Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E18525g2.534ON1711718011e-110
TDEL0A030802.534ON1671654862e-62
SAKL0A09504g2.534ON1671654671e-59
KNAG0C058002.534ON1671654627e-59
NCAS0F008902.534ON1671654541e-57
KLTH0D06864g2.534ON1671654513e-57
Skud_13.2272.534ON1671654498e-57
Suva_13.2482.534ON1671654481e-56
YMR071C (TVP18)2.534ON1671654481e-56
TBLA0G022402.534ON1671654411e-55
NDAI0H013902.534ON1671604384e-55
TPHA0G035202.534ON2041654275e-53
KAFR0A018702.534ON1671654183e-52
Ecym_72542.534ON1671654184e-52
Smik_13.2502.534ON1671654167e-52
AGL072W2.534ON1671644123e-51
CAGL0K03025g2.534ON1671604105e-51
ZYRO0B02024g2.534ON1661574011e-49
Kpol_348.92.534ON1301313033e-35
Kwal_26.80252.534ON64661358e-11
KLLA0E17161g3.201ON41744629.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E18525g
         (171 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} simil...   313   e-110
TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON...   191   2e-62
SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504...   184   1e-59
KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2....   182   7e-59
NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.53...   179   1e-57
KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504...   178   3e-57
Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {O...   177   8e-57
Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {O...   177   1e-56
YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}  ...   177   1e-56
TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON...   174   1e-55
NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.53...   173   4e-55
TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON...   169   5e-53
KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON...   165   3e-52
Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to...   165   4e-52
Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {O...   164   7e-52
AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic hom...   163   3e-51
CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {...   162   5e-51
ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {O...   159   1e-49
Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON} c...   121   3e-35
Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}...    57   8e-11
KLLA0E17161g Chr5 (1526177..1527430) [1254 bp, 417 aa] {ON} simi...    28   9.0  

>KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} similar
           to uniprot|Q04767 Saccharomyces cerevisiae YMR071C TVP18
           Tlg2-Vesicle Protein of 18 kDa Integral membrane vesicle
           protein
          Length = 171

 Score =  313 bits (801), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 158/171 (92%), Positives = 158/171 (92%)

Query: 1   MVSVGFLKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXX 60
           MVSVGFLKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFH          
Sbjct: 1   MVSVGFLKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHFSAVIVFSII 60

Query: 61  XXXQGLIILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTS 120
              QGLIILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTS
Sbjct: 61  AIVQGLIILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTS 120

Query: 121 LIVVAVGLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
           LIVVAVGLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML
Sbjct: 121 LIVVAVGLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171

>TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  191 bits (486), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 117/165 (70%), Gaps = 2/165 (1%)

Query: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGL 66
           ++   NV+G+V DLKS NFS+YG+W  Y+NI  C+A GIAN+FH             QGL
Sbjct: 5   VRQFINVAGIVKDLKSFNFSLYGRWFGYINIFLCIALGIANLFHVSAVIAFGIVAIVQGL 64

Query: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126
           IILF+E+PFLLKICPLSDNFI F+ +F+TN  R LFY+VM  IQWCSI VQ+TSLIVVAV
Sbjct: 65  IILFVEIPFLLKICPLSDNFIEFIKRFETNGYRTLFYVVMAVIQWCSIAVQATSLIVVAV 124

Query: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
           GL+I+A  YA+     QEF+N+ IL D    +    +EAVVR+ML
Sbjct: 125 GLTISACSYAVALTKHQEFQNTHILKD--PTSDDFPHEAVVREML 167

>SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  184 bits (467), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 115/165 (69%), Gaps = 2/165 (1%)

Query: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGL 66
           +K   N++G+V DLKS NFS+YGQW  Y+NII CLA GIAN+FH             Q L
Sbjct: 5   IKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSIIQSL 64

Query: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126
           +ILFIEVPFLLKICPLSDNFI F+ +F+TN +R LFY  M  IQWCS+ + +TSLIVVA+
Sbjct: 65  VILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLIVVAI 124

