Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E18547g2.533ON43143113171e-180
SAKL0A09482g2.533ON3881323169e-32
Ecym_72552.533ON5441383017e-29
KNAG0C058102.533ON5541222982e-28
NDAI0H014002.533ON5411432945e-28
TDEL0A030702.533ON2391242736e-27
KAFR0A018602.533ON4901212839e-27
TPHA0G035102.533ON3871402772e-26
AGL071C2.533ON3961272712e-25
ZYRO0B02002g2.533ON2941242582e-24
TBLA0G022302.533ON2161232523e-24
Smik_13.2492.533ON4731392643e-24
NCAS0F009002.533ON5251322644e-24
Kpol_1018.332.533ON5891192654e-24
NCAS0A048002.533ON5111232644e-24
Kwal_26.80212.533ON5071222627e-24
Skud_13.2262.533ON475702618e-24
YMR070W (MOT3)2.533ON490742592e-23
NDAI0K018602.533ON7301342584e-23
KLTH0D06842g2.533ON5061212547e-23
TBLA0I014802.533ON513762549e-23
Suva_13.2462.533ON419672501e-22
CAGL0K03003g2.533ON6471222461e-21
KAFR0J003402.533ON218752058e-18
TPHA0C041902.533ON417521952e-15
KNAG0A070402.533ON352581888e-15
Kwal_26.80112.531ON190541385e-09
SAKL0B11330g2.598ON499561402e-08
NCAS0A129102.598ON822551392e-08
Kwal_26.83512.598ON698561383e-08
KLTH0D08734g2.598ON677551365e-08
KLLA0F26961g2.598ON694551365e-08
TPHA0C025802.598ON365541339e-08
YKL062W (MSN4)2.598ON630561321e-07
Kpol_1013.212.598ON494551312e-07
Smik_11.1862.598ON641561322e-07
Kpol_185.32.598ON647501322e-07
ABR089C2.598ON571561312e-07
Skud_11.1672.598ON628561312e-07
Suva_13.2062.598ON709501303e-07
Skud_13.1932.598ON704501303e-07
CAGL0M13189g2.598ON541501293e-07
YMR037C (MSN2)2.598ON704501303e-07
KNAG0G012808.144ON472501293e-07
TBLA0G019202.598ON523501293e-07
TDEL0B069102.598ON437571283e-07
ZYRO0F01012g2.598ON584631294e-07
Ecym_23012.598ON767551294e-07
TPHA0N014602.598ON519511284e-07
Smik_13.2072.598ON703501294e-07
NDAI0C005602.598ON972501294e-07
KAFR0F020702.598ON370591275e-07
NDAI0B013402.598ON769551277e-07
Suva_11.1642.598ON639801251e-06
KNAG0H005502.598ON620501251e-06
KAFR0A023202.598ON443551241e-06
TBLA0G032403.298ON511591232e-06
NCAS0H030802.598ON730591232e-06
CAGL0F05995g2.598ON597501232e-06
TBLA0H028302.598ON746501214e-06
KLLA0F20636gsingletonON285501184e-06
Kpol_541.398.116ON291501184e-06
NCAS0C040708.144ON289671185e-06
TPHA0D010508.144ON439551187e-06
KAFR0B063608.425ON627541187e-06
KNAG0D021208.144ON402581179e-06
NDAI0B019308.144ON436581161e-05
TPHA0B003804.351ON1310581171e-05
KLTH0E06688g8.144ON397551161e-05
Kwal_23.54007.543ON429681152e-05
NCAS0B046008.144ON547501142e-05
YHR006W (STP2)5.586ON541781142e-05
Kpol_1052.83.298ON386521132e-05
Kpol_1001.14.351ON13411151152e-05
Skud_8.555.586ON535781142e-05
Smik_8.635.586ON542681133e-05
Kwal_47.172418.144ON403551133e-05
KAFR0B021608.144ON453501123e-05
SAKL0H24816g8.144ON410551123e-05
KNAG0C060305.586ON314671114e-05
NDAI0C06260na 1ON582641124e-05
Suva_13.704.351ON777471124e-05
TPHA0K002105.586ON481671124e-05
SAKL0E10714g2.162ON819641124e-05
TPHA0A039103.298ON351631105e-05
Suva_8.625.586ON545671115e-05
KAFR0B025508.234ON890521125e-05
Skud_13.614.351ON12531081125e-05
KAFR0H012903.298ON330631105e-05
SAKL0H04070g4.214ON899621125e-05
ACL057W8.144ON520501115e-05
SAKL0G06292g5.586ON517731115e-05
Ecym_84038.144ON573501115e-05
TBLA0I020603.298ON833511115e-05
Suva_2.3838.425ON1319601125e-05
TBLA0B061604.351ON1384591125e-05
YDR216W (ADR1)8.425ON1323601125e-05
NDAI0C006905.586ON650721116e-05
YDR463W (STP1)5.586ON519701106e-05
KNAG0M023102.598ON660501116e-05
NDAI0B042902.162ON1064781116e-05
Ecym_4128na 2ON312551096e-05
Smik_4.4638.425ON1324601117e-05
NCAS0B05750singletonON505511107e-05
YML081W (TDA9)4.351ON1251471117e-05
Smik_13.584.351ON1253471117e-05
NDAI0G034208.144ON484721098e-05
Skud_4.7395.586ON514701098e-05
TBLA0I027004.214ON737591108e-05
CAGL0E04312g5.586ON688721108e-05
Smik_4.7425.586ON528701098e-05
NCAS0A079005.586ON367671088e-05
Ecym_8387na 3ON179561049e-05
CAGL0L06072g8.144ON300481079e-05
KAFR0C003403.298ON394521089e-05
KAFR0C029808.144ON225631061e-04
CAGL0L05786g8.116ON348501081e-04
Smik_5.2768.144ON442581081e-04
KNAG0B033505.586ON600681091e-04
SAKL0H20416g8.116ON317501071e-04
NDAI0H011105.586ON454661081e-04
Skud_5.2488.144ON442581081e-04
KAFR0A067205.586ON235671061e-04
Skud_4.4788.425ON1323601091e-04
AGR186Cna 2ON287481061e-04
YER130C8.144ON443581081e-04
Kpol_1018.352.531ON517531081e-04
NCAS0B028408.425ON1152631091e-04
ADR308Cna 4ON278501061e-04
CAGL0K02145g8.144ON317501061e-04
SAKL0G18062g4.351ON1238561081e-04
KLLA0C17072g8.144ON474501071e-04
TDEL0B046708.144ON312551061e-04
SAKL0H20394g8.117ON359501071e-04
TBLA0E028205.586ON312671061e-04
NCAS0H028905.586ON532671071e-04
CAGL0M00594g4.351ON1020641081e-04
TDEL0D006704.351ON1199471081e-04
ZYRO0B11770g8.234ON867571081e-04
TDEL0A045305.586ON484841071e-04
ZYRO0G19140g8.144ON557501072e-04
KLTH0D18062g4.351ON1128871082e-04
Ecym_14045.586ON562671072e-04
Suva_5.2518.144ON449501072e-04
Ecym_27604.214ON938621072e-04
Suva_2.6395.586ON516671072e-04
TBLA0E047704.351ON1655471082e-04
Kpol_1031.428.144ON359501062e-04
SAKL0F16170g7.543ON437711062e-04
AEL278W7.543ON476651062e-04
ADL051Wna 5ON173501022e-04
CAGL0K04631g4.214ON1013571072e-04
NCAS0B069602.162ON839371062e-04
NCAS0C042308.117ON338501052e-04
TPHA0A019408.234ON912601062e-04
AER159C4.351ON1191561062e-04
KLLA0F10109g5.586ON623721062e-04
Suva_16.5187.543ON427681052e-04
Kwal_47.166214.351ON1178531063e-04
TDEL0E015904.214ON770621053e-04
Smik_16.4507.543ON432631053e-04
Smik_6.1504.214ON806571053e-04
TBLA0B060502.303ON762501053e-04
TBLA0F003708.144ON687501053e-04
Suva_16.766.256ON392531043e-04
TDEL0A013008.234ON837571053e-04
YGR067C4.214ON804611053e-04
Skud_7.3644.214ON810571053e-04
KNAG0G018708.234ON875521053e-04
KNAG0G011408.117ON519501043e-04
KLLA0B04477g4.351ON1332561053e-04
AFR461C5.586ON544711044e-04
KNAG0M003504.351ON1076471054e-04
KLTH0E09724g2.162ON768641044e-04
KNAG0I020702.162ON572541044e-04
ZYRO0B07568g4.214ON616601044e-04
Ecym_8388na 5ON223501014e-04
Kwal_47.178882.162ON786641044e-04
KNAG0A044608.425ON1290611044e-04
TBLA0F038308.234ON967521044e-04
Suva_7.3494.214ON812571044e-04
ZYRO0B14894g4.351ON1119471044e-04
ADL050Wna 3ON14662974e-04
KAFR0C031408.117ON370501025e-04
Ecym_35208.234ON819571045e-04
YPR186C (PZF1)7.543ON429631035e-04
NDAI0D032404.351ON1362751045e-04
AFR580C4.214ON838621035e-04
NCAS0G037302.303ON571691035e-04
TBLA0F013001.326ON985521036e-04
Smik_16.2538.116ON317501016e-04
CAGL0H04213g4.351ON1321561037e-04
TDEL0F011708.116ON16250977e-04
Suva_16.3358.116ON317501007e-04
ZYRO0D13992g5.586ON587671027e-04
Suva_8.1662.162ON948641027e-04
Kwal_27.114602.303ON531501018e-04
KAFR0C057105.586ON442671018e-04
Kpol_1032.528.234ON824571028e-04
NDAI0G058001.326ON836551028e-04
Skud_16.2988.116ON317501008e-04
AGR117C8.234ON799531028e-04
KNAG0J022503.296ON296571008e-04
TBLA0H006608.425ON1311661028e-04
NDAI0I029003.518ON524511018e-04
KLTH0G10802g2.303ON526501018e-04
YOR113W (AZF1)2.162ON914641028e-04
Kpol_495.20singletonON486531019e-04
AEL174W1.326ON661621019e-04
NCAS0B046708.116ON266128999e-04
TBLA0B049607.543ON448601000.001
Smik_15.2912.162ON909641010.001
KNAG0B005903.518ON439621000.001
Ecym_62951.326ON663521010.001
Skud_15.2762.162ON917641010.001
NCAS0A062504.351ON1341471010.001
Ecym_8011na 4ON27650990.001
Kpol_1023.635.586ON556671000.001
Suva_6.1321.326ON878611010.001
Skud_16.4907.543ON407531000.001
AGR172W8.425ON1057471010.001
KLLA0B07909g4.214ON922601000.001
ADL198W2.303ON547501000.001
ACR264W2.162ON769641000.001
SAKL0H17842g8.234ON814571000.001
CAGL0M01870g3.298ON31552990.001
TPHA0G002707.543ON47247990.001
TBLA0E04210singletonON45450990.001
YPR013C8.116ON31750980.001
CAGL0J01595g8.117ON34450980.001
TBLA0B012802.162ON823611000.001
NDAI0C048608.425ON1350521000.001
CAGL0L11880g8.234ON980571000.001
SAKL0E07216g2.303ON54850990.001
TBLA0E042208.234ON51953990.001
KAFR0B019908.116ON41050980.001
TPHA0D034003.518ON33857980.001
SAKL0H11440g8.486ON20547960.002
Smik_6.4356.256ON38657980.002
YJL056C (ZAP1)1.326ON88061990.002
KAFR0B045802.162ON72970990.002
NCAS0I014603.298ON33052970.002
KAFR0H032402.303ON51950980.002
KNAG0H034802.162ON79666990.002
NDAI0A075403.298ON37057970.002
NCAS0E006103.518ON40151970.002
TPHA0G008202.303ON53250980.002
YPL230W (USV1)6.256ON39148970.002
KNAG0H019302.303ON61850980.002
NDAI0G007202.303ON70856980.002
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E18547g
         (431 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...   511   e-180
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...   126   9e-32
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...   120   7e-29
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   119   2e-28
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...   117   5e-28
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...   109   6e-27
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   113   9e-27
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...   111   2e-26
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...   108   2e-25
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   103   2e-24
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...   101   3e-24
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...   106   3e-24
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...   106   4e-24
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...   106   4e-24
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...   106   4e-24
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...   105   7e-24
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...   105   8e-24
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...   104   2e-23
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...   103   4e-23
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...   102   7e-23
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...   102   9e-23
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...   100   1e-22
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...    99   1e-21
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       84   8e-18
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    80   2e-15
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    77   8e-15
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    58   5e-09
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    59   2e-08
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    58   2e-08
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    58   3e-08
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    57   5e-08
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    57   5e-08
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    56   9e-08
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    55   1e-07
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    55   2e-07
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    55   2e-07
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    55   2e-07
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    55   2e-07
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    55   2e-07
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    55   3e-07
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    55   3e-07
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    54   3e-07
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    55   3e-07
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    54   3e-07
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    54   3e-07
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    54   3e-07
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    54   4e-07
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    54   4e-07
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    54   4e-07
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    54   4e-07
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     54   4e-07
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    54   5e-07
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     54   7e-07
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    53   1e-06
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    53   1e-06
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    52   1e-06
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     52   2e-06
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    52   2e-06
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    52   2e-06
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    51   4e-06
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    50   4e-06
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    50   4e-06
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      50   5e-06
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    50   7e-06
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    50   7e-06
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    50   9e-06
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     49   1e-05
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    50   1e-05
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    49   1e-05
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    49   2e-05
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    49   2e-05
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    49   2e-05
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    48   2e-05
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    49   2e-05
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    49   2e-05
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    48   3e-05
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    48   3e-05
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    48   3e-05
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    48   3e-05
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    47   4e-05
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             48   4e-05
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    48   4e-05
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    48   4e-05
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    48   4e-05
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    47   5e-05
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    47   5e-05
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    48   5e-05
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    48   5e-05
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    47   5e-05
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    48   5e-05
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    47   5e-05
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    47   5e-05
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    47   5e-05
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     47   5e-05
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    48   5e-05
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    48   5e-05
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    48   5e-05
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    47   6e-05
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    47   6e-05
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    47   6e-05
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    47   6e-05
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    47   6e-05
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    47   7e-05
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    47   7e-05
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    47   7e-05
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    47   7e-05
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    47   8e-05
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    47   8e-05
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    47   8e-05
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    47   8e-05
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    47   8e-05
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    46   8e-05
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    45   9e-05
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    46   9e-05
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    46   9e-05
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    45   1e-04
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    46   1e-04
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    46   1e-04
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    47   1e-04
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    46   1e-04
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     46   1e-04
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    46   1e-04
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    45   1e-04
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    47   1e-04
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    45   1e-04
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    46   1e-04
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    46   1e-04
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    47   1e-04
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    45   1e-04
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    45   1e-04
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    46   1e-04
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    46   1e-04
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    45   1e-04
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    46   1e-04
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    45   1e-04
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    46   1e-04
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    46   1e-04
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    46   1e-04
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    46   1e-04
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    46   1e-04
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    46   2e-04
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    46   2e-04
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    46   2e-04
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    46   2e-04
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    46   2e-04
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    46   2e-04
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    46   2e-04
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    45   2e-04
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    45   2e-04
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    45   2e-04
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    44   2e-04
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    46   2e-04
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    45   2e-04
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               45   2e-04
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    45   2e-04
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    45   2e-04
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    45   2e-04
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    45   2e-04
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    45   3e-04
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    45   3e-04
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    45   3e-04
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    45   3e-04
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    45   3e-04
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    45   3e-04
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    45   3e-04
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    45   3e-04
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    45   3e-04
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    45   3e-04
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    45   3e-04
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    45   3e-04
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    45   3e-04
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    45   4e-04
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    45   4e-04
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    45   4e-04
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    45   4e-04
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    45   4e-04
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    44   4e-04
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    45   4e-04
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    45   4e-04
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    45   4e-04
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    45   4e-04
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    45   4e-04
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    42   4e-04
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               44   5e-04
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    45   5e-04
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    44   5e-04
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    45   5e-04
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    44   5e-04
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     44   5e-04
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    44   6e-04
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    44   6e-04
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    44   7e-04
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    42   7e-04
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    43   7e-04
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    44   7e-04
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    44   7e-04
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    44   8e-04
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    44   8e-04
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    44   8e-04
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    44   8e-04
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    43   8e-04
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    44   8e-04
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               43   8e-04
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    44   8e-04
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    44   8e-04
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    44   8e-04
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    44   8e-04
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    44   9e-04
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    44   9e-04
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                43   9e-04
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    43   0.001
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    44   0.001
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    43   0.001
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    44   0.001
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    44   0.001
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    44   0.001
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    43   0.001
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    43   0.001
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    44   0.001
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    43   0.001
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    44   0.001
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    43   0.001
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    43   0.001
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    43   0.001
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    43   0.001
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    43   0.001
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    43   0.001
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             43   0.001
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    42   0.001
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    42   0.001
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    43   0.001
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    43   0.001
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    43   0.001
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    43   0.001
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    43   0.001
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    42   0.001
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    42   0.001
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    42   0.002
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    42   0.002
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    43   0.002
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    43   0.002
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    42   0.002
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    42   0.002
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    43   0.002
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    42   0.002
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     42   0.002
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    42   0.002
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    42   0.002
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    42   0.002
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    42   0.002
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     42   0.002
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    42   0.002
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    42   0.002
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    42   0.002
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    42   0.002
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    42   0.002
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    42   0.002
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    42   0.002
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    42   0.002
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    42   0.002
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    42   0.002
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    42   0.002
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    42   0.002
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    42   0.003
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    42   0.003
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    42   0.003
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    42   0.003
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    42   0.003
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    42   0.003
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    41   0.003
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    42   0.003
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    42   0.003
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    42   0.003
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    42   0.003
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    42   0.003
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    42   0.003
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    42   0.003
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    42   0.003
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    42   0.003
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    42   0.003
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    42   0.003
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    41   0.003
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    42   0.003
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    42   0.003
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    42   0.003
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    41   0.003
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    39   0.003
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    41   0.004
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    42   0.004
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    42   0.004
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    42   0.004
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    41   0.004
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    41   0.004
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    41   0.005
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    41   0.005
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    41   0.005
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    41   0.005
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    40   0.005
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     41   0.005
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    40   0.005
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    41   0.005
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    41   0.005
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    41   0.005
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    41   0.006
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    41   0.006
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    39   0.006
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    40   0.006
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    40   0.006
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    41   0.007
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    39   0.007
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    41   0.007
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    41   0.007
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    40   0.007
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    39   0.007
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                40   0.007
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    40   0.007
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    41   0.008
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    40   0.008
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    41   0.008
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    41   0.008
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    39   0.008
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    40   0.008
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    40   0.008
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    40   0.008
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    40   0.009
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    40   0.009
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    40   0.009
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    40   0.009
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               40   0.009
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    40   0.010
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    40   0.010
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               40   0.010
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    40   0.010
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             40   0.010
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     40   0.010
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    40   0.010
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    40   0.011
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    40   0.011
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    39   0.011
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    40   0.011
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    39   0.011
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    40   0.011
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    40   0.011
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    40   0.013
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    39   0.013
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    40   0.013
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    39   0.014
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    39   0.014
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    40   0.014
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    40   0.014
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    39   0.014
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                39   0.015
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    40   0.015
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    40   0.015
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    39   0.016
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    39   0.017
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       37   0.017
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    39   0.017
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    39   0.019
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    39   0.019
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    39   0.020
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    39   0.020
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    39   0.020
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    39   0.020
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    39   0.020
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    38   0.020
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    39   0.020
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    38   0.021
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    39   0.022
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    39   0.022
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    39   0.022
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    39   0.023
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    39   0.023
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    39   0.023
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    37   0.024
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    39   0.024
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    39   0.024
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    39   0.025
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               39   0.025
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    39   0.025
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    39   0.026
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    38   0.026
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    39   0.027
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    37   0.027
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    39   0.028
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    38   0.028
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    39   0.028
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    39   0.030
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    38   0.030
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    39   0.031
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    37   0.032
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    37   0.036
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    38   0.036
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    37   0.037
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    38   0.038
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    38   0.038
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    38   0.041
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    38   0.042
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    37   0.042
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    38   0.044
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    37   0.047
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    37   0.048
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    37   0.048
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    38   0.050
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    37   0.050
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    38   0.051
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    37   0.052
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    37   0.053
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    37   0.055
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    37   0.058
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    38   0.059
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    37   0.060
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    37   0.062
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    37   0.063
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    37   0.063
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    36   0.066
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    37   0.066
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    38   0.066
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    36   0.068
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    36   0.070
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      37   0.071
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    37   0.071
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    37   0.073
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    37   0.075
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    37   0.076
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    37   0.076
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    37   0.079
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                37   0.082
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    37   0.085
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    37   0.089
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    37   0.090
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                36   0.091
Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON...    36   0.095
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    36   0.097
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    37   0.099
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    37   0.10 
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    37   0.10 
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    37   0.10 
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    37   0.11 
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    36   0.11 
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    37   0.11 
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    37   0.11 
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    36   0.12 
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    37   0.12 
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    37   0.12 
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    36   0.12 
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      36   0.13 
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    36   0.13 
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    36   0.14 
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    36   0.14 
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    36   0.14 
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    35   0.14 
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    35   0.14 
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    36   0.14 
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    36   0.15 
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    36   0.15 
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    36   0.15 
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    36   0.15 
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    36   0.15 
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    36   0.16 
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    37   0.16 
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      36   0.18 
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      35   0.18 
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    36   0.21 
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    35   0.21 
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    35   0.23 
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    35   0.24 
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    35   0.24 
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    35   0.25 
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    36   0.25 
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    35   0.26 
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    35   0.26 
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    35   0.26 
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    35   0.27 
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    35   0.29 
Smik_7.7 Chr7 (16965..17897) [933 bp, 310 aa] {ON} YGL254W (REAL)      35   0.29 
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    35   0.29 
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    35   0.31 
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    34   0.31 
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    35   0.31 
Skud_7.13 Chr7 (26414..27304) [891 bp, 296 aa] {ON} YGL254W (REAL)     35   0.32 
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    35   0.32 
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    35   0.34 
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    35   0.36 
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    35   0.37 
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    35   0.40 
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    35   0.41 
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    35   0.41 
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      35   0.41 
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    34   0.42 
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      35   0.43 
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    35   0.45 
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    34   0.46 
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    34   0.47 
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    33   0.47 
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    35   0.48 
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    35   0.48 
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    34   0.48 
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  34   0.51 
TDEL0G01700 Chr7 complement(334394..335848) [1455 bp, 484 aa] {O...    35   0.52 
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    34   0.53 
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    35   0.53 
KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa] ...    33   0.63 
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    33   0.65 
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    33   0.66 
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    34   0.73 
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    34   0.76 
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    34   0.77 
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      34   0.79 
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    34   0.82 
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    33   0.91 
YGL254W Chr7 (22304..23203) [900 bp, 299 aa] {ON}  FZF1Transcrip...    33   0.99 
Kwal_55.20634 s55 (498959..500218) [1260 bp, 419 aa] {ON} YHL027...    33   1.1  
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    33   1.1  
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    33   1.1  
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    33   1.1  
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    33   1.2  
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    33   1.2  
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    33   1.3  
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    33   1.4  
AFR190C Chr6 complement(783107..784405) [1299 bp, 432 aa] {ON} S...    33   1.5  
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    33   1.6  
NCAS0B04360 Chr2 (791449..792276) [828 bp, 275 aa] {ON}                33   1.7  
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    33   1.7  
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    33   1.7  
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    33   1.8  
NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {...    32   1.8  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    33   1.8  
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  32   1.9  
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    33   2.2  
TPHA0H00790 Chr8 (162043..163785) [1743 bp, 580 aa] {ON} Anc_3.1...    33   2.2  
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    32   2.4  
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    32   2.5  
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    32   2.5  
Suva_7.7 Chr7 (16721..17614) [894 bp, 297 aa] {ON} YGL254W (REAL)      32   2.6  
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    32   2.8  
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    32   2.9  
KLLA0E00793g Chr5 (80516..82069) [1554 bp, 517 aa] {ON} weakly s...    32   3.0  
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    32   3.1  
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    32   3.2  
Kpol_388.8 s388 (25278..26939) [1662 bp, 553 aa] {ON} (25278..26...    32   3.3  
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    32   3.4  
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    32   3.6  
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      32   3.7  
NCAS0C05820 Chr3 complement(1197669..1199426) [1758 bp, 585 aa] ...    32   4.1  
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    32   4.8  
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    32   4.9  
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 31   5.4  
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    31   5.8  
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    31   6.4  
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    31   6.8  
CAGL0H07557g Chr8 (738086..739516) [1431 bp, 476 aa] {ON} some s...    31   8.0  
KNAG0D02570 Chr4 complement(451868..452791) [924 bp, 307 aa] {ON...    30   8.2  
Kwal_33.14227 s33 complement(577899..579554) [1656 bp, 551 aa] {...    31   8.2  
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    31   8.3  
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    31   8.6  
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    31   8.7  
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    30   9.0  
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    30   9.3  
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    31   9.3  
Kpol_1031.73 s1031 complement(186968..187513) [546 bp, 181 aa] {...    30   9.3  
NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {O...    30   9.7  
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    30   9.9  
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    30   9.9  

