602.532ON2441861002e-04
Ecym_72562.532ON243181992e-04
Kpol_1018.342.532ON292166992e-04
NCAS0D026402.532ON260166983e-04
Kwal_26.80162.532ON240157850.013
KLLA0A12089gsingletonON18163820.026
Skud_13.2252.532ON254157800.069
Skud_6.558.58ON159108760.14
Skud_4.4458.381ON149384740.61
Smik_6.628.58ON159108710.64
SAKL0H06006g8.697ON16958672.1
KLTH0F13838g7.166ON74862692.4
YKL092C (BUD2)2.490ON1104148683.2
YLL040C (VPS13)4.14ON3144150673.7
SAKL0D03784g3.257ON95083664.8
TPHA0P017702.8ON982164649.8
NOTE: 1 genes in the same pillar as KLLA0E18569g were not hit in these BLAST results
LIST: Suva_13.244

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E18569g
         (215 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa] ...   446   e-162
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...    73   2e-15
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...    64   1e-11
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...    62   4e-11
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...    54   6e-08
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...    52   2e-07
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...    52   2e-07
Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187...    50   4e-07
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...    51   4e-07
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...    51   5e-07
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...    48   5e-06
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...    45   6e-05
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...    44   1e-04
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...    43   2e-04
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    43   2e-04
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...    43   2e-04
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...    42   3e-04
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    37   0.013
KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} simil...    36   0.026
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...    35   0.069
Skud_6.55 Chr6 complement(106216..106695) [480 bp, 159 aa] {ON} ...    34   0.14 
Skud_4.445 Chr4 (788199..792680) [4482 bp, 1493 aa] {ON} YDR180W...    33   0.61 
Smik_6.62 Chr6 complement(117406..117885) [480 bp, 159 aa] {ON} ...    32   0.64 
SAKL0H06006g Chr8 complement(532245..532754) [510 bp, 169 aa] {O...    30   2.1  
KLTH0F13838g Chr6 (1136917..1139163) [2247 bp, 748 aa] {ON} simi...    31   2.4  
YKL092C Chr11 complement(266145..269459) [3315 bp, 1104 aa] {ON}...    31   3.2  
YLL040C Chr12 complement(54211..63645) [9435 bp, 3144 aa] {ON}  ...    30   3.7  
SAKL0D03784g Chr4 (308125..310977) [2853 bp, 950 aa] {ON} simila...    30   4.8  
TPHA0P01770 Chr16 complement(367690..370638) [2949 bp, 982 aa] {...    29   9.8  

>KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa]
           {ON} no similarity
          Length = 215

 Score =  446 bits (1148), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 215/215 (100%), Positives = 215/215 (100%)

Query: 1   MSNYHSRNLRRVAGVLCQELNSTGDSDVVCEVFSNRVHSGDPNYLGSTLPKCLAIIKQNL 60
           MSNYHSRNLRRVAGVLCQELNSTGDSDVVCEVFSNRVHSGDPNYLGSTLPKCLAIIKQNL
Sbjct: 1   MSNYHSRNLRRVAGVLCQELNSTGDSDVVCEVFSNRVHSGDPNYLGSTLPKCLAIIKQNL 60

Query: 61  STFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRDTTKIVGFTSVAL 120
           STFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRDTTKIVGFTSVAL
Sbjct: 61  STFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRDTTKIVGFTSVAL 120

Query: 121 SDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIFNGLLIPLARDLTCPSIELCVF 180
           SDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIFNGLLIPLARDLTCPSIELCVF
Sbjct: 121 SDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIFNGLLIPLARDLTCPSIELCVF 180

Query: 181 TANDVACRWYKRLGFQLTVEFSEHLIGMSRVIGAS 215
           TANDVACRWYKRLGFQLTVEFSEHLIGMSRVIGAS
Sbjct: 181 TANDVACRWYKRLGFQLTVEFSEHLIGMSRVIGAS 215

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score = 72.8 bits (177), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 78/150 (52%), Gaps = 12/150 (8%)

Query: 49  LPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRD 108
           L K L +I+ NL ++Y  +  +IY        K N++W   KW EM  ++L ++  +  +
Sbjct: 21  LEKQLQLIEINLGSYYNKYNKTIY--------KNNKRWQSNKWQEMCSENLFHVSYWNVE 72