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score =  511 bits (1317), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 270/431 (62%), Positives = 270/431 (62%)

Query: 1   MNINTNTDADIGPNSGLGFGNVMVKHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MNINTNTDADIGPNSGLGFGNVMVKH                                  
Sbjct: 1   MNINTNTDADIGPNSGLGFGNVMVKHEQELLQKQQLFQMSQYQQQQQQQQQVQQQQQQQQ 60

Query: 61  XXXXXXXXXRSTTPVMMHPVYYTNNGXXXXXXXXXXXXXXXXFTHXXXXXXXXXXXXXXX 120
                    RSTTPVMMHPVYYTNNG                FTH               
Sbjct: 61  QQPQHQMMQRSTTPVMMHPVYYTNNGASSQHSQQLPQSQASAFTHNSSIGGSGGFNTSSN 120

Query: 121 XXXXXXXXXXXXXXXXXXXXGNINSTSXXXXXXXXXXXXXXXPTFPLSQSNQTNRIFXXX 180
                               GNINSTS               PTFPLSQSNQTNRIF   
Sbjct: 121 SSLNSAGHDSNQLLSLQSNNGNINSTSQLQQHQYQNMYQHQQPTFPLSQSNQTNRIFSSN 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXHPAVPVHSIDRMQHYKXXXXXXXXXXXXXXXXXXTQNLS 240
                                HPAVPVHSIDRMQHYK                  TQNLS
Sbjct: 181 STSANTTNYQYSNNNNLQQAYHPAVPVHSIDRMQHYKQLHNLQQLQMLQVKLQAQTQNLS 240

Query: 241 HNIQPSTALQPLNIRTGEDSFSTFKEHNTHEQQLLSNPNNGRXXXXXXXXXXLTHDGVPH 300
           HNIQPSTALQPLNIRTGEDSFSTFKEHNTHEQQLLSNPNNGR          LTHDGVPH
Sbjct: 241 HNIQPSTALQPLNIRTGEDSFSTFKEHNTHEQQLLSNPNNGRDQDHDQQQQQLTHDGVPH 300

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQY 360
           ESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQY
Sbjct: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQY 360

Query: 361 LLHEFTLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKR 420
           LLHEFTLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKR
Sbjct: 361 LLHEFTLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKR 420

Query: 421 CLNYIVDSKCS 431
           CLNYIVDSKCS
Sbjct: 421 CLNYIVDSKCS 431

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score =  126 bits (316), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 63/132 (47%), Positives = 89/132 (67%), Gaps = 3/132 (2%)

Query: 299 PHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHT 358
           P +  + +QCHLC+K F+RKSWLKRHLLSHS++K F+CPWC S HKRKDNLLQH+KLKHT
Sbjct: 251 PADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHT 310

Query: 359 QYLLHEFTLFGILMNVNNGS-GNTANLVTTSTGETICLINNEPS--TTIRDMLDSNALPK 415
             +L E    G+   V+N +  N A+    +   ++  ++ + S  T+I+ M+D   L K
Sbjct: 311 PQVLQELQSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNK 370

Query: 416 DQVKRCLNYIVD 427
           D VKR LN +++
Sbjct: 371 DDVKRVLNMLIN 382

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score =  120 bits (301), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 87/138 (63%), Gaps = 12/138 (8%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           ++CH CEK F+RKSWLKRHLLSHS +K + CPWC S HKRKDNL QHLKLKH + LL   
Sbjct: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345

Query: 366 T----LFGILMNVNNGSGNTANLVTTSTGETICLINNE-------PST-TIRDMLDSNAL 413
           +        LMN  +   N A  VT ++ ++   + +        P+T +I+DM+DS  L
Sbjct: 346 SSNPNTASHLMNRLHSGANGAVAVTAASADSSATMVSSSSSSAAGPTTFSIKDMIDSGML 405

Query: 414 PKDQVKRCLNYIVDSKCS 431
            K++VK+ LN +++S  +
Sbjct: 406 SKNEVKKTLNSLINSDIA 423

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  119 bits (298), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 75/122 (61%), Gaps = 6/122 (4%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           ++CHLCEK F+R+SWLKRHLLSHS  + + CPWC S HKRKDNLLQH+KLKH+ YLL E 
Sbjct: 436 HKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLDEL 495

Query: 366 TLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNYI 425
               +  N     G        ST      ++  P ++I+ +L    L KD VKR LN I
Sbjct: 496 KNANVSFNWGTYDG------QNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVLNKI 549

Query: 426 VD 427
           ++
Sbjct: 550 IE 551

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score =  117 bits (294), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 82/143 (57%), Gaps = 22/143 (15%)

Query: 304 HSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLH 363
            SY+C +CEK+F+R+SWLKRHLLSHS+ + + CPWC S HKR+DNLLQH+KLKH   L++
Sbjct: 398 QSYRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLIN 457