Query: 109 TTKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIFNGLLIPLAR 168
           + ++V F S+   +    E + S +    ++LYEIH+  E++++  G  I N L   L  
Sbjct: 73  SNELVCFCSIMPCEESIVEGEMSNI----IYLYEIHVAPEWRNQKFGKSILNALKEKLCP 128

Query: 169 DLTCPSIELCVFTANDVACRWYKRLGFQLT 198
                 IEL VF++N+ A  +Y+  GF L+
Sbjct: 129 KAHLSGIELTVFSSNERAINFYRNNGFTLS 158

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 74/165 (44%), Gaps = 20/165 (12%)

Query: 42  PNYLGSTLPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVY 101
           P      L + L+++  NL   Y  H  +IY       G G + W   K  EM    LVY
Sbjct: 71  PRPPADLLDQLLSLVTANLGPMYTRHARAIY-------GAGRQSWPARKRAEMETPGLVY 123

Query: 102 IVLFKRDTTKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLI--- 158
           +V     +  +V F S+ L+D   PEL      R  L+L+EIH+    + +GLG+ +   
Sbjct: 124 VVYSDSHSQPLV-FMSLLLTD--EPELGQELAAR-VLYLFEIHVSDIIRGQGLGTHLLRD 179

Query: 159 -FNGLLIPLARDLTCPSI---ELCVFTANDVACRWYKRLGFQLTV 199
              G L  L+R    PS+   EL VF+ N  A R Y  LG  +  
Sbjct: 180 CLGGTLASLSR--ASPSVLGAELTVFSENQRALRLYLALGMHVAA 222

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score = 62.4 bits (150), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 91/208 (43%), Gaps = 26/208 (12%)

Query: 4   YHSRNLRRVAGVLCQELNSTGDSDVVCEVFSNR--VHSGDPNYLGSTLPKCLAIIKQNLS 61
           Y ++NL ++   +    + T D     E+++ R   +S +         K L I+  NL 
Sbjct: 20  YVNKNLTKLVKKIIVVDSETEDIKNSAELYNGRYLTYSQNKEECEIEFSKILTILDNNLG 79

Query: 62  TFYELHGSSIYNYTDDDKGKGNEK-WIRFKWDEMLDKDLVYIVLFKRDTTKIVG----FT 116
             Y +    +Y         GN K W   K  EM  + L+Y+V    D  K V     FT
Sbjct: 80  DIYTIKNKKLY---------GNSKPWKENKIQEMKTEGLIYVVYHLEDEKKTVSLYLSFT 130

Query: 117 SVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIFNGLLIPLARDL------ 170
               S  L P++D   +  P ++LYEI L  E ++ GLG+ +  G L     D+      
Sbjct: 131 LTKESGFL-PDID---VFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIHK 186

Query: 171 TCPSIELCVFTANDVACRWYKRLGFQLT 198
               IEL VF+ N  A R+Y+ +G +LT
Sbjct: 187 DIIGIELTVFSDNTNAIRFYETIGMKLT 214

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 68/149 (45%), Gaps = 13/149 (8%)

Query: 53  LAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEK-WIRFKWDEMLDKDLVYIVLFKRDTTK 111
           L I+  NL   Y      IY         GN K W   KW EML   LVY+  +  D+  
Sbjct: 87  LEILDNNLGPVYARLSRKIY---------GNSKHWRENKWLEMLSAQLVYVSYWVSDSEP 137

Query: 112 IVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIFNGLLIPLARDLT 171
           ++ +TS  L++     +   +     ++LYEI L+   + + LG  I + L         
Sbjct: 138 VL-YTSFMLTEENG--ISSIESTDRVVYLYEIQLIEAIRRQKLGQAIVSYLTECALESPE 194

Query: 172 CPSIELCVFTANDVACRWYKRLGFQLTVE 200
             ++ L VF+ N+ A ++Y+RL F  T++
Sbjct: 195 VAAVALTVFSDNEKALKFYERLNFTYTID 223

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 74/166 (44%), Gaps = 25/166 (15%)