Query: 364 EFTLFGI-------------------LMNVNNGSGNTANLVTTSTGETICLINNEPSTTI 404
           E  L                      +M++N+G  NT   V  +    +     E   TI
Sbjct: 458 ELKLRNFISSQTAAASVAFVTSAAPSIMSINDGMNNT---VAGTVDNAVSTPGYETGITI 514

Query: 405 RDMLDSNALPKDQVKRCLNYIVD 427
           +D++    + K+ VKR LN ++D
Sbjct: 515 KDLISEGLINKEDVKRLLNILID 537

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score =  109 bits (273), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 71/124 (57%), Gaps = 22/124 (17%)

Query: 304 HSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLH 363
           + ++CHLC K F+RKSWL+RHLLSHS  + F CPWC S HKRKDNLLQH+KLKHT Y+L 
Sbjct: 132 YVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQ 191

Query: 364 EFTLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLN 423
           E  L  + ++      N                       IR +L    L KD+VK+ LN
Sbjct: 192 ELRLNNVYVSTEGSCKN----------------------NIRTLLYEGRLNKDEVKKVLN 229

Query: 424 YIVD 427
            ++D
Sbjct: 230 SLID 233

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  113 bits (283), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 73/121 (60%), Gaps = 15/121 (12%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           + CHLCEK FRRKSWLKRHLLSHS  ++F CPWC S HKRKDNLLQH+KLKH+ YL+ E 
Sbjct: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIEL 412

Query: 366 TLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNYI 425
                + +  NG GN   L  T                IR+++    + KD VK+ +N +
Sbjct: 413 KKNNAVFSCVNG-GNREKLNDTD--------------DIRNLISLGVINKDDVKKVINKL 457

Query: 426 V 426
           +
Sbjct: 458 I 458

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score =  111 bits (277), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 88/140 (62%), Gaps = 8/140 (5%)

Query: 296 DGVPHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           D +   + + ++C++C K F+RKSWLKRHLLSHS+ +++ CPWC S HKRKDNLLQH+KL
Sbjct: 244 DNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKL 303

Query: 356 KHTQYLLHEF-TLFGILMNVNNGSGNTANLVTTSTGET-ICLINNEPSTTIRD------M 407
           KH Q +L E   L    + +N+ S    +  +    ET + ++N++  ++  D      M
Sbjct: 304 KHKQQVLQEMDKLSESSLELNDESSTGTDTASPIVNETALSMLNDDSGSSSNDNVSIIAM 363

Query: 408 LDSNALPKDQVKRCLNYIVD 427
           +D+  L K+ VK+ LN I++
Sbjct: 364 VDNGTLKKENVKKVLNSIIE 383

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score =  108 bits (271), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 75/127 (59%), Gaps = 7/127 (5%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           ++CH CEK F+RKSWLKRHLLSHS +K + CPWC S HKRKDNL QHLKLKH + LL   
Sbjct: 185 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 244

Query: 366 TLFGILMNVNNGSGNTANLVTTSTGETICLINNEPST--TIRDMLDSNALPKDQVKRCLN 423
           +      N N  +     L ++                 +I+DM+DS  L K++VK+ LN
Sbjct: 245 S-----SNPNTPTSLINRLHSSDAAAGSAAAAAGTPAAFSIKDMIDSGMLSKNEVKKTLN 299

Query: 424 YIVDSKC 430
            +++ + 
Sbjct: 300 SLINPEV 306

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score =  103 bits (258), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 75/124 (60%), Gaps = 23/124 (18%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHE 364
           S+ C +C+K F+RKSWL+RHLLSHS  + F CPWC S HKRKDNLLQH+KLKHT+Y+L +
Sbjct: 191 SHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEK 250

Query: 365 FTLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNY 424
                 L N N G            GE    + N+    IR +L    L K+ VK+ LN 
Sbjct: 251 ------LRNQNVG----------IDGE----VRND---NIRTLLCEGRLNKEDVKKVLNG 287

Query: 425 IVDS 428
           ++DS
Sbjct: 288 LIDS 291

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score =  101 bits (252), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 72/123 (58%), Gaps = 19/123 (15%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           ++C  CEK+F+RKSWLKRH+LSHS  +++ CPWC S HKRKDNLLQH+KLKHT  +L + 
Sbjct: 113 HKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKHTDEVLKKL 172

Query: 366 TLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNYI 425
            +   L                  GE +   +N     IR ML    L KD+VK+ LN +
Sbjct: 173 KMTCYL--------------EGDDGEEMMNRDN-----IRTMLYEGLLDKDEVKKVLNEL 213

Query: 426 VDS 428
           ++ 
Sbjct: 214 LEE 216

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score =  106 bits (264), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 77/139 (55%), Gaps = 12/139 (8%)

Query: 302 SHHSY--QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQ 359
           S H Y  QC  CEK F+RKSWLKRHLLSHS  + F CPWC S  KRKDNLLQH+KLKHT 
Sbjct: 332 SDHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 391

Query: 360 YLLHEFTLFGILMNVNNGSGNTANLVTTSTGETICLI----------NNEPSTTIRDMLD 409
           YLL E     I+ N NN S N+ N    ++                  N     I+ +++
Sbjct: 392 YLLDELKKNNIIFNYNNSSINSNNSNNNNSASGSGGGSAAAAPENEDGNSYDPNIKTLIN 451

Query: 410 SNALPKDQVKRCLNYIVDS 428
              L KD VKR LN ++ S
Sbjct: 452 DGVLNKDDVKRVLNNLIVS 470

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score =  106 bits (264), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 55/132 (41%), Positives = 79/132 (59%), Gaps = 10/132 (7%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           Y CH+C K F+R+SWLKRHLLSHS+ + + CPWC S HKR+DNLLQH+KLKH++ L++E 
Sbjct: 388 YICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINEL 447

Query: 366 TLFGILMNVNN---GSGNTANLVTTSTGETICLIN--NEP-----STTIRDMLDSNALPK 415
               ++ + +N         +      G     I+  NEP       TIR ++ +  + K
Sbjct: 448 KFRNVIFDWHNYHYQQQVQRHQQYQQQGGMPPQIHGANEPFNINSEFTIRTLVTNGVVNK 507

Query: 416 DQVKRCLNYIVD 427
           + VKR LN +VD
Sbjct: 508 EDVKRVLNQLVD 519

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score =  106 bits (265), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 53/119 (44%), Positives = 72/119 (60%), Gaps = 14/119 (11%)

Query: 308 CHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEFTL 367
           CH+C KQF+RKSWL+RHLLSHS+ + F CPWC S HKRKDNLLQH+KLKH + +L +   
Sbjct: 479 CHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAENVLEQLR- 537

Query: 368 FGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNYIV 426
             I +  NN + N+   +  +               IR ++    L KD+VK+ LN +V
Sbjct: 538 --INLKANNPNDNSEPTLEGNGDH-----------NIRTLMGEGILNKDEVKKLLNSLV 583

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score =  106 bits (264), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 70/123 (56%), Gaps = 13/123 (10%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           YQCH+C K FRR SWLKRHLL+HS+ + + CP C S HKRKDNLLQHLKLKHT ++L + 
Sbjct: 387 YQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFVLEQL 446

Query: 366 TLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNYI 425
               I +      G       ++T              I+ +L    L K+ VK+ LN +
Sbjct: 447 RQDNIDIKTAKDEGEEDQGTASNTN-------------IKTLLVEGRLNKEDVKKVLNRL 493

Query: 426 VDS 428
           +DS
Sbjct: 494 IDS 496

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score =  105 bits (262), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 76/122 (62%), Gaps = 12/122 (9%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHE 364
           +Y+C +C+K F+R+SW KRHLLSHS+ K + CPWC S HKR+DNL QH+K KH ++++ E
Sbjct: 388 AYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQE 447

Query: 365 FTLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNY 424
                 L+ V +  G+  + +  ++ E+       P  +I+ ++    + K++VK  LN 
Sbjct: 448 ------LLEVGDVDGSVMSGMQVTSDESA------PEPSIKTLIQDGQVKKERVKAVLNA 495

Query: 425 IV 426
           ++
Sbjct: 496 VI 497

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score =  105 bits (261), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 46/70 (65%), Positives = 51/70 (72%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           +QC  CEK F+RKSWLKRHLLSHS  + F CPWC S  KRKDNLLQH+KLKHT YLL E 
Sbjct: 328 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 387

Query: 366 TLFGILMNVN 375
               I+ N N
Sbjct: 388 KKNNIIFNYN 397

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score =  104 bits (259), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 48/74 (64%), Positives = 52/74 (70%), Gaps = 2/74 (2%)

Query: 302 SHHSY--QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQ 359
           S H Y  QC  CEK F+RKSWLKRHLLSHS  + F CPWC S  KRKDNLLQH+KLKHT 
Sbjct: 340 SDHKYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTN 399

Query: 360 YLLHEFTLFGILMN 373
           YLL E     I+ N
Sbjct: 400 YLLDELKKNNIIFN 413

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score =  103 bits (258), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 77/134 (57%), Gaps = 12/134 (8%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           +QC  C K F+R SWLKRHLL+HS  + + CPWC S HKRKDNLLQHLKLKHT+ +L + 
Sbjct: 560 FQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQL 619

Query: 366 TLFGILMNVNNGS-----------GNTANLVTTSTGETICLIN-NEPSTTIRDMLDSNAL 413
            L  I ++    +             + +  T+   + I + N  +P T I+ +L    L
Sbjct: 620 RLENIEISTIEETMEDRRVDVHERSKSVDTGTSGVNDDIDIKNVKQPGTNIKTLLYDGRL 679

Query: 414 PKDQVKRCLNYIVD 427
            K+ VK+ LN ++D
Sbjct: 680 NKEDVKKVLNKLLD 693

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score =  102 bits (254), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 70/121 (57%), Gaps = 12/121 (9%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           Y+C +CEK F+RKSW +RHLLSHS+ K ++CPWC S HKR+DNL QH+K KH   +L E 
Sbjct: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE- 446

Query: 366 TLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNYI 425
                LM   +  G+    V  +  + +         +IR ++    + K++VK  LN +
Sbjct: 447 -----LMEAGDLDGSMGTNVRLAIDDMVA------GPSIRTLVQDGRVKKERVKTVLNAV 495

Query: 426 V 426
           +
Sbjct: 496 I 496

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score =  102 bits (254), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           +QCHLCEK F+RKSWLKRHLLSHS  + F CP C S HKRKDNL+QHLKLKH  Y+L + 
Sbjct: 340 FQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLDYILKKL 399

Query: 366 TLFGILMNVNNGSGNT 381
               +++  N  S +T
Sbjct: 400 NKDDLIIKYNLSSNST 415

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score =  100 bits (250), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 44/67 (65%), Positives = 49/67 (73%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           +QC  CEK F+RKSWLKRHLLSHS  + F CPWC S  KRKDNLLQH+KLKHT YLL E 
Sbjct: 327 HQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDEL 386

Query: 366 TLFGILM 372
               I+ 
Sbjct: 387 KKNNIIF 393

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score = 99.4 bits (246), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 69/122 (56%), Gaps = 11/122 (9%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           ++CHLC K F+RKSWLKRHLLSHS  + F CPWC+S HKR+DNLLQH+KLKH   LL E 
Sbjct: 534 HRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVPNLLQEI 593

Query: 366 TLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNYI 425
               +  N           +     + I      P T  + ++    L KD++K  LN +
Sbjct: 594 NSRNMRFNW---------PILERLSKQIDGTIEYPDT--KTLIHEGLLNKDELKNILNTV 642

Query: 426 VD 427
           +D
Sbjct: 643 ID 644

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 83.6 bits (205), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 51/75 (68%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           Y+C++C K F+R++WL+RH LSH+N + F CPWC S HKR+DNL +H+KLKH + L+   
Sbjct: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKAI 178

Query: 366 TLFGILMNVNNGSGN 380
             +  L +  +   N
Sbjct: 179 REYYPLTDFEDKDLN 193

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/52 (59%), Positives = 39/52 (75%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKH 357
           Y+C +C K F+R SWLKRH  SHS +K F C WCS  +KRKDNL+QH++ KH
Sbjct: 324 YECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKH 375

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 40/58 (68%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLL 362
           SY C  C K F+R +WLKRH ++H+N   F C WC S HKR+DN+ +H+KLKH   L+
Sbjct: 249 SYPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKHMNLLM 306

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 303 HHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           H  YQC LC K F R S L+ HLL+H+  + F CP+  CS T   K N+++HLK
Sbjct: 125 HPKYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLK 178

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
            E    ++C  C K FRR   LKRH+ S HS+ + FHC +C     R DNL QHLK
Sbjct: 436 EEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLK 491

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + + +++C  C K FRR   LKRH+ S HS+ + F CP C     R DNL QH+K
Sbjct: 760 DENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIK 814

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
            E    ++C  C K FRR   LKRH+ S HS+ + FHC +C     R DNL QHLK
Sbjct: 635 EEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLK 690

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           E    ++C  C K FRR   LKRH+ S HS  + FHC +C     R DNL QHLK
Sbjct: 615 EDEKPFKCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLK 669

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           E    ++C  C K FRR   LKRH+ S HS  + FHC +C     R DNL QHLK
Sbjct: 616 EEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLK 670

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (62%), Gaps = 1/54 (1%)

Query: 302 SHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           S   ++C+ CEK+F+R   LKRH+ S HS  + +HC +C     R DNL QHLK
Sbjct: 304 SDKPFKCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLK 357

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSH 328
           H +   Y C  CEK F R   L +HL +H
Sbjct: 331 HSTERPYHCQFCEKNFSRSDNLSQHLKTH 359

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           ++ +  ++C  CEK FRR   LKRH+ S HS  + F C +C     R DNL QHLK
Sbjct: 567 YDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 622

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           E    ++C  C KQFRR   LKRH+ S HS  + F C +C     R DNL QHLK
Sbjct: 432 EIEKPFKCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLK 486

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           ++ +  ++C  CEK FRR   LKRH+ S HS  + F C +C     R DNL QHLK
Sbjct: 578 YDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 633

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           ++C  CEK FRR   LKRH+ S HS+ + F C +C     R DNL QHLK
Sbjct: 590 FKCTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHLK 639

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSH 328
           H S   + C+ CEK+F R   L +HL +H
Sbjct: 613 HSSERPFACNYCEKKFSRSDNLSQHLKTH 641

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
            E    ++C  C K FRR   LKRH+ S HS+ + F C +C     R DNL QHLK
Sbjct: 498 EEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLK 553

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           ++ +  ++C  CEK FRR   LKRH+ S HS  + F C +C     R DNL QHLK
Sbjct: 565 YDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 620

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + CH+C K F+R   LKRH+ S HSN + F C  C     R DNL QH+K
Sbjct: 652 FHCHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 701

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 18/29 (62%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSH 328
           H +   + CH+C+K+F R   L +H+ +H
Sbjct: 675 HSNERPFACHICDKKFSRSDNLSQHIKTH 703