Query: 49  LPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEK-WIRFKWDEMLDKDLVYIVLFKR 107
           L   L ++ QNL   YE+    +Y         GN+K W   K +EM  + ++Y+  + +
Sbjct: 79  LSSLLELLDQNLGQKYEISSKEMY---------GNKKPWKENKIEEMNTEGMIYVSYWTK 129

Query: 108 ---DTTKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIFNGLLI 164
              + T  + F S  L++  N  L H+      +FLYEI +  E + +GLG    +  L 
Sbjct: 130 VDDEHTVPLLFLSFMLTEEEN--LTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLF 187

Query: 165 PLAR--------DLTCP--SIELCVFTANDVACRWYKRLGFQLTVE 200
             A+        +L  P   IEL VF  N  A   Y++LG   T E
Sbjct: 188 QCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPE 233

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 79/169 (46%), Gaps = 23/169 (13%)

Query: 36  RVHSGDPNYLGSTLPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEK-WIRFKWDEM 94
           R+H    N++   L  C+ +I ++L   Y     ++Y         GN K W   K  EM
Sbjct: 61  RLHKSRGNHI---LDSCVQLIDEHLGAKYRRASRTMY---------GNRKPWKANKLAEM 108

Query: 95  LDKDLVYIVLFKRDTTKIVGFTSVALSDPLN-PELDHS-KLNRPCLFLYEIHLMGEYQSR 152
              +LVY+  +  D   +  F S  L++     E D + +++ P ++LYE+H+   ++  
Sbjct: 109 KSPNLVYVSYW--DNGALAAFASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGH 166

Query: 153 GLG-SLIFNGLLIPLARDLTCP-----SIELCVFTANDVACRWYKRLGF 195
           G+G  L+   L   +AR + C       + L VF+ N  A R Y+ LGF
Sbjct: 167 GIGRRLLERALCEGVARHVRCLYEEFFGVALTVFSDNTRARRLYEALGF 215

>Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187
           aa] {ON} ANNOTATED BY YGOB -
          Length = 187

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 63/144 (43%), Gaps = 19/144 (13%)

Query: 54  AIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRDTTKIV 113
           A++   L+  Y  H   +Y    D        W R K  E+LD   ++I L++    ++ 
Sbjct: 46  ALVAAGLAPLYRAHARLLYPRLRDPAA-----WPRCKRAELLDPAALHI-LYRDPAGRLA 99

Query: 114 GFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIFNGLLIPLAR-DLTC 172
            F S+ L  P +P           L++ E+H+   ++ RGL + + +          LT 
Sbjct: 100 CFISLLLPGPADP----------VLYILELHVAAPFRRRGLAAALLDAATRTARAAGLT- 148

Query: 173 PSIELCVFTANDVACRWYKRLGFQ 196
             +EL VFTAN  A   Y R GF+
Sbjct: 149 -RLELTVFTANRPALALYARAGFR 171

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 80/180 (44%), Gaps = 28/180 (15%)

Query: 39  SGDPNYLGSTLPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKD 98
           S DP      L K L I+  NL   Y     +IY   ++DK      W   K +EML   
Sbjct: 57  SSDPQQRSDVLNKFLNILDVNLGAKYTKVSKTIY---ENDKS-----WKSNKLEEMLSPG 108

Query: 99  LVYIVLFKRDTTKIVGFTSVALSD---------PLNPELDHSKLNRPCLFLYEIHLMGEY 149
           L+Y+  +     + + F S  L++           + E +H+      ++LYEI ++ + 
Sbjct: 109 LIYVSYWDEKYQEPLLFLSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQL 168

Query: 150 QSRGLGSLIFN--------GLLIPLARD-LTCP--SIELCVFTANDVACRWYKRLGFQLT 198
           + +G+G+ + +         L+    +D L  P   IEL VF+ N  A  +YK +G +LT
Sbjct: 169 RGQGIGTKLLSVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLT 228

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 90/202 (44%), Gaps = 22/202 (10%)

Query: 7   RNLRRVAGVLCQELNSTGDSDVVCEVFSNRVHSGDPNYLGSTL-PKCLAIIKQNLSTFYE 65
           +NL+R    +  E     +SD V     +     +   +GS L    L I+  NL   YE
Sbjct: 27  QNLKRKILYIASEDEENKESDSVINEQDDLTKFTEG--IGSKLLDSFLEILDNNLGNKYE 84

Query: 66  LHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRDTTKIVG--FTSVALSDP 123
                IY+         N+ W + K  EM    L+Y+  +K +  K     F S  L++ 
Sbjct: 85  KISREIYD--------NNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCALFLSFMLTEE 136

Query: 124 LNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIFNGL--LIPLARDLTCPS-----IE 176
                D  K +   ++LYEI L+ +Y+   LG+ +  GL  +  +A+    P+     I+
Sbjct: 137 DFVVDDIRKFS--VIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIGIQ 194

Query: 177 LCVFTANDVACRWYKRLGFQLT 198
           L VF+ N  A ++Y+R+G + T
Sbjct: 195 LTVFSDNKRAIKFYERIGMKFT 216

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 71/164 (43%), Gaps = 19/164 (11%)

Query: 39  SGDPNYLGSTLPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKD 98
           SGD     S L + L ++  NL + Y    +++Y  T          W   K +EM    
Sbjct: 53  SGDRQSSNSLLIQFLKVLDLNLGSKYRSVSATLYGNT--------RSWTENKLEEMQTIG 104

Query: 99  LVYIVLFKRDTTKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLI 158
           LVY+  F+  +  +  F S  L+D    E D        ++LYEI L+ E Q + LG+ +
Sbjct: 105 LVYVGYFQGVSPLM--FLSFLLTD----EPDFLPDPVKVVYLYEIQLLPEVQGQRLGTQM 158

Query: 159 FNGLLI----PLAR-DLTCPSIELCVFTANDVACRWYKRLGFQL 197
               L      L+R D     IEL VF+ ND A   Y  +G  L
Sbjct: 159 LQVYLKNTVHSLSRLDPLLKGIELTVFSDNDAALHLYYSIGMAL 202

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 72/158 (45%), Gaps = 20/158 (12%)

Query: 47  STLPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEK-WIRFKWDEMLDKDLVYIVLF 105
             L  C+ +I ++L   Y      +Y         GN K W   K  EM    LVY+  +
Sbjct: 99  QVLDACVQLIDKHLGAKYRRASRIMY---------GNRKPWKANKLAEMKSAGLVYVCYW 149

Query: 106 KRDTTKIVGFTSVALSDPLN-PELDH-SKLNRPCLFLYEIHLMGEYQSRGLG-SLIFNGL 162
             D   +  FTS  L++     E D   +++ P ++LYE+H+   ++  G+G  L+ + L
Sbjct: 150 --DNGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHAL 207

Query: 163 LIPLARDL--TCPS---IELCVFTANDVACRWYKRLGF 195
              +AR     C +   + L VF+ N  A R Y+ LGF
Sbjct: 208 CDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEALGF 245

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 84/192 (43%), Gaps = 22/192 (11%)

Query: 16  LCQELNSTGDSDVVCEVFSNRVHSGDPNYLGSTLPKCLAIIKQNLSTFYELHGSSIYNYT 75
           L  + N+  + D +   F +R +    N + + +     +I +NL   Y+     IY   
Sbjct: 41  LLSDQNNNSNDDEIYWYFKDRKNPTVENIIKTQI---FQLIDENLGKLYKKKSKKIY--- 94

Query: 76  DDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRDTTKIVGFTSVALSDPLNPELDHSKLNR 135
                + +  W   K +EM   +++YI  +      +  F S+ LS      L+++    
Sbjct: 95  -----ENDLDWSINKREEMFTSNMIYITYWDCKQNSVALFLSI-LSCEETYILENNDQGE 148

Query: 136 PCLFLYEIHLMGEYQSRGLGSLIFNGLLI-----PLA---RDLTCPSIELCVFTANDVAC 187
             L+LYEIH+  EYQ +G+G  +    LI     PL    +D     +EL VF+ N+ A 
Sbjct: 149 -VLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKIERQDNNFIGLELTVFSENNDAQ 207