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + CH+C K F+R   LKRH+ S HSN + F C  C     R DNL QH+K
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 18/29 (62%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSH 328
           H +   + CH+C+K+F R   L +H+ +H
Sbjct: 670 HSNERPFACHICDKKFSRSDNLSQHIKTH 698

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           +QC  C+K FRR   LKRH+ S HS  + F C +C     R DNL QHLK
Sbjct: 484 FQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLK 533

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + CH+C K F+R   LKRH+ S HSN + F C  C     R DNL QH+K
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 18/29 (62%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSH 328
           H +   + CH+C+K+F R   L +H+ +H
Sbjct: 670 HSNERPFACHICDKKFSRSDNLSQHIKTH 698

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + C  C ++F+R+  LKRH+LS H   K+F CP C     R DNL QH+K
Sbjct: 400 FGCKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIK 449

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           ++C  CEK FRR   LKRH+ S HS+ + F C +C     R DNL QHLK
Sbjct: 466 FKCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLK 515

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 299 PHESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           P E    ++C  C K FRR   LKRH+ S HS  + F C +C     R DNL QHLK
Sbjct: 373 PDEEVKPFKCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 429

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKL--KH 357
           E    ++C  C K FRR   LKRH+ S HS+ + F C +C     R DNL QHLK   KH
Sbjct: 522 EDVKPFKCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKH 581

Query: 358 TQY 360
             +
Sbjct: 582 GDF 584

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSH 328
           H S   + C  CEK+F R   L +HL +H
Sbjct: 550 HSSERPFACMFCEKKFSRSDNLSQHLKTH 578

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           E    ++C  C K FRR   LKRH+ S HS  + F C +C     R DNL QHLK
Sbjct: 693 EEEKPFKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLK 747

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           +++C+ CEK FRR   LKRH+ S HS+ + F C +C     R DNL QHLK
Sbjct: 461 TFKCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLK 511

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSH 328
           H S   + C+ CEK+F R   L +HL +H
Sbjct: 485 HSSERPFPCNYCEKKFSRSDNLSQHLKTH 513

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + CH+C K F+R   LKRH+ S HSN + F C  C     R DNL QH+K
Sbjct: 646 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICEKKFSRSDNLSQHIK 695

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSH 328
           H +   + CH+CEK+F R   L +H+ +H
Sbjct: 669 HSNERPFACHICEKKFSRSDNLSQHIKTH 697

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           ++C  CEK FRR   LKRH  S HS  + F C +C+    R DNL QHLK
Sbjct: 915 FKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLK 964

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 297 GVPHESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           G   +    ++C  CEK F+R   LKRH  S HSN + F C  C     R DNL QHLK
Sbjct: 304 GNDEDLDKQFKCSECEKGFKRSEHLKRHFRSVHSNERPFPCMLCEKKFSRSDNLSQHLK 362

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSH 328
           H +   + C LCEK+F R   L +HL +H
Sbjct: 336 HSNERPFPCMLCEKKFSRSDNLSQHLKTH 364

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + +  +QC  C K FRR   LKRH+ S HS  + F C  C     R DNL QHLK
Sbjct: 707 DENKPFQCDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLK 761

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSH 328
           H     + C+LCEK+F R   L +HL +H
Sbjct: 735 HSKERPFACNLCEKKFSRSDNLSQHLKTH 763

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 277 NPNNGRXXXXXXXXXXL-THDGVPHESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKF 334
           N NNG+          + T D   ++ +  + C  C+K FRR   LKRH+ S HS  + F
Sbjct: 552 NNNNGKVAVQPRKRKSIATIDQNNYDKNKPFNCKDCDKAFRRSEHLKRHIRSVHSAERPF 611

Query: 335 HCPWCSSTHKRKDNLLQHLK 354
            C +C     R DNL QHLK
Sbjct: 612 ACMFCEKKFSRSDNLSQHLK 631

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           ++C  C K F+R   LKRH+ S HSN + F C  C     R DNL QHLK
Sbjct: 563 FKCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLK 612

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSH 328
           H +   + C LCEK+F R   L +HL +H
Sbjct: 586 HSNDRPFACTLCEKKFSRSDNLSQHLKTH 614

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           E+   ++C  C K FRR   LKRH+ S HS  + F C  C     R DNL QHLK
Sbjct: 381 ENEKPFKCDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHLK 435

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 299 PHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           P+  +  Y C +C K FRR S LK H+  H+ VK + CP+  C      K N+L+H KL
Sbjct: 408 PNPKNFKYHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFKL 466

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 297 GVPHESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           G   + +  ++C  C K FRR   LKRH+ S HS+ + F C +C     R DNL QHLK
Sbjct: 664 GSLDDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLK 722

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSH 328
           H S   + C  CEK+F R   L +HL +H
Sbjct: 696 HSSERPFACMFCEKKFSRSDNLSQHLKTH 724

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + CHLC K F+R   LKRH+ S HS  + F C  C     R DNL QH+K
Sbjct: 535 FGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIK 584

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSH 328
           H +   + CHLCEK+F R   L +H+ +H
Sbjct: 558 HSTDRPFSCHLCEKKFSRSDNLSQHIKTH 586

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           ++C  C K FRR   LKRH+ S HS  + F C  C     R DNL QHLK
Sbjct: 689 FKCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLK 738

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 308 CHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           C  C KQF R S L+ H+L HS  K F C W  C+     K NL++HLKL
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKL 283

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           QCH+C+K   R + LK HLL H+    F CPW  C  +   K N+L+HLK
Sbjct: 150 QCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLK 199

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 298 VPHESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           +P +S   Y CHLC+K+F+R   LKRH  + H  V+ F C  C     R DNL QH+++ 
Sbjct: 216 LPDDSKQ-YFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRIH 274

Query: 357 HTQYLLH 363
             Q ++ 
Sbjct: 275 EQQPIME 281

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           +S   + C  CE++F+R+  LKRH+ S H  VK + C  C     R DNL QH+K
Sbjct: 381 DSSKQFGCDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLSQHIK 435

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 17/24 (70%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHS 329
           Y CH+C+K+F R   L +H+ +H+
Sbjct: 415 YACHICDKKFSRSDNLSQHIKTHT 438

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%)

Query: 299 PHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           P  +  ++ C +C+K F R+  L RHL SH+N K F C  C     R+D L++H
Sbjct: 42  PSGNKRTFLCFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLLIRH 95

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 298 VPHESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           +P  + H Y C  CE++F+R+  LKRH+ S H   K + C  C+    R DNL QH K
Sbjct: 342 IPDNTKH-YSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTK 398

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 298 VPHESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           +P  S   + C  CE++F+R+  LKRH+ S H  VK + C  C     R DNL QH+K
Sbjct: 377 IPDASKQ-FGCEYCERRFKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLSQHIK 433

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 6/58 (10%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLH 363
           + C +C + F R+  LKRH +SH+N K F C +C     RKD +L+H      QY LH
Sbjct: 34  FLCSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH------QYKLH 85

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           ++   + C  C+++F+R+  LKRH+ S H   K F C  C     R DNL QH+K
Sbjct: 335 DASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVK 389

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 295 HDGVPHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           H  V H+    +QC +C +QF RK+ L+RH+ SHS  K F C +C      K  L +H +
Sbjct: 70  HQEVVHQGIKPFQCTVCARQFSRKTHLERHMFSHSEDKPFKCSYCGKGVTTKQQLRRH-E 128

Query: 355 LKHTQYLL 362
           + HT+  +
Sbjct: 129 ITHTRSFV 136

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 308 CHLCEKQFRRKSWLKRHLLSHSN---VKKFHCPW--CSSTHKRKDNLLQHLKLKH 357
           C +C K+F+R   LK H+  H N   V+K+ C    C    K    L QH+K  H
Sbjct: 166 CEICGKRFQRPYRLKNHIAKHHNPDVVQKYQCSQGSCIEAFKTWSALQQHMKETH 220

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + C  CE++F+R+  LKRH+ S H   K + C  C+    R DNL QH+K
Sbjct: 495 FACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIK 544

>YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}
           STP2Transcription factor, activated by proteolytic
           processing in response to signals from the SPS sensor
           system for external amino acids; activates transcription
           of amino acid permease genes
          Length = 541

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 14/78 (17%)

Query: 297 GVPHESHHS--YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW------------CSST 342
           G+  ES  +  Y CH C+ +FR + +L RH+  H+  K +HCP+             S  
Sbjct: 193 GIADESSETLPYICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGG 252

Query: 343 HKRKDNLLQHLKLKHTQY 360
             R+D    HLK +H  Y
Sbjct: 253 FSRRDTYKTHLKSRHFTY 270

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           Y C +C K+F+R S L  H+  H+  K F CP+  C+ +   K N+L+H KL
Sbjct: 305 YHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKL 356

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 54/115 (46%), Gaps = 10/115 (8%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           + C +C + F R   LKRH +SH+N K F C +C     RKD +L+H      QY LH  
Sbjct: 36  FLCSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH------QYKLHP- 88

Query: 366 TLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKR 420
               ++   ++   N+     ++T E I  +     T +   L+  A+   Q+K+
Sbjct: 89  ---ALVSQKDSKDSNSNTNSGSATNENIVKVTGNKQTILPTPLNPLAMTTAQLKK 140

>Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W
           (REAL)
          Length = 535

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 14/78 (17%)

Query: 297 GVPHESHHS--YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW------------CSST 342
           G   ES  +  Y CH C+ +FR + +L RH+  H+  K +HCP+             S  
Sbjct: 194 GTADESSETLPYVCHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDDSISQELRCHTSGG 253

Query: 343 HKRKDNLLQHLKLKHTQY 360
             R+D    HLK +H  Y
Sbjct: 254 FSRRDTYKTHLKSRHFNY 271

>Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)
          Length = 542

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 12/68 (17%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW------------CSSTHKRKDNLLQH 352
           SY CH C+ +FR + +L RH+  H+  K +HCP+             S    R+D    H
Sbjct: 203 SYICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDTYKTH 262

Query: 353 LKLKHTQY 360
           LK +H  Y
Sbjct: 263 LKSRHFTY 270

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           ++   + C  C+++F+R+  LKRH+ S H   K F C  C     R DNL QH+K
Sbjct: 341 DASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIK 395

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + C  C+++F+R+  LKRH+ S H   K FHC  C     R DNL QH+K
Sbjct: 398 FSCEYCDRRFKRQEHLKRHIRSLHICEKPFHCHICDKHFSRSDNLNQHIK 447

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSN 330
           + CH+C+K F R   L +H+ +HSN
Sbjct: 427 FHCHICDKHFSRSDNLNQHIKTHSN 451

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           ++   + C  C+++F+R+  LKRH+ S H   K + C  C     R DNL QH+K
Sbjct: 349 DASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIK 403

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW----------C--SSTHKRKDNLLQHL 353
           + CH C+ +FR + +L RH+  H+  K F CP+          C  S    R+D    HL
Sbjct: 61  FVCHYCDARFRMRGYLTRHIKKHAIEKAFRCPFFQRGQPRDLQCHPSGGFSRRDTYKTHL 120

Query: 354 KLKHTQY 360
           K+KH  Y
Sbjct: 121 KVKHVLY 127

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKR---KDNLLQHLKLKHTQYL 361
           S QCH+C K   R S L+ H+L H+  + F C W S  HKR   K N+ +H KL   + L
Sbjct: 490 SRQCHICGKSVTRTSTLQTHMLVHTGDRPFECVW-SGCHKRFNVKSNMNRHYKLHLKKQL 548

Query: 362 LHEF 365
            +E 
Sbjct: 549 ANEV 552

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (61%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           + CH+C + F R+  LKRH  +H+N K F C +C     R+D +L+H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON}
           Anc_5.586 YHR006W
          Length = 481

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 12/67 (17%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW----------CSST--HKRKDNLLQHL 353
           + CH C+  FR + +L RH+  H+  K FHCP+          C +T    R+D    HL
Sbjct: 99  FVCHYCDAVFRIRGYLTRHIKKHAIQKAFHCPFYNDSASSKLKCHTTGGFSRRDTYKAHL 158

Query: 354 KLKHTQY 360
           K++H  Y
Sbjct: 159 KIRHFMY 165

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKLKH 357
           H     Y C  C K+F RK  L  H+L+H N+K +HC    CS +  +  NL  H    H
Sbjct: 590 HTGEKPYSCEKCGKRFSRKGNLAAHMLTHENLKPYHCKLDGCSKSFTQLGNLKAHQNRFH 649

Query: 358 TQYL 361
            Q L
Sbjct: 650 LQTL 653

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 25/54 (46%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHL 353
           H  +  +QC  C K+F +   L+ H   H+  K + C  C     RK NL  H+
Sbjct: 562 HIGYKPFQCEYCGKRFTQGGNLRTHTRLHTGEKPYSCEKCGKRFSRKGNLAAHM 615

 Score = 37.0 bits (84), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           ++C  C K F + + L+ H+ SH   K F C +C     +  NL  H +L
Sbjct: 540 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHTRL 589

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCP--WCSSTHKRKDNLLQ----HLKLKHTQ 359
           Y C++C K+F+R S L  H+  H+  K + CP   CS     K N+L+    H KL   Q
Sbjct: 270 YDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKLHFKLNTGQ 329

Query: 360 YLL 362
           Y+L
Sbjct: 330 YIL 332

>Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W
           (REAL)
          Length = 545

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW----------C--SSTHKRKDNLLQHL 353
           Y CH C+ +FR + +L RH+  H+  K +HCP+          C  S    R+D    HL
Sbjct: 204 YICHYCDSRFRIRGYLTRHIKKHAKRKAYHCPFFDGSISQELRCHNSGGFSRRDTYKTHL 263

Query: 354 KLKHTQY 360
           K +H  Y
Sbjct: 264 KSRHFNY 270

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           Y C +C++QF     L RH  S HS  K F CP C    KR+D++LQHL  K
Sbjct: 781 YICQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKRRDHVLQHLNKK 832

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 45/108 (41%), Gaps = 25/108 (23%)

Query: 245 PSTALQPLNIRTGEDSFSTFKEHNTHEQQLLSNPNNGRXXXXXXXXXXLTHDGVPHESHH 304
           P+ +  P  I TG D           E Q+L  P   R               +  +   
Sbjct: 25  PAFSAPPCVISTGND-----------EAQVLPIPKKSRT--------------IKTDKPR 59

Query: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
            + CH+C + F R+  LKRH  +H+N K F C +C     R+D +L+H
Sbjct: 60  PFLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQ----HLKLKHTQ 359
           Y C++C K+F+R S L  H   H+  K FHCP   C+ T   + N+L+    H KL    
Sbjct: 233 YCCNVCGKRFKRPSSLSTHTNIHTGKKPFHCPLAKCTKTFNARSNMLRHYKAHFKLASGV 292

Query: 360 YLL 362
           YLL
Sbjct: 293 YLL 295

>SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 899

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%)