Query: 188 RWY-KRLGFQLT 198
            +Y  ++  Q T
Sbjct: 208 NFYFNKIQMQYT 219

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 70/186 (37%), Gaps = 32/186 (17%)

Query: 37  VHSGDPNYLGSTLPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLD 96
           VHS  P      L + L I+ +NL   Y     ++Y+ T          W   KW EML 
Sbjct: 51  VHS--PREAEKLLWQLLEILDENLGQKYAGSSRALYHNT--------RPWRVNKWREMLT 100

Query: 97  KDLVYIV--------LFKRDTTKI--VGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLM 146
             LVY++          +R       + F S  L++      D        L+LYE+ L+
Sbjct: 101 PGLVYVIYSTAATTTATQRRNAPFSPLLFLSFMLTEEDGLVADDPTEVWTVLYLYELQLL 160

Query: 147 GEYQSRGLGSLIFNGLLIPLARDLTCPS------------IELCVFTANDVACRWYKRLG 194
              +  GL + +    L    R L   S            +EL VF  N  A R Y+ LG
Sbjct: 161 PRVRRLGLAARLLGDHLAQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLG 220

Query: 195 FQLTVE 200
            QL  +
Sbjct: 221 MQLAAD 226

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 69/181 (38%), Gaps = 48/181 (26%)

Query: 54  AIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRDTT-KI 112
           AII++ L  FY++H   +Y      +      W   K  E+      +++  K +    I
Sbjct: 52  AIIERTLGCFYDVHAHLLYPRLTRSR-----PWQAHKRAELQGLGTCHVLYRKENPGGAI 106

Query: 113 VGFTSVALSD--------------------------PLNPELDHSKLNRPCLFLY--EIH 144
            GF S+   D                             P  + +    PC  +Y  EIH
Sbjct: 107 AGFVSLLFCDEPHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKVVYVMEIH 166

Query: 145 LMGEYQSRGLGSLIFNGLLIPLARDLTC---PS------IELCVFTANDVACRWYKRLGF 195
           +   +Q++GLGS      ++  AR L     PS      +EL VFT N  A   Y+R GF
Sbjct: 167 VSPSFQNQGLGSC-----MLLCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGF 221

Query: 196 Q 196
           +
Sbjct: 222 K 222

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 76/166 (45%), Gaps = 27/166 (16%)

Query: 49  LPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEK-WIRFKWDEMLDKDLVYIVLFKR 107
           L K L I+  NL   Y    S IY          NEK W   K  EM  + L+Y++    
Sbjct: 69  LNKLLDILDNNLGPIYLEKSSKIY---------CNEKPWKENKIVEMKSEGLLYVIYNDD 119

Query: 108 DTTKIVGFTSVALSDPLNPEL------DHSKLNR---PCLFLYEIHLMGEYQSRGLGSLI 158
            T + + F S  ++D  +P L      D ++L+      ++LYEI L+   +++ LG+++
Sbjct: 120 ITKEPLLFMSFMITD--DPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLGTIL 177

Query: 159 FNGLLIP----LARDL--TCPSIELCVFTANDVACRWYKRLGFQLT 198
               L      L +D      ++EL VF+ N  A  +YK++G   T
Sbjct: 178 ITNYLKKTIEILNKDYQKNIIALELTVFSNNINAINFYKKIGMLYT 223

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 72/166 (43%), Gaps = 32/166 (19%)

Query: 49  LPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRD 108
           L + L I+  NL   Y      IY        +    W   K +EM    LVY+  +  +
Sbjct: 65  LDQFLDILDVNLGEKYTKVSKKIY--------ENARPWKVNKLEEMRSPGLVYVSYWDEE 116

Query: 109 TTKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIF--------- 159
           + + + F S  L++      D   L+   ++LYEI ++   ++R LG+ +          
Sbjct: 117 SDEPMLFLSFMLTEEDGFTEDDKLLS--VVYLYEIQILPSLRNRKLGTRLLAEHLQDACS 174

Query: 160 -----NGLLI--PLARDLTCPSIELCVFTANDVACRWYKRLGFQLT 198
                NG L+  PL        IEL VF+ N+ A ++YK +G +LT
Sbjct: 175 RLRSENGELLEYPLI------GIELTVFSDNENAIKFYKSIGMELT 214

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 63/157 (40%), Gaps = 13/157 (8%)

Query: 49  LPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRD 108
           L + LA++  NL   Y  H  ++Y       G     W   K  EM+   LVY+V    D
Sbjct: 53  LEQLLALVDSNLGPVYAQHAKALY-------GDQCGSWKERKRQEMVTPGLVYVVYRAVD 105

Query: 109 T-TKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIFNGLLIPLA 167
             T   G     LS  L  E +        ++L EIH+    +  GLG  +    +    
Sbjct: 106 EETGKEGLPLAFLSLLLTDEPELGPAPAAVVYLMEIHVADIIRGLGLGGTLLREGVAGTV 165

Query: 168 RDL--TCPSI---ELCVFTANDVACRWYKRLGFQLTV 199
           R      P I   EL VFT N+ A R Y RLG Q+  
Sbjct: 166 RGARRAHPFIQGTELTVFTDNEGALRLYLRLGMQIAA 202

>KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} similar
           to uniprot|Q5WCY3 Bacillus clausii ABC3243 paiA
           Septation and degradation transcriptional repressor of
           sporulation
          Length = 181

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 140 LYEIHLMGEYQSRGLGSLIFNGLLIPLARDLTCPSIELCVFTANDVACRWYKRLGFQLTV 199
           L  I+++ +YQ +GLG ++ + +   +A+      I L V+  N  A  +YK+ GF++T 
Sbjct: 102 LQRIYILQKYQGKGLGRVLMDKVH-DIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFEITG 160

Query: 200 EFS 202
           + S
Sbjct: 161 DHS 163

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score = 35.4 bits (80), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 66/157 (42%), Gaps = 20/157 (12%)

Query: 48  TLPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNE-KWIRFKWDEMLDKDLVYIVLFK 106
            L  C+ ++ ++L   Y     ++Y         GN   W   K  EM    L+Y+  + 
Sbjct: 69  VLDSCVQLVDEHLGDKYRRASRTMY---------GNRIPWKANKLAEMKSAGLLYVSYWG 119

Query: 107 RDTTKIVGFTSVALSDPLN-PELDHS-KLNRPCLFLYEIHLMGEYQSRGLGSLIFNGLLI 164
                +  F S  L++     E D + +++ P ++LYEIH+   ++  GLG  +    L 
Sbjct: 120 NGA--LGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGLGRRLLERALC 177

Query: 165 P----LARDLTCP--SIELCVFTANDVACRWYKRLGF 195
                  R + C    + L VF  N  A R Y+ +GF
Sbjct: 178 EGVARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGF 214

>Skud_6.55 Chr6 complement(106216..106695) [480 bp, 159 aa] {ON}
           YFL017C (REAL)
          Length = 159

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 49/108 (45%), Gaps = 13/108 (12%)

Query: 91  WDEMLDKDLVY---IVLFKRDTTKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMG 147
           WDE  DK ++    IV+  R T  I    ++ +   +  EL        C  + +I +  
Sbjct: 51  WDENNDKQIMQYNPIVIVDRRTESIAATGNILIERKIIHELG------LCGHIEDIAVNS 104

Query: 148 EYQSRGLGSLIFNGLLIPLARDLTCPSIELCVFTANDVACRWYKRLGF 195
           +YQ +GLG L+ +  L+ +     C  I   +   ++   ++YK+ GF
Sbjct: 105 KYQGQGLGKLLIDQ-LVAIGFGYGCYKI---ILDCDEKNVKFYKKCGF 148

>Skud_4.445 Chr4 (788199..792680) [4482 bp, 1493 aa] {ON} YDR180W
            (REAL)
          Length = 1493

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 12/84 (14%)

Query: 6    SRNLRRVAGVLCQELNS-------TGDSDVVCEVFSNRVHSGDP-----NYLGSTLPKCL 53
            SR +RRVA  + ++L         +G S  + +  +  +H+GD      NY  ++L K  
Sbjct: 1261 SRYIRRVAHEILEDLFEKYETLVFSGLSRGITKAINYSIHTGDESYYKHNYFFASLEKLC 1320