Query: 302 SHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYL 361
           S   Y C  C K F R     RH  SH+ VK F C  C+ +  R+D L +H++  H  +L
Sbjct: 4   SQRKYICSFCAKAFSRSEHRTRHERSHTGVKPFTCTVCAHSFVRRDLLQRHIRTVHRTFL 63

Query: 362 LH 363
           L 
Sbjct: 64  LQ 65

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + C  CE++F+R+  LKRH+ S H   K + C  C     R DNL QH+K
Sbjct: 460 FGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 509

>SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON}
           uniprot|Q875P4 Saccharomyces kluyveri STP1
          Length = 517

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 12/73 (16%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW----------CSST--HKRKD 347
            E    Y CH C+ +FR + +L RH+  H+  K +HCP+          C +T    R+D
Sbjct: 156 EEQRGKYVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPESRCHTTGGFSRRD 215

Query: 348 NLLQHLKLKHTQY 360
               HLK +H  Y
Sbjct: 216 TYKTHLKSRHFIY 228

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + C  CE++F+R+  LKRH+ S H   K + C  C     R DNL QH+K
Sbjct: 514 FGCEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 563

>TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298
          Length = 833

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCP--WCSSTHKRKDNLLQHLKL 355
           +C  C K+FRR S LK HL  H+ ++ F CP   C  +   + N+L+H KL
Sbjct: 715 KCEYCLKKFRRPSSLKTHLNIHTGIQPFKCPSKRCDKSFNARSNMLRHYKL 765

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%)

Query: 299 PHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHT 358
           P     S+ C +C + F R+  LKRH  SH+N K + C  C+    R+D L++H +  H+
Sbjct: 97  PSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHS 156

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHE 364
           Y C  C + F R+  LKRH  SH+N K F C +C     R+D +L+H +  H+  + ++
Sbjct: 105 YICQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLILRHQRRLHSSLMTND 163

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%)

Query: 299 PHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHT 358
           P     S+ C +C + F R+  LKRH  SH+N K + C  C+    R+D L++H +  H+
Sbjct: 97  PSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHS 156

>NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {ON} 
          Length = 650

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 12/72 (16%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW----------C--SSTHKRKDN 348
           E   ++ CH C+ +FR + +L RH+  H+  K +HCP+          C  S    R+D 
Sbjct: 268 EEEGTFVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFFNNDALPELRCHNSGGFSRRDT 327

Query: 349 LLQHLKLKHTQY 360
              HLK +H  Y
Sbjct: 328 YKTHLKARHFIY 339

>YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}
           STP1Transcription factor, undergoes proteolytic
           processing by SPS (Ssy1p-Ptr3p-Ssy5p)-sensor component
           Ssy5p in response to extracellular amino acids;
           activates transcription of amino acid permease genes and
           may have a role in tRNA processing
          Length = 519

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 12/70 (17%)

Query: 303 HHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSST------------HKRKDNLL 350
              + CH C+  FR + +L RH+  H+  K +HCP+ +S               R+D   
Sbjct: 157 EEEFICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDTYK 216

Query: 351 QHLKLKHTQY 360
            HLK +H  Y
Sbjct: 217 THLKARHVLY 226

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + C  C K F+R   LKRH+ S HS  + + C  C     R DNL QHLK
Sbjct: 603 FHCEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQHLK 652

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSH 328
           H     Y C++C+K+F R   L +HL +H
Sbjct: 626 HSQERPYGCNICDKKFSRSDNLSQHLKTH 654

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKLKH 357
           H     Y+C +C+K+F RK  L  H L+H +VK F C    C+ T  +  N+  H    H
Sbjct: 650 HTGEKPYRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAHQNKFH 709

Query: 358 TQYLLHEFTLFGILMNVN 375
            Q LL E T     MN N
Sbjct: 710 LQTLL-ELTSKIAEMNPN 726

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKH 357
           H  +  +QC+ C K+F +   L+ H   H+  K + C  C     RK NL  H KL H
Sbjct: 622 HLGYKPFQCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEICDKRFSRKGNLAAH-KLTH 678

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 298 VPHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           V HE    ++C  C + F + + L+ H+ SH   K F C +C     +  NL  H +L
Sbjct: 592 VVHEGSKQHECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNFCGKRFTQGGNLRTHQRL 649

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 308 CHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLL 362
           C LC K F R+S L+ HLL H+N+K F C +C      K NL +H ++ H Q ++
Sbjct: 173 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCEKEFNVKSNLNRHERI-HRQKVI 226

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%)

Query: 299 PHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHT 358
           P     S+ C +C + F R+  LKRH  SH+N K + C  C+    R+D L++H +  H+
Sbjct: 103 PSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHS 162

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           QC LC K   R S L+ H+L H+ V+ F C W  C  T   K N+ +HLKL
Sbjct: 448 QCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKL 498

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (61%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           + CH+C + F R+  LKRH  +H+N K F C +C     R+D +L+H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (61%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           + CH+C + F R+  LKRH  +H+N K F C +C     R+D +L+H
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 107

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 298 VPHESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           VP  S   + C +C ++FRR+  +KRH+ + H   + + C  C  T  R DNL QHL+  
Sbjct: 406 VPDGSKQ-FLCTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKTFSRSDNLNQHLRTH 464

Query: 357 HTQYLLHEFTLF 368
              Y +    LF
Sbjct: 465 TRNYEVKHPPLF 476

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHS-NVKKFHCPWCSSTHK 344
           H     Y C++CEK F R   L +HL +H+ N +  H P  +  H+
Sbjct: 436 HFQERPYTCYVCEKTFSRSDNLNQHLRTHTRNYEVKHPPLFNYDHR 481

>Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463W
           (REAL)
          Length = 514

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 12/70 (17%)

Query: 303 HHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW----------C--SSTHKRKDNLL 350
              + CH C+  FR + +L RH+  H+  K +HCP+          C  S    R+D   
Sbjct: 157 EEEFICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNGATPPDLRCHNSGGFSRRDTYK 216

Query: 351 QHLKLKHTQY 360
            HLK +H  Y
Sbjct: 217 THLKARHVLY 226

>TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {ON}
           Anc_4.214 YGR067C
          Length = 737

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLH 363
           S+ C  C + F R    KRH  SH  VK F C  C+    R+D L +H+K  H  +LL 
Sbjct: 4   SHVCAFCRRAFSRSEHRKRHERSHQGVKPFQCAVCNHVFVRRDLLKRHIKTVHRAWLLE 62

>CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006w SPT2 or uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 688

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 12/72 (16%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW----------C--SSTHKRKDN 348
           +    + CH C+ +FR + +L RH+  H+  K +HCP+          C  S    R+D 
Sbjct: 193 DDEKEFVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFYNGQEVPSKRCHNSGGFSRRDT 252

Query: 349 LLQHLKLKHTQY 360
              H+K +H  Y
Sbjct: 253 YKTHMKARHLIY 264

>Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463W
           (REAL)
          Length = 528

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 12/70 (17%)

Query: 303 HHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW----------C--SSTHKRKDNLL 350
              + CH C+  FR + +L RH+  H+  K +HCP+          C  S    R+D   
Sbjct: 157 EEEFICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNNATPPDLRCHNSGGFSRRDTYK 216

Query: 351 QHLKLKHTQY 360
            HLK +H  Y
Sbjct: 217 THLKARHVLY 226

>NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa]
           {ON} Anc_5.586
          Length = 367

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSST------------HKRKDNLLQHL 353
           Y CH C+ +FR K +L RH+  H+  K +HCP+ S+               R+D    HL
Sbjct: 96  YVCHYCQAKFRIKGYLTRHIKKHAVEKAYHCPFFSTESPPELRCHNSGGFSRRDTYKTHL 155

Query: 354 KLKHTQY 360
           K +H  +
Sbjct: 156 KARHILF 162

>Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON}
           similar to Ashbya gossypii ADL050W
          Length = 179

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 308 CHLCEKQFRRKSWLKRHLLSHSNVKKFHC--PWCSSTHKRKDNLLQHLKLKHTQYL 361
           C +C K+F RK+ L  HLL H++++ + C  P C  T   K NL +HLK+   Q L
Sbjct: 111 CPVCLKEFTRKTSLNTHLLIHADIRPYRCKYPDCKKTFNVKSNLNRHLKIHKKQEL 166

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQH 352
           ++C +CE++F+R+  LKRH+ S H   + + C  C  +  R DNL QH
Sbjct: 218 FKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQH 265

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           Y C +C K+F+R S L  H+  H+  K + CP+  C  +   K N+L+H KL
Sbjct: 278 YCCKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYKL 329

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 293 LTHDGVPHESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQ 351
           L  DG        + C  C ++FRR+  +KRH+ S H   K + C  CS    R DNL Q
Sbjct: 163 LVDDGT-----KKFACQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICSKAFSRNDNLKQ 217

Query: 352 HLK 354
           H K
Sbjct: 218 HRK 220

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           QC +C K   R S LK H L H+    F CPW  C      K N+L+HLK
Sbjct: 286 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLK 335

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 298 VPHESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           +P  S   + C  C+++F+R+  LKRH+ S H   K F C  C+    R DNL QH+K
Sbjct: 381 IPDASKQ-FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {ON}
           Anc_5.586 YHR006W
          Length = 600

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 12/68 (17%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSST------------HKRKDNLLQH 352
           +Y CH C+  F+ + +L RH+  H+  K +HCP+ ++T              R+D    H
Sbjct: 198 TYICHYCDATFKIRGYLTRHIKKHAIDKAYHCPFFNATLGTELKCHNTGGFSRRDTYKTH 257

Query: 353 LKLKHTQY 360
           LK +H  Y
Sbjct: 258 LKTRHFVY 265

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           QC +C K   R S LK H L H+    F CPW  C+ +   K N+L+H K
Sbjct: 259 QCPICGKLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVKSNMLRHYK 308

>NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586
          Length = 454

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 31/66 (46%), Gaps = 12/66 (18%)

Query: 304 HSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW----------C--SSTHKRKDNLLQ 351
           H Y CH C  QFR K +L RHL  H+  K + CP+          C  S    R+D    
Sbjct: 98  HQYVCHHCNAQFRIKGYLTRHLKKHATEKAYTCPFFNTDSPPELRCHNSGGFSRRDTYKT 157

Query: 352 HLKLKH 357
           HLK +H
Sbjct: 158 HLKSRH 163

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 298 VPHESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           +P  S   + C  C+++F+R+  LKRH+ S H   K F C  C+    R DNL QH+K
Sbjct: 381 IPDASKQ-FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5.586
           YHR006W
          Length = 235

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 32/67 (47%), Gaps = 12/67 (17%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW----------C--SSTHKRKDNLLQHL 353
           Y CH C+  FR + +L RH+  HS  K +HCP+          C  S    R+D    HL
Sbjct: 35  YVCHYCDASFRIRGYLTRHIKKHSIEKAYHCPFYNEHQPSELKCHNSGGFSRRDTYKTHL 94

Query: 354 KLKHTQY 360
           K +H  Y
Sbjct: 95  KSRHILY 101

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%)

Query: 299 PHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHT 358
           P     S+ C +C + F R+  LKRH  SH+N K + C  C+    R+D L++H +  H+
Sbjct: 97  PSGKLRSFVCEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHS 156

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 308 CHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           C LC K F R+S L+ HLL H+N+K F C +C      K NL +H ++
Sbjct: 169 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCDKEFNVKSNLNRHERI 216

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 298 VPHESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           +P  S   + C  C+++F+R+  LKRH+ S H   K F C  C+    R DNL QH+K
Sbjct: 382 IPDASKQ-FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 438

>Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON}
           (118605..120158) [1554 nt, 518 aa]
          Length = 517

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           SYQC +C K   R S L  H+  H+N + + C W  C+ T   K NL +H KL
Sbjct: 457 SYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKL 509

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%)

Query: 295 HDGVPHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           H   P      + C +C + F R+  L RH  SH+N K + C  C+    R+D LL+H +
Sbjct: 67  HGTTPSGKPRLFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQ 126

Query: 355 LKH 357
             H
Sbjct: 127 KVH 129

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 308 CHLCEKQFRRKSWLKRHLLSHSNVKKFHC--PWCSSTHKRKDNLLQHLKL 355
           C +C ++ RR S LK H+L+H+  + F C  P CS +   + N+L+H +L
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERL 255

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + C  C+++F+R+  LKRH+ S H   K + C  C+    R DNL QH+K
Sbjct: 264 FGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHS 329
           H     Y+CH+C K+F R   L +H+ +HS
Sbjct: 287 HMGEKPYECHICNKKFSRSDNLNQHIKTHS 316

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYL 361
           + C +C + F R+  LKRH  SH+N K F C +C     R+D +L+H +  H   +
Sbjct: 73  FLCPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLM 128

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + C  C+++F+R+  LKRH+ S H   K + C  C     R DNL QHLK
Sbjct: 418 FGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLK 467

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKK 333
           Y CHLC K+F R   L +HL +H++  K
Sbjct: 447 YGCHLCGKKFSRSDNLSQHLKTHTHEDK 474

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           ++   + C  C+++F+R+  LKRH+ S H   K F+C  C     R DNL QH+K
Sbjct: 253 DASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDKKFSRSDNLNQHIK 307

>SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 359

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           QCH+C K   R S L+ H+L H+ VK + C W  C+ +   K N+++H K
Sbjct: 286 QCHICGKVCSRPSTLRTHVLVHTGVKPYPCEWPGCNRSFNVKSNMIRHYK 335

>TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON}
           Anc_5.586 YHR006W
          Length = 312

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 30/67 (44%), Gaps = 12/67 (17%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW------------CSSTHKRKDNLLQHL 353
           Y CH C+  FR  S+L RH+  H+  K F CP+             S    RKD    HL
Sbjct: 13  YICHYCDASFRLMSYLTRHIKKHAIEKAFKCPFYNEKLPADLRCHVSGGFSRKDTFKMHL 72

Query: 354 KLKHTQY 360
           K +H  Y
Sbjct: 73  KCRHFIY 79

>NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {ON}
           Anc_5.586
          Length = 532

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSST------------HKRKDNLLQHL 353
           + CH C+ +FR + +L RH+  H+  K +HCP+ +S               R+D    HL
Sbjct: 183 FICHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGFSRRDTYKTHL 242

Query: 354 KLKHTQY 360
           K +H  Y
Sbjct: 243 KARHFVY 249

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%)

Query: 297 GVPHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
            V  +    + C +C + F R+  LKRH  SH++ K F C  C     RKD +L+HL+  
Sbjct: 18  AVKTDKPRPFLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKCFARKDLVLRHLQKL 77

Query: 357 HTQY 360
           H  Y
Sbjct: 78  HRDY 81

>TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4.351
           YJR127C
          Length = 1199

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 28/47 (59%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           Y C +C + F R+  LKRH  SH+N K F C +C     R+D +L+H
Sbjct: 57  YLCPICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH 103

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           E+   Y C  C++QF     L RH  S HS  K + CP C    KR+D++LQHL  K
Sbjct: 783 ENGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 839

>TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.586
           YHR006W
          Length = 484

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 17/84 (20%)