Query: 54   AIIKQNLSTFYELHGSSIYNYTDD 77
               K+N   FY++    I +Y DD
Sbjct: 1321 GTGKKNTPKFYKIMKRIIQSYLDD 1344

>Smik_6.62 Chr6 complement(117406..117885) [480 bp, 159 aa] {ON}
           YFL017C (REAL)
          Length = 159

 Score = 32.0 bits (71), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 50/108 (46%), Gaps = 13/108 (12%)

Query: 91  WDEMLDKDLVY---IVLFKRDTTKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMG 147
           WD+  DK ++    IV+  + T KI    ++ +   +  EL        C  + +I +  
Sbjct: 51  WDDNNDKKIMQYNAIVIVDKHTEKIAATGNIFIEKKIIHELG------LCGHIEDIAVNS 104

Query: 148 EYQSRGLGSLIFNGLLIPLARDLTCPSIELCVFTANDVACRWYKRLGF 195
           +YQ +GLG L+ +  L+ +     C  I   +   ++   ++Y++ GF
Sbjct: 105 KYQGQGLGKLLIDE-LVTIGYGYGCYKI---ILDCDEKNVKFYEKCGF 148

>SAKL0H06006g Chr8 complement(532245..532754) [510 bp, 169 aa] {ON}
           similar to uniprot|Q08689 Saccharomyces cerevisiae
           YOR253W NAT5 Subunit of the N-terminal acetyltransferase
           NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
           proteins which influences multiple processes such as the
           cell cycle heat-shock resistance mating sporulation and
           telomeric silencing
          Length = 169

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 138 LFLYEIHLMGEYQSRGLGSLIFNGLLIPLARDLTCPSIELCVFTANDVACRWYKRLGF 195
           +++  + ++  Y+ +G+GS +    +    +D     I + V T N VA  WYK+ GF
Sbjct: 86  VYIEVLAVLSAYRDKGIGSKLLE-FIEQQCKDHFQHDIYVHVATDNSVALEWYKKKGF 142

>KLTH0F13838g Chr6 (1136917..1139163) [2247 bp, 748 aa] {ON} similar
           to uniprot|P39518 Saccharomyces cerevisiae YER015W FAA2
           Long chain fatty acyl-CoA synthetase accepts a wider
           range of acyl chain lengths than Faa1p preferring
           C9:0-C13:0 involved in the activation of endogenous
           pools of fatty acids
          Length = 748

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 34  SNRVHSGDPNYLGSTLPKCL-AIIKQNLSTFYELHGSSIYNYTDDD-KGKGNEKWIRFKW 91
           S++ H   P +  S  P+CL + +   LSTF+EL   S+  + D+D  G+ ++  +   W
Sbjct: 66  SSKKHGYSPVFRSSLSPECLVSNVHPRLSTFFELFNFSVERFPDNDCLGQRSQDRVTGHW 125

Query: 92  DE 93
            +
Sbjct: 126 GQ 127

>YKL092C Chr11 complement(266145..269459) [3315 bp, 1104 aa] {ON}
           BUD2GTPase activating factor for Rsr1p/Bud1p required
           for both axial and bipolar budding patterns; mutants
           exhibit random budding in all cell types
          Length = 1104

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 65/148 (43%), Gaps = 17/148 (11%)

Query: 49  LPKC-LAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKR 107
           L +C + IIK   S+F +++ +  +    +  GK N+ ++R K      K L  ++ +  
Sbjct: 80  LQQCRIEIIKDKHSSFKDINANCNFIIQVNTSGKDNKVYLRVKSWSDFKKLLTCLIWWSS 139

Query: 108 DTTKIVGFTSVALSDPLNPELDHSKLNRP-CLFLYEIHLMGEYQSRGLGSLIFNGLLIPL 166
             T  + F    +S PL  E    K+ +P  L +Y++++         G ++ N +L P 
Sbjct: 140 MKTNGI-FNKFQVSRPL--EFKSKKMAKPESLLVYKLNV--------FGPIVKNIVLPPA 188

Query: 167 ARDLTCPSIELCVFTANDVACRWYKRLG 194
              L  P I       +D +  W+  +G
Sbjct: 189 TNILESPDI----INNDDNSVGWFSAMG 212