Query: 294 THDGV-PHES----HHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSST------ 342
           T DGV P +        + CH C+ +FR + +L RH+  H+  K +HCP+ S+       
Sbjct: 121 TPDGVSPQDEVAKDKEVFVCHYCDAKFRIRGYLTRHIKKHAIQKAYHCPFFSAEAPQDMR 180

Query: 343 ------HKRKDNLLQHLKLKHTQY 360
                   R+D    HL+ +H  Y
Sbjct: 181 CHNSGGFSRRDTYKTHLRARHFTY 204

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + C  C+++F+R+  LKRH+ S H   K F C  C     R DNL QH+K
Sbjct: 503 FGCEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIK 552

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 42/87 (48%), Gaps = 9/87 (10%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           + C +C + F R+  LKRH  +H+N K F C +C     R+D     L L+H Q L    
Sbjct: 32  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRD-----LVLRHQQKLHSSL 86

Query: 366 TLFGILMNVNNGSG----NTANLVTTS 388
           T  G   + NNG      N  +++T S
Sbjct: 87  TDTGSGASPNNGDAKNHLNERHIITIS 113

>Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR461C
          Length = 562

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW---CSSTH---------KRKDNLLQHL 353
           Y CH C+ +FR + +L RH+  H+  K +HCP+   CS             R+D    HL
Sbjct: 163 YVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNGCSPPETRCHTTGGFSRRDTYKTHL 222

Query: 354 KLKHTQY 360
           + +H  Y
Sbjct: 223 RSRHFIY 229

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + C  C+++F+R+  LKRH+ S H   K F C  C+    R DNL QH+K
Sbjct: 395 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 444

>Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {ON}
           similar to Ashbya gossypii AFR580C
          Length = 938

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 30/62 (48%)

Query: 302 SHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYL 361
           S   Y C  C + F R     RH  SH+ VK F C  CS +  R+D L +H++  H   L
Sbjct: 4   SQRKYICCFCARAFSRSEHRTRHERSHTGVKPFSCKVCSHSFVRRDLLQRHIRTVHRSML 63

Query: 362 LH 363
           L 
Sbjct: 64  LE 65

>Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463W
           (REAL)
          Length = 516

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 12/67 (17%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--C----------SSTHKRKDNLLQHL 353
           + CH C+  FR + +L RH+  H+  K +HCP+  C          S    R+D    HL
Sbjct: 160 FICHYCDATFRIRGYLTRHIKKHAIRKAYHCPFFNCATPPDLRCHNSGGFSRRDTYKTHL 219

Query: 354 KLKHTQY 360
           K +H  Y
Sbjct: 220 KARHVLY 226

>TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1655

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           Y C +C + F R+  L+RH  +H+N K F C +C     R+D +L+H
Sbjct: 87  YLCQICTRGFVRQEHLRRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 133

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + C  C+++F+R+  LKRH+ S H   K F C  C     R DNL QH+K
Sbjct: 303 FACEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLNQHIK 352

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKK 333
           H     + CH+CEK+F R   L +H+ +HSN  K
Sbjct: 326 HMGEKPFSCHICEKKFSRSDNLNQHIKTHSNFHK 359

>SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]
           {ON} similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 437

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 295 HDGVPHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           H    H+    ++C  CE+ F +KS L+RH+ +HS+ K FHC +C      K  L +H +
Sbjct: 75  HQLTVHQGIKPFKCDHCERTFAKKSHLERHMFTHSDNKPFHCSYCGKGVTTKQQLKRH-E 133

Query: 355 LKHTQYLLHEF 365
           + HT+    E+
Sbjct: 134 ITHTKSFKCEY 144

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 308 CHLCEKQFRRKSWLKRHLLSHSNVK---KFHCPW--CSSTHKRKDNLLQHLKLKH 357
           C  C K F+R   L+ HL  H NV    K+ C +  C+ T K    L QH+K  H
Sbjct: 171 CEHCGKMFQRPYRLQNHLAKHHNVDVENKYQCTYTACTETFKTWTALQQHIKADH 225

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 311 CEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHL 353
           C K F R S L  H L+ H  +K F C  C  T  +K +L +H+
Sbjct: 62  CNKSFTRPSLLTEHQLTVHQGIKPFKCDHCERTFAKKSHLERHM 105

>AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR186C (PZF1)
          Length = 476

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 295 HDGVPHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           H    H+   +YQC  C + F +KS L+RHL SHS  K F C  C      +  L +H +
Sbjct: 139 HQQTAHQGIRAYQCEQCGRGFTKKSHLERHLFSHSETKPFSCTVCGKGVTTRQQLRRH-E 197

Query: 355 LKHTQ 359
           + HT+
Sbjct: 198 ITHTK 202

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 308 CHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           C +C K F RK+ L+ H+L H+  K + CP+  C+ T   K NL +H ++
Sbjct: 118 CAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERI 167

>CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]
           {ON} some similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067c
          Length = 1013

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 29/57 (50%)

Query: 308 CHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHE 364
           C  C K F R     RH  SH+ VK F C  CS +  R+D L +H++  H   LL +
Sbjct: 14  CSFCNKAFSRSEHKTRHERSHAGVKPFECQVCSHSFVRRDLLQRHIRTVHRILLLRD 70

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC 336
           H     Y+C LC+K+F RK  L  HLL+H  VK F C
Sbjct: 565 HTGEKPYECELCDKKFSRKGNLAAHLLTHQKVKPFIC 601

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHL 353
           H  +  YQC  C K+F +   L+ H   H+  K + C  C     RK NL  HL
Sbjct: 537 HLGYKPYQCGYCGKRFTQGGNLRTHQRLHTGEKPYECELCDKKFSRKGNLAAHL 590

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 27/56 (48%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           HE    ++C  C + F + + L+ H+ SH   K + C +C     +  NL  H +L
Sbjct: 509 HEGSKQHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGYCGKRFTQGGNLRTHQRL 564

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           QC +C K   R S LK H L H+    F CPW  C+ +   K N+L+HLK
Sbjct: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 298 VPHESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           V  E+   Y C  C++QF     L RH  S HS  K   CP C    KR+D++LQHL  K
Sbjct: 769 VISENGKVYICQDCKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 828

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYL 361
           + C +C + F R+  LKRH  SH+N K F C +C     R+D +L+H +  H   +
Sbjct: 80  FLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLM 135

>KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {ON}
           weakly similar to uniprot|Q00947 Saccharomyces
           cerevisiae YDR463W STP1 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes and may have
           a role in tRNA processing
          Length = 623

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 12/72 (16%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW----------CSST--HKRKDN 348
           E+   + CH C+ +F+ + +L RH+  H+  K +HCP+          C ST    R+D+
Sbjct: 237 ETDMKFVCHYCDAEFKMRGYLTRHIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDS 296

Query: 349 LLQHLKLKHTQY 360
              HL+ +H  Y
Sbjct: 297 YKTHLRSRHFIY 308

>Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {ON}
           YPR186C (REAL)
          Length = 427

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 295 HDGVPHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           H    H+   +++C  C K F +KS L+RHL SHS+ K F C +C      +  L +H +
Sbjct: 69  HQSTVHQGLRAFRCDNCAKSFVKKSHLERHLFSHSDTKPFQCSYCGKGVTTRQQLKRH-E 127

Query: 355 LKHTQYLL 362
           + HT+  +
Sbjct: 128 VTHTKSFV 135

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHT 358
           + C +C + F R+  LKRH  +H+N K F C +C     R+D +L+H +  H+
Sbjct: 78  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHS 130

>TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.214
           YGR067C
          Length = 770

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           Y C  C K F R     RH  SH+ VK F C  C  +  R+D L +H++  H + LL E 
Sbjct: 12  YICSYCGKPFSRSEHKARHERSHTGVKPFECKVCRHSFVRRDLLQRHIRTVHRELLLVES 71

Query: 366 TL 367
           +L
Sbjct: 72  SL 73

>Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {ON}
           YPR186C (REAL)
          Length = 432

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQ 359
           H+   ++QC  C K F +KS L+RHL SHS+ K F C +C      +  L +H ++ HT+
Sbjct: 77  HQGLRAFQCDKCPKSFVKKSHLERHLYSHSDTKPFQCSYCGKGVTTRQQLKRH-EVTHTK 135

Query: 360 YLL 362
             +
Sbjct: 136 SFI 138

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 311 CEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHL 353
           C+K F R S L  H LS H  ++ F C  C  +  +K +L +HL
Sbjct: 59  CDKAFTRPSILTEHQLSVHQGLRAFQCDKCPKSFVKKSHLERHL 102

>Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON}
           YGR067C (REAL)
          Length = 806

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 29/57 (50%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLL 362
           Y C  C K F R     RH  SH+ VK F C  C  +  R+D L +H++  H  +LL
Sbjct: 8   YICSFCLKPFSRSEHKMRHERSHAGVKPFQCQICKHSFVRRDLLQRHIRTVHRTFLL 64

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           Y C LC+K+F R   LK HL +H+N + F C  C+    R+ +  +H  L
Sbjct: 651 YACELCDKKFTRPYNLKSHLRTHTNERPFICSICNKAFARQHDRKRHEDL 700

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 9/66 (13%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--------PW-CSSTHKRKDNLL 350
           H +   + C +C K F R+   KRH   H+  K++ C         W C     R D L 
Sbjct: 673 HTNERPFICSICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGTSWGCGKKFARSDALG 732

Query: 351 QHLKLK 356
           +H K +
Sbjct: 733 RHFKTE 738

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           + C  C ++F+R+  LKRH  S H   K F C  C+    R DNL QH+K
Sbjct: 634 FICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLAQHIK 683

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 19/35 (54%)

Query: 295 HDGVPHESHHSYQCHLCEKQFRRKSWLKRHLLSHS 329
           H+   H     + CH+C K+F R   L +H+ +HS
Sbjct: 652 HNRSLHMGEKPFDCHICNKKFSRSDNLAQHIKTHS 686

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 24/53 (45%)

Query: 311 CEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLH 363
           C   F R   L RH+  H+  K F CP C     R DNL QH +  H    LH
Sbjct: 52  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHKQLH 104

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           E+   Y C  C++QF     L RH  S HS  K + CP C    KR+D++LQHL  K
Sbjct: 751 ENGKVYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 807

>YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON}
           Putative protein of unknown function; contains a zinc
           finger motif similar to that of Adr1p
          Length = 804

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           Y C  C K F R     RH  SH+ VK F C  C  +  R+D L +H++  H  +LL  +
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVHRTFLLSSY 67

Query: 366 T 366
            
Sbjct: 68  A 68

>Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON}
           YGR067C (REAL)
          Length = 810

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 29/57 (50%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLL 362
           Y C  C K F R     RH  SH+ VK F C  C  +  R+D L +H++  H  +LL
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQICKHSFVRRDLLQRHIRTVHRSFLL 64

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           Y C  C++QF     L RH  S HS  K + CP C    KR+D++LQHL  K
Sbjct: 760 YVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVLQHLNKK 811

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           QC +C K   R S LK H + H+    F CPW  C+ +   K N+ +HLK
Sbjct: 456 QCPVCGKICSRPSTLKTHYMIHTGDTPFKCPWEGCNKSFNVKSNMFRHLK 505

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYL 361
           + C +C + F R+  L+RH  SH+N K F C +C     R+D +L+H +  H   +
Sbjct: 83  FLCPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLM 138

>AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR463W
           (STP1)
          Length = 544

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 12/71 (16%)

Query: 302 SHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW----------CSST--HKRKDNL 349
           S   + CH C+ +FR + +L RH+  H+  K +HCP+          C +T    R+D  
Sbjct: 148 SKERFVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDTY 207

Query: 350 LQHLKLKHTQY 360
             HL+ +H  Y
Sbjct: 208 KTHLRSRHFIY 218

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           + C +C + F R+  LKRH  SH+N K F C +C     R+D +L+H
Sbjct: 52  FVCSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVLRH 98

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKLKH 357
           H     Y+C  C ++F RK  L  H L+H N+K FHC    C+ +  +  N+  H    H
Sbjct: 536 HTGEKPYECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFH 595

Query: 358 TQYL 361
            Q L
Sbjct: 596 LQTL 599

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           H  +  +QC  C K+F +   L+ H+  H+  K + C  C     RK NL  H
Sbjct: 508 HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH 560

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           ++C  C K F + + L+ H+ SH   K F C +C     +  NL  H++L
Sbjct: 486 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 535

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 26/54 (48%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHL 353
           H     Y+C  C K F +   LK H+  H+  K F C +CS    RK NL  HL
Sbjct: 410 HLGDKPYKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSKRFSRKGNLTAHL 463

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           ++C++C K F + + L+ HL SH   K + C WC     +  NL  H++L
Sbjct: 388 HECNICHKLFIQLTHLEVHLRSHLGDKPYKCTWCGKGFTQGGNLKTHVRL 437

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 3/69 (4%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKLKH 357
           H     + C  C K+F RK  L  HL++H  V+ F C    C  T  +  N+  H    H
Sbjct: 438 HTGEKPFSCEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNRFH 497

Query: 358 TQYLLHEFT 366
            Q  L E T
Sbjct: 498 -QNTLTELT 505

>ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 616

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (46%)

Query: 303 HHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLL 362
              Y C  C K F R     RH  SH+ +K F C  C     R+D L +H++  H + LL
Sbjct: 5   QRKYVCSFCSKAFSRSEHRARHERSHTGMKPFECKVCRHAFVRRDLLQRHIRTVHRELLL 64

>Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON}
           similar to Ashbya gossypii ADL051W
          Length = 223

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 308 CHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           CH+C K F RK+ L+ H+L H+ VK + C +  C+ T   K NL +H ++
Sbjct: 161 CHICLKSFTRKTSLQTHMLIHTKVKPYRCSYQRCNKTFNVKSNLYRHERI 210

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKLKH 357
           H     Y+C  C ++F RK  L  H L+H N+K FHC    C+ +  +  N+  H    H
Sbjct: 553 HTGEKPYECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFH 612

Query: 358 TQYL 361
            Q L
Sbjct: 613 LQTL 616

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKH 357
           H  +  +QC  C K+F +   L+ H+  H+  K + C  C     RK NL  H +L H
Sbjct: 525 HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAH-RLTH 581

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           ++C  C K F + + L+ H+ SH   K F C +C     +  NL  H++L
Sbjct: 503 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 552

>KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1290

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 293 LTHDGV-PHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQ 351
           L  +GV P      + C +C + F R   L+RH  SH+N K + C  C     R+D LL+
Sbjct: 61  LKLNGVTPSGKPRRFVCKVCTRAFARSEHLERHERSHTNEKPYECGICDRMFTRRDLLLR 120

Query: 352 H 352
           H
Sbjct: 121 H 121

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           Y C  C++QF     L RH  S HS  K   CP C    KR+D++LQHL  K
Sbjct: 859 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 910

>Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON}
           YGR067C (REAL)
          Length = 812

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 29/57 (50%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLL 362
           Y C  C K F R     RH  SH+ VK F C  C  +  R+D L +H++  H  +LL
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVHRSFLL 64

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           + C +C + F R+  LKRH  SH+N K F C +C     R+D +L+H
Sbjct: 75  FLCSICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH 121

>ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No
           homolog in Saccharomyces cerevisiae
          Length = 146

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKLKHTQYLL 362
           S  C +C K+F RK+ L  HLL H++++ + C +  C+ +   K NL +HL++     L 
Sbjct: 75  SKTCPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIHRGHELH 134

Query: 363 HE 364
           HE
Sbjct: 135 HE 136

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           QC +C K   R S LK H L H+    F CPW  C+ +   K N+L+H K
Sbjct: 299 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKSFNVKSNMLRHFK 348

>Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}
           similar to Ashbya gossypii AGR117C
          Length = 819

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           E   +Y C  C++QF     L RH  S HS  K   CP C    KR+D++LQHL  K
Sbjct: 747 EKGKAYICQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 803

>YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON}
           PZF1Transcription factor IIIA (TFIIIA); essential DNA
           binding protein required for transcription of 5S rRNA by
           RNA polymerase III; not involved in transcription of
           other RNAP III genes; nine conserved zinc fingers; may
           also bind 5S rRNA
          Length = 429

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQ 359
           H+   ++QC  C K F +KS L+RHL +HS+ K F C +C      +  L +H ++ HT+
Sbjct: 74  HQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRH-EVTHTK 132

Query: 360 YLL 362
             +
Sbjct: 133 SFI 135

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 311 CEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHL 353
           C+K F R S L  H LS H  ++ F C  C+ +  +K +L +HL
Sbjct: 56  CDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHL 99

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 37/75 (49%), Gaps = 7/75 (9%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365
           + C  C + F R+  LKRH  SH+N K F C +C     R+D +L+H      Q+ LH  
Sbjct: 71  FVCSTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH------QHKLHA- 123

Query: 366 TLFGILMNVNNGSGN 380
            L G  M+    S N
Sbjct: 124 ALIGTSMDSYTNSSN 138

>AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR067C
          Length = 838

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 30/62 (48%)

Query: 302 SHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYL 361
           S   Y C  C + F R     RH  SH+ VK F C  C+ +  R+D L +H++  H   L
Sbjct: 4   SQRKYICSFCAQAFSRSEHKTRHERSHTGVKPFSCKVCNHSFVRRDLLQRHIRTVHRSML 63

Query: 362 LH 363
           L 
Sbjct: 64  LE 65

>NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303
          Length = 571

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHE 364
           +Y C LC+K F R   LK HL +H+N K F C  C     R+ +  +H  L HT      
Sbjct: 451 AYACELCDKTFTRPYNLKSHLRTHTNEKPFVCNICGKAFARQHDRKRHEDL-HTGK--KR 507

Query: 365 FTLFGILMN 373
           +   G+L N
Sbjct: 508 YVCGGVLKN 516

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 9/64 (14%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--------PW-CSSTHKRKDNLL 350
           H +   + C++C K F R+   KRH   H+  K++ C        PW C     R D L 
Sbjct: 474 HTNEKPFVCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALG 533

Query: 351 QHLK 354
           +H K
Sbjct: 534 RHFK 537

>TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.326
           YJL056C
          Length = 985

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 305 SYQC--HLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           SY+C  H C K F+++  + RHL +HS  K F C  CS     K+ L+QH +
Sbjct: 869 SYECKWHNCHKVFKQRQKILRHLKTHSGFKPFKCDVCSRCFSSKETLIQHYR 920

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           H     Y+C +C K F   S LK H+ +H+  K F C  C        N  +H+K+
Sbjct: 922 HSGEKPYKCEICGKSFSISSSLKIHVRTHTGEKPFECKVCGKRFVESSNYSKHMKV 977

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 25/55 (45%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           H     ++C +C + F  K  L +H  +HS  K + C  C  +     +L  H++
Sbjct: 894 HSGFKPFKCDVCSRCFSSKETLIQHYRTHSGEKPYKCEICGKSFSISSSLKIHVR 948

>Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           QC +C K   R S LK H L H+    F C W  CS +   K N+L+HLK
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLK 304

>CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1321

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 308 CHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLH 363
           C +C + F R   LKRH  +H+N K F C +C     R+D +L+H      QY LH
Sbjct: 35  CPICTRGFVRLEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH------QYKLH 84

>TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.117
           YPR015C
          Length = 162

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           QC +C K   R S LK H L H+    F C W  C+ +   K N+L+HLK
Sbjct: 102 QCPVCGKVCSRPSTLKTHYLIHTGDTPFKCSWGNCTKSFNVKSNMLRHLK 151

>Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           QC +C K   R S LK H L H+    F C W  CS +   K N+L+HLK
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLK 304

>ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 587

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW----------C--SSTHKRKDNLLQHL 353
           + CH C+ +F+ + +L RH+  H+  K +HCP+          C  S    R+D    HL
Sbjct: 204 FVCHYCDAKFKIRGYLTRHIKKHAIQKAYHCPFFMGEAPPELRCHNSGGFSRRDTYKTHL 263

Query: 354 KLKHTQY 360
           + +H  Y
Sbjct: 264 RTRHFIY 270

>Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W
           (REAL)
          Length = 948

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKLKH 357
           H     Y C +C+K+F RK  L  HL++H  +K F C    C  T  +  N+  H    H
Sbjct: 674 HTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCDKTFTQLGNMKAHQNRFH 733

Query: 358 TQYL 361
            + L
Sbjct: 734 KETL 737

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHL 353
           H  +  + C  C K+F +   L+ H   H+  K + C  C     RK NL  HL
Sbjct: 646 HIGYKPFACDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 699

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           ++C  C + F + + L+ H+ SH   K F C +C     +  NL  H +L
Sbjct: 624 HECPYCHRLFSQATHLEVHVRSHIGYKPFACDYCGKRFTQGGNLRTHERL 673

>Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {ON}
           YNL027W (CRZ1) - putative transcription factor [contig
           27] FULL
          Length = 531

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           Y C LC+K+F R   LK HL +H++ + F C  C     R+ +  +H  L
Sbjct: 413 YACELCDKKFTRPYNLKSHLRTHTDERPFSCAICGKAFARQHDRKRHEDL 462

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--------PW-CSSTHKRKDNLL 350
           H     + C +C K F R+   KRH   H+  K++ C         W C     R D L 
Sbjct: 435 HTDERPFSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALG 494

Query: 351 QHLK 354
           +H K
Sbjct: 495 RHFK 498

>KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON}
           Anc_5.586 YHR006W
          Length = 442

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 303 HHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW----------CSST--HKRKDNLL 350
             ++ CH C+ +F+ + +L RH+  H+  K F CP+          C ST    R+D   
Sbjct: 119 EEAFICHYCDAKFKIRGYLTRHIRKHAIEKAFKCPYFNATLPKTLRCHSTGGFSRRDTFK 178

Query: 351 QHLKLKH 357
            HLK +H
Sbjct: 179 IHLKSRH 185

>Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON}
           (118186..120660) [2475 nt, 825 aa]
          Length = 824

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           E+   Y C  C++QF     L RH  S HS  K   CP C    KR+D++LQHL  K
Sbjct: 682 ENGKVYICQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 738

>NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa]
           {ON} Anc_1.326
          Length = 836

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           H     +QCHLC+K+F   S LK H+ +H+  K   C  C        NL +H+K
Sbjct: 760 HTGEKPFQCHLCDKRFTIASSLKIHIRTHTGEKPLKCKICGKAFNESSNLSKHIK 814

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 306 YQCHL--CEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           YQCH   C K+F ++  + RHL  HS  K   CP C+      + L QH +
Sbjct: 708 YQCHWHGCSKKFTQRQKMVRHLKVHSGYKPCKCPVCNKCFSNLETLKQHQR 758

>Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           QC +C K   R S LK H L H+    F C W  CS +   K N+L+HLK
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLK 304

>AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER169W
           (RPH1) and YDR096W (GIS1)
          Length = 799

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           +Y C  C++QF     L RH  S HS  K   CP C    KR+D++LQHL  K
Sbjct: 731 AYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           E+   ++C +C K FRR S L  H   H+  K + CP+  C  +   K N+ +H KL
Sbjct: 203 ENKRKFKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYENCHKSFNAKSNMFRHYKL 259

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 293 LTHDGV-PHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQ 351
           LT +G  P      + C  C++ F R+  L RH  SH+N K F C  C     R+D L++
Sbjct: 138 LTLNGTTPSGKLRLFLCDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIR 197

Query: 352 HLKLKH 357
           H +  H
Sbjct: 198 HAQKIH 203

>NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {ON}
           Anc_3.518
          Length = 524

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--PWCSSTHKRKDNLLQHLK 354
           ++C +C + F R    KRH+ +H+  K  HC  P C  +  R D L +HL+
Sbjct: 18  FKCDVCSRGFHRLEHKKRHMRTHTGEKPHHCNFPGCGKSFSRSDELKRHLR 68

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           Y C LC+K+F R   LK HL +H++ + F C  C     R+ +  +H  L
Sbjct: 408 YACELCDKKFTRPYNLKSHLRTHTDERPFACAICGKAFARQHDRKRHEDL 457

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCP--------W-CSSTHKRKDNLL 350
           H     + C +C K F R+   KRH   H+  K++ C         W C     R D L 
Sbjct: 430 HTDERPFACAICGKAFARQHDRKRHEDLHTGKKRYTCKGKLKDGTQWGCGKKFARSDALG 489

Query: 351 QHLK 354
           +H K
Sbjct: 490 RHFK 493

>YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}
           AZF1Zinc-finger transcription factor, involved in
           induction of CLN3 transcription in response to glucose;
           genetic and physical interactions indicate a possible
           role in mitochondrial transcription or genome
           maintenance
          Length = 914

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKLKH 357
           H     Y C +C+K+F RK  L  HL++H  +K F C    C+ T  +  N+  H    H
Sbjct: 643 HTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFH 702

Query: 358 TQYL 361
            + L
Sbjct: 703 KETL 706

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHL 353
           H  +  + C  C K+F +   L+ H   H+  K + C  C     RK NL  HL
Sbjct: 615 HIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 668

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           ++C  C + F + + L+ H+ SH   K F C +C     +  NL  H +L
Sbjct: 593 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERL 642

>Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON}
           (65876..67336) [1461 nt, 487 aa]
          Length = 486

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           +Y+C +C K+  R   L  H+L H+ V+ + C W  C  T   K NL +H+K+
Sbjct: 423 TYECSVCGKRVTRAYSLHAHMLIHTKVRPYKCDWENCGKTFNVKSNLNRHVKI 475

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 29/62 (46%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQ 359
           H     + CH C KQF   S L+ H+ +H+  K   C  C        NL +H+K+   +
Sbjct: 566 HSGERPFHCHYCRKQFSTSSSLRVHIRTHTGEKPLSCTVCGKRFNESSNLSKHMKIHERK 625

Query: 360 YL 361
           Y+
Sbjct: 626 YM 627

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 3/60 (5%)

Query: 298 VPHESHHSYQ---CHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLK 354
            PH+  H ++   C  C K F     L +H+ +HS  + FHC +C        +L  H++
Sbjct: 533 APHQGTHRHKPCSCPHCPKTFSTDDILAQHIRTHSGERPFHCHYCRKQFSTSSSLRVHIR 592

>NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON} 
          Length = 266

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 54/128 (42%), Gaps = 12/128 (9%)

Query: 240 SHNIQPSTALQPLN-IRTGEDSFSTFKEHNTHEQQLLSNPNNGRXXXXXXXXXXLTHDGV 298
           S NIQPS   QP+N + TG    ++ +  +  + + + N N+ +          L     
Sbjct: 142 SRNIQPSN--QPVNPVVTGSLLPTSSRSSSLQDVKPIINKNSSKVPSKKRANRTLL---- 195

Query: 299 PHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKLK 356
              S    QC  C K   R S LK H L H+    F C W  C+     K N+L+HLK  
Sbjct: 196 ---SKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAH 252

Query: 357 HTQYLLHE 364
             + +  E
Sbjct: 253 EKKVIKKE 260

>TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa]
           {ON} Anc_7.543 YPR186C
          Length = 448

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQ 359
           H+    + C +C+K + R   L+RHL+SHS  K FHC +C+     K  L +H ++ HT+
Sbjct: 84  HQGIKQFTCDICQKSYSRMYHLERHLISHSTEKPFHCSFCNKGVTTKQQLKRH-EITHTK 142

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 311 CEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHL 353
           CEK F R S L  H LS H  +K+F C  C  ++ R  +L +HL
Sbjct: 66  CEKVFTRPSLLTEHQLSFHQGIKQFTCDICQKSYSRMYHLERHL 109

>Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113W
           (REAL)
          Length = 909

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKLKH 357
           H     Y C +C+K+F RK  L  HL++H  +K F C    C+ T  +  N+  H    H
Sbjct: 633 HTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFH 692

Query: 358 TQYL 361
            + L
Sbjct: 693 KETL 696

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHL 353
           H  +  + C  C K+F +   L+ H   H+  K + C  C     RK NL  HL
Sbjct: 605 HIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 658

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           ++C  C + F + + L+ H+ SH   K F C +C     +  NL  H +L
Sbjct: 583 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERL 632

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 296 DGVPH-ESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--PWCSSTHKRKDNLLQH 352
           D +P  + +  Y+C +C + F R    KRHL +H+  K   C  P C+    R D L +H
Sbjct: 9   DSLPENDENRPYKCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCTKGFSRGDELKRH 68

Query: 353 LK 354
           L+
Sbjct: 69  LR 70

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 305 SYQCHL--CEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           SYQC    C K F ++  L RH+  H+  K F CP CS T   +D L QH++
Sbjct: 515 SYQCRWDGCTKHFAQRQKLLRHIKVHTGYKPFKCPHCSKTFSTEDILSQHIR 566

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 30/62 (48%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQ 359
           H     ++C  C+K+F   S L+ H+ +H+  K   C  C        NL +H+K+   +
Sbjct: 568 HSGERPFKCQFCDKRFTTSSSLRIHIRTHTGEKPLACNVCGKRFNESSNLSKHMKIHERK 627

Query: 360 YL 361
           Y+
Sbjct: 628 YM 629

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 26/55 (47%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           H  +  ++C  C K F  +  L +H+ +HS  + F C +C        +L  H++
Sbjct: 540 HTGYKPFKCPHCSKTFSTEDILSQHIRTHSGERPFKCQFCDKRFTTSSSLRIHIR 594

>Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113W
           (REAL)
          Length = 917

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKLKH 357
           H     Y C +C+K+F RK  L  HL++H  +K F C    C+ T  +  N+  H    H
Sbjct: 644 HTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFH 703

Query: 358 TQYL 361
            + L
Sbjct: 704 KETL 707

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHL 353
           H  +  + C  C K+F +   L+ H   H+  K + C  C     RK NL  HL
Sbjct: 616 HIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 669

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           ++C  C + F + + L+ H+ SH   K F C +C     +  NL  H +L
Sbjct: 594 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERL 643

>NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]
           {ON} Anc_4.351
          Length = 1341

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           + C  C + F R+  LKRH  SH+N K F C +C     R+D +L+H
Sbjct: 72  FLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRH 118

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 308 CHLCEKQFRRKSWLKRHLLSHSNVKKFHC--PWCSSTHKRKDNLLQHLKL 355
           C +C ++ RR S LK H+L+H+  + F C  P C+ +   + N+L+H +L
Sbjct: 215 CKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKSFNVRSNMLRHERL 264

>Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa]
           {ON} complement(144388..146058) [1671 nt, 557 aa]
          Length = 556

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 12/67 (17%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW------------CSSTHKRKDNLLQHL 353
           + CH C+  FR + +L RH+  H+  K + CP+             S    R+D    HL
Sbjct: 180 FVCHYCDASFRIRGYLTRHIKKHAIQKAYCCPFYNKSSPPDIRCHTSGGFSRRDTYKTHL 239

Query: 354 KLKHTQY 360
           K++H  Y
Sbjct: 240 KVRHFMY 246

>Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C
           (REAL)
          Length = 878

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQ 359
           H     Y+CH+C+K+F   S LK H+ +H+  K   C  C        NL +H+K    +
Sbjct: 788 HSGEKPYKCHICDKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHKKK 847

Query: 360 Y 360
           Y
Sbjct: 848 Y 848

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 306 YQC--HLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           YQC  H C + F ++  L RHL  HS  K + C  C      ++ L+QH +
Sbjct: 736 YQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTR 786

>Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {ON}
           YPR186C (REAL)
          Length = 407

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           H+    +QC  C K F +KS L+RHL SHS+ K F C +C      +  L +H
Sbjct: 74  HQGLRPFQCDKCPKSFVKKSHLERHLYSHSDTKPFQCSYCGKGVTTRQQLKRH 126

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           + CH C + F R+  L RH  SH+N K + C  C     R+D LL+H
Sbjct: 49  FVCHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSRRDLLLRH 95

>KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C
          Length = 922

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 28/60 (46%)

Query: 302 SHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYL 361
           S   Y C  C K F R     RH  SH+  K F C  CS +  R+D L +H++  H   L
Sbjct: 4   SQRKYICSFCAKPFSRSEHKARHERSHTGSKPFSCSICSHSFVRRDLLQRHIRTVHKSSL 63

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           Y C+LC+K+F R   LK HL +H++ + F C  C     R+ +  +H  L
Sbjct: 426 YSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSVCGKAFARQHDRKRHEDL 475

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--------PW-CSSTHKRKDNLL 350
           H     + C +C K F R+   KRH   HS  K++ C         W C     R D L 
Sbjct: 448 HTDERPFSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALG 507

Query: 351 QHLK 354
           +H K
Sbjct: 508 RHFK 511

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKLKH 357
           H     Y+C  C K+F RK  L  H+L+H N K F C    C+ +  +  N+  H    H
Sbjct: 537 HTGERPYECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAHQNRFH 596

Query: 358 TQYL 361
            Q L
Sbjct: 597 LQTL 600

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQ 359
           H  +  +QC  C K+F +   L+ H+  H+  + + C  C     RK NL  H+ L H  
Sbjct: 509 HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHM-LTHEN 567

Query: 360 Y 360
           Y
Sbjct: 568 Y 568

 Score = 37.0 bits (84), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           ++C  C K F + + L+ H+ SH   K F C +C     +  NL  H++L
Sbjct: 487 HKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL 536

>SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]
           {ON} similar to uniprot|P39956 Saccharomyces cerevisiae
           YER169W RPH1 Transcriptional repressor of PHR1 which is
           a photolyase induced by DNA damage binds to AG(4)
           (C(4)T) sequence upstream of PHR1 Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 814

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           E    Y C  C++QF     L RH  S HS  K   CP C    KR+D++LQHL  K
Sbjct: 713 EKGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 769

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           + C +C K+F+R S L  H+  H+  K + CP+  C+ +   K N+L+H KL
Sbjct: 173 FICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKL 224

>TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543
           YPR186C
          Length = 472

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 28/47 (59%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           + C +C  +F RKS L+RHL+SHS  K FHC +C      +  L +H
Sbjct: 108 HSCDVCGSKFSRKSHLERHLISHSAEKPFHCSFCDKGLTTRQQLKRH 154

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 298 VPHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           + H +   + C  C+K    +  LKRH ++HS  K F C +  C+ +  +   L  H+  
Sbjct: 128 ISHSAEKPFHCSFCDKGLTTRQQLKRHEITHS--KSFQCTFEGCAESFYKHPQLRAHVLS 185

Query: 356 KHTQYLLHEF 365
            H + L  +F
Sbjct: 186 VHLEKLKCQF 195

>TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON} 
          Length = 454

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 308 CHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           C+ C + F     L RH  + H N K F CP C    KR+D++LQHL  K
Sbjct: 392 CYECCRSFSSSHHLTRHKKTVHLNEKPFSCPRCRKRFKRRDHVLQHLNKK 441

>YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON}
           Putative zinc finger protein; YPR013C is not an
           essential gene
          Length = 317

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           QC +C K   R S LK H L H+    F C W  C+ +   K N+L+HLK
Sbjct: 255 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLK 304

>CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11
          Length = 344

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           QC +C K   R S LK H+L H+    F C W  C      K NLL+HLK
Sbjct: 285 QCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLK 334

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNL----LQHLKL 355
           H  +  YQC+ C K+F +   LK H   H+  K + C  C+    RK NL    L H KL
Sbjct: 539 HIGYKPYQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKICNKRFSRKGNLTAHVLTHKKL 598

Query: 356 K 356
           K
Sbjct: 599 K 599

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQH 352
           H     Y C +C K+F RK  L  H+L+H  +K + C    C+ T  +  N+  H
Sbjct: 567 HTGEKPYSCKICNKRFSRKGNLTAHVLTHKKLKPYFCKLDNCNKTFTQLGNMKAH 621

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           ++QC  C + F + + L+ H+ SH   K + C +C     +  NL  H +L
Sbjct: 516 THQCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNFCGKKFTQGGNLKTHQRL 566

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKH 357
           + C +C + F R+  L RH  SH+  K ++C  CS    R+D L++H +  H
Sbjct: 116 FVCEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQKVH 167

>CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169w
          Length = 980

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           +S   Y C  C++QF     L RH  S HS  K   CP C    KR+D++LQHL  K
Sbjct: 897 DSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           Y C LC+K+F R   LK HL +H++ + F C  C     R+ +  +H  L
Sbjct: 424 YACELCDKKFTRPYNLKSHLRTHTDERPFACNVCGKAFARQHDRKRHEDL 473

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--------PW-CSSTHKRKDNLL 350
           H     + C++C K F R+   KRH   H+  K++ C         W C     R D L 
Sbjct: 446 HTDERPFACNVCGKAFARQHDRKRHEDLHTGKKRYICGGNLKDGTSWGCGKKFARSDALG 505

Query: 351 QHLK 354
           +H K
Sbjct: 506 RHFK 509

>TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON}
           Anc_8.234 YER169W
          Length = 519

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 305 SYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356
           S  C  C + F     L RH  + H N K F CP C    KR+D++LQHL  K
Sbjct: 446 SSYCFECRRSFSSSHHLTRHRKTVHLNEKPFSCPKCGKRFKRRDHVLQHLNKK 498

>KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {ON}
           Anc_8.116 YPR013C
          Length = 410

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354
           QC +C K   R S LK H L H+    F C W  CS +   K N+L+HLK
Sbjct: 341 QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEDCSKSFNVKSNMLRHLK 390

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           E    + C +C K FRR    KRH+ +H+  K  HC +  C     R D L +HLK+
Sbjct: 8   EVDRPFICDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLKI 64

>SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar to
           uniprot|Q12041 Saccharomyces cerevisiae YDR253C MET32
           Zinc-finger DNA-binding protein, involved in regulating
           expression of the methionine biosynthetic genes
          Length = 205

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           YQC  CE  FRR S L+RH  +H  +    C  C     RKD L +H
Sbjct: 125 YQCDKCELVFRRSSDLRRHERAHLPILPNICSLCGKGFARKDALKRH 171

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 26/57 (45%), Gaps = 3/57 (5%)

Query: 305 SYQC---HLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHT 358
           S++C     C   F R   L RH+  H+  K F CP C     R DNL QH +  H 
Sbjct: 40  SFKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHA 96

>YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON}
           ZAP1Zinc-regulated transcription factor; binds to
           zinc-responsive promoters to induce transcription of
           certain genes in presence of zinc, represses other genes
           in low zinc; regulates its own transcription; contains
           seven zinc-finger domains
          Length = 880

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQ 359
           H     Y+CH+C K+F   S LK H+ +H+  K   C  C        NL +H+K    +
Sbjct: 790 HSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQKK 849

Query: 360 Y 360
           Y
Sbjct: 850 Y 850

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 306 YQC--HLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLK 354
           YQC  H C + F ++  L RHL  HS  K + C  C      ++ L+QH +
Sbjct: 738 YQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTR 788

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 294 THDGVPHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQ 351
           TH+ + H     YQC LC K+F RK  L  H+L+H  +K F C    C+ +  +  N+  
Sbjct: 538 THERL-HTGEKPYQCELCGKRFSRKGNLAAHVLTHKKIKPFICKLDNCNKSFTQLGNMKG 596

Query: 352 HLKLKHTQYL 361
           H    H + L
Sbjct: 597 HQNKFHLETL 606

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 29/64 (45%), Gaps = 3/64 (4%)

Query: 293 LTHDGVPHESH---HSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNL 349
           LTH  V   SH     YQC  C K+F +   L+ H   H+  K + C  C     RK NL
Sbjct: 505 LTHLEVHIRSHIGIKPYQCQYCGKKFTQGGNLRTHERLHTGEKPYQCELCGKRFSRKGNL 564

Query: 350 LQHL 353
             H+
Sbjct: 565 AAHV 568

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 299 PHESH--HSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           P  SH    ++C  C + F + + L+ H+ SH  +K + C +C     +  NL  H +L
Sbjct: 484 PFGSHGVKQHECRYCHRFFTQLTHLEVHIRSHIGIKPYQCQYCGKKFTQGGNLRTHERL 542

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           Y C +C K FRR S L+ H    S  + + CP+  C+ +   K N+L+H KL
Sbjct: 239 YFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKL 290

>KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.303
           YNL027W
          Length = 519

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           Y C +C+K+F R   LK HL +H+N + F C  C     R+ +  +H  L
Sbjct: 397 YTCEVCDKKFTRPYNLKSHLRTHTNERPFACTICGKAFARQHDRKRHEDL 446

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 9/64 (14%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--------PW-CSSTHKRKDNLL 350
           H +   + C +C K F R+   KRH   HS  K++ C        PW C     R D L 
Sbjct: 419 HTNERPFACTICGKAFARQHDRKRHEDLHSGKKRYACGGKLKSGIPWGCGKKFARSDALG 478

Query: 351 QHLK 354
           +H K
Sbjct: 479 RHFK 482

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 29/66 (43%), Gaps = 2/66 (3%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKLKH 357
           H     Y C  C K+F RK  L  H L+H  VK F C    C  T  +  N+  H    H
Sbjct: 522 HTGEKPYACQHCSKRFSRKGNLAAHQLTHREVKPFLCKLDNCGKTFAQLGNMKNHQNRFH 581

Query: 358 TQYLLH 363
           +Q +L 
Sbjct: 582 SQTVLE 587

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQH 352
           H  +  ++C  C K+F +   L+ H   H+  K + C  CS    RK NL  H
Sbjct: 494 HLGYKPFECQFCGKRFTQGGNLRTHQRLHTGEKPYACQHCSKRFSRKGNLAAH 546

 Score = 37.7 bits (86), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 27/58 (46%)

Query: 298 VPHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
            P +    ++C  C  +F + + L+ H+ SH   K F C +C     +  NL  H +L
Sbjct: 464 TPQQQQKKHECPYCHHKFAQTTHLEVHVRSHLGYKPFECQFCGKRFTQGGNLRTHQRL 521

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 301 ESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355
           E    Y C  C K+F+R S L  H+  H+  K + CP+  C  +   K N+L+H KL
Sbjct: 253 EEIAKYGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYKL 309

>NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518
          Length = 401

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--PWCSSTHKRKDNLLQHLK 354
           ++C  C + F R    KRH+ +H+  K  HC  P C     R D L +HL+
Sbjct: 18  FRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLR 68

>TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.303
           YNL027W
          Length = 532

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           Y C +CEK+F R   L+ HL +H+N + F C  C     R+ +  +H  L
Sbjct: 420 YDCVICEKKFTRPYNLRSHLRTHTNERPFVCTVCGKAFAREHDRKRHEDL 469

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--------PW-CSSTHKRKDNLL 350
           H +   + C +C K F R+   KRH   H+  K++ C         W C     R D L 
Sbjct: 442 HTNERPFVCTVCGKAFAREHDRKRHEDLHTGKKRYICGGKLKSGEAWGCGKKFARSDALG 501

Query: 351 QHLK 354
           +H K
Sbjct: 502 RHFK 505

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 22/48 (45%)

Query: 311 CEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHT 358
           C   F R   L RH+  H+  K F CP C     R DNL QH +  H 
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHA 96

>KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.303
           YNL027W
          Length = 618

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
           Y C +C+K+F R   LK HL +H+N + F C  C     R+ +  +H  L
Sbjct: 499 YACDMCDKKFTRPYNLKSHLRTHTNERPFVCSICGKAFARQHDRKRHEDL 548

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 12/77 (15%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--------PW-CSSTHKRKDNLL 350
           H +   + C +C K F R+   KRH   HS  K++ C         W C     R D L 
Sbjct: 521 HTNERPFVCSICGKAFARQHDRKRHEDLHSGKKRYICGGTLKDGTKWGCGKKFARSDALG 580

Query: 351 QHLKLKHTQY---LLHE 364
           +H K +  +    LL+E
Sbjct: 581 RHFKTEAGKRCISLLYE 597

>NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {ON}
           Anc_2.303 YNL027W
          Length = 708

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKL 355
            +S   Y C LC K F R   LK HL +H+N K F C  C+    R+ +  +H  L
Sbjct: 574 RQSTGGYICELCNKTFTRPYNLKSHLRTHTNEKPFICKICNKAFARQHDRKRHEDL 629

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 300 HESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--------PW-CSSTHKRKDNLL 350
           H +   + C +C K F R+   KRH   H+  K++ C         W C     R D L 
Sbjct: 602 HTNEKPFICKICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGDTWGCGKKFARSDALG 661

Query: 351 QHLK 354
           +H K
Sbjct: 662 RHFK 665

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.130    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,603,517
Number of extensions: 1132439
Number of successful extensions: 4871
Number of sequences better than 10.0: 604
Number of HSP's gapped: 4625
Number of HSP's successfully gapped: 822
Length of query: 431
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 319
Effective length of database: 40,638,807
Effective search space: 12963779433
Effective search space used: 12963779433
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)