>YLL040C Chr12 complement(54211..63645) [9435 bp, 3144 aa] {ON}
            VPS13Protein of unknown function; heterooligomeric or
            homooligomeric complex; peripherally associated with
            membranes; involved in sporulation, vacuolar protein
            sorting, prospore membrane formation and protein-Golgi
            retention; homologous to human CHAC and COH1 which are
            involved in chorea acanthocytosis and Cohen syndrome,
            respectively
          Length = 3144

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 58/150 (38%), Gaps = 30/150 (20%)

Query: 6    SRNLRRVAGVLCQELNSTGDSDVVCEVFSNRVHSGD-PNYLGSTLPKCLAIIKQNLSTFY 64
            SRN  ++  +LCQ LN   D          RVHS D  +Y+  T  K           F 
Sbjct: 918  SRNSEKLVDILCQRLNFNFDKRAKEMNLDLRVHSLDVEDYIELTDNK----------EFK 967

Query: 65   ELHGSSIYNYTDDDKGKGNEKWIRFK--------WDEMLDKDLVY------IVLFKRDTT 110
             L  S +   T   K     K+ R +          E+ D+D+V       +VL  R   
Sbjct: 968  NLISSGVEKVTRSQKDLFTLKYKRVQRIVPHNDTLIELFDQDIVMHMSELQLVLTPRSVL 1027

Query: 111  KIVGFTSVALSDPLNPE-----LDHSKLNR 135
             ++ +  +  +DP  PE     L H+K +R
Sbjct: 1028 TLMNYAMLTFTDPNAPEMPADVLRHNKEDR 1057

>SAKL0D03784g Chr4 (308125..310977) [2853 bp, 950 aa] {ON} similar
           to uniprot|Q12071 Saccharomyces cerevisiae YDR027C VPS54
           Component of the GARP (Golgi-associated retrograde
           protein) complex
          Length = 950

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 37/83 (44%), Gaps = 20/83 (24%)

Query: 44  YLGSTLPKCLAI-IKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYI 102
           +L   L   LA+ IK  +ST   LH  +I N  D       EKWI F  D  L KD+  I
Sbjct: 718 FLTKYLSDVLAVQIKNYVSTMSSLHLKTIQNKID------QEKWIPFVVDGGLQKDVNDI 771

Query: 103 VLFKRDTTKIVGFTSVALSDPLN 125
           +            +SV L DPLN
Sbjct: 772 I------------SSVDL-DPLN 781

>TPHA0P01770 Chr16 complement(367690..370638) [2949 bp, 982 aa] {ON}
           Anc_2.8 YNL236W
          Length = 982

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 72/164 (43%), Gaps = 16/164 (9%)

Query: 52  CLAIIKQ-NLSTFYELHGS------SIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVL 104
           CLA+ K   +  +Y+   S      S++  T   K   +  W+ +     L++D   ++ 
Sbjct: 238 CLAVRKNGQIDFWYQFSNSKSHKKISLHLNTAQGKSSNDMDWVEYTNISALNEDQSLLIS 297

Query: 105 FKRDTTKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLI-FNGLL 163
                TK+V F  + ++  +  ++++S+LN P L L+ +  +   Q    G+L+ F  L 
Sbjct: 298 TYSRLTKVVSFYKLHVNWNIT-DINNSQLNDPLLSLFHLSDVAVEQIDDEGNLLEFQYLY 356

Query: 164 I----PLARDLTCPSIELC--VFTANDVACRWYKRLGFQLTVEF 201
           +    P+ +D + P I L   V        + YK +  QL   +
Sbjct: 357 VISKAPVEKD-SAPEILLLYNVLDTGKSIIKRYKLIPTQLNAHY 399

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.139    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,827,815
Number of extensions: 1121610
Number of successful extensions: 2237
Number of sequences better than 10.0: 31
Number of HSP's gapped: 2263
Number of HSP's successfully gapped: 31
Length of query: 215
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 110
Effective length of database: 41,441,469
Effective search space: 4558561590
Effective search space used: 4558561590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 63 (28.9 bits)