Query: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
           GL+I+A  YA+  +  Q+F+N+ I+  +        +EAVVR+ML
Sbjct: 125 GLTISAASYAVAWSKHQQFQNTNII--KNPTDEDFPHEAVVREML 167

>KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  182 bits (462), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 87/165 (52%), Positives = 117/165 (70%), Gaps = 2/165 (1%)

Query: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGL 66
           +K  FN +GM+ DL+S NFS+YG+W  ++NII C+A GIAN+FH             QGL
Sbjct: 5   IKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSIVQGL 64

Query: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126
           IILFIE+PFLLKICPLSDNFI F+S+F+TN  RA+FYL M  IQ+CS+I+  TSL+VVA+
Sbjct: 65  IILFIEIPFLLKICPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLLVVAI 124

Query: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
            L+++A  YA+     QEF+N+ I+ +     A   +EAVVR+ML
Sbjct: 125 CLTVSAVFYAVAFVKHQEFQNTNIIKNPAD--ADFPHEAVVREML 167

>NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  179 bits (454), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 87/165 (52%), Positives = 116/165 (70%), Gaps = 2/165 (1%)

Query: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGL 66
           +K   N +GM  DLKS NFS+YG+W  Y+NII C+A G+AN+FH             QGL
Sbjct: 5   IKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISIIQGL 64

Query: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126
           +ILFIE+PFLLKICPLS+NFI F+ +F+TN  R LFYL M  IQ+CSII+ +TSLIVVA+
Sbjct: 65  VILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLIVVAI 124

Query: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
           GL+I++  YA+  A  QEF+N+ I+ +     A   +EAVVR+M+
Sbjct: 125 GLTISSMSYAVAFANHQEFQNTNIIKNPAD--ADFPHEAVVREMV 167

>KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  178 bits (451), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 114/165 (69%), Gaps = 2/165 (1%)

Query: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGL 66
           +K   NV+G+V DLKS NFS+YGQW  Y+NI  C+A GIAN+FH             QGL
Sbjct: 5   IKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAIVQGL 64

Query: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126
           +ILF+EVPFLL+ICPLSDNFI F+ +F+TN +R LFY+ M A+QWCS+ V +TSLI VA+
Sbjct: 65  VILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLIAVAI 124

Query: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
           GL+I+A  Y +     Q+F+ ++++  +        +EAVVR+ML
Sbjct: 125 GLTISAASYGVAFFKHQQFQGTSVI--KSPADDDFPHEAVVREML 167

>Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  177 bits (449), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 89/165 (53%), Positives = 112/165 (67%), Gaps = 2/165 (1%)

Query: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGL 66
           L    NV GMV DLKS NFS+YG+W  Y+NII C+A GIAN+FH             QGL
Sbjct: 5   LGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISIIQGL 64

Query: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126
           +ILFIE+PFLLKICPLSDNF+ F+ KF+TN  R +FYL M  IQ+ SI V +TSLIVVAV
Sbjct: 65  VILFIEIPFLLKICPLSDNFVEFIKKFETNGWRCIFYLAMAVIQYVSIAVMATSLIVVAV 124

Query: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
           GL+I++  YA+     QEF+N+ I+  +        +EAVVR+ML
Sbjct: 125 GLTISSISYAVAYTKHQEFQNTNII--KNPTDDDFPHEAVVREML 167

>Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  177 bits (448), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 89/165 (53%), Positives = 112/165 (67%), Gaps = 2/165 (1%)

Query: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGL 66
           L    NV GMV DLKS NFS+YG+W  Y+NII C+A GIAN+FH             QGL
Sbjct: 5   LGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISIIQGL 64

Query: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126
           +ILFIE+PFLLKICPLSDNF+ F+ +F+TN  R +FYL M  IQ+ SI V +TSLIVVAV
Sbjct: 65  VILFIEIPFLLKICPLSDNFVEFIKRFETNGWRCIFYLAMATIQYISIAVMATSLIVVAV 124

Query: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
           GL+I++  YA+     QEF+N+ IL  +        +EAVVR+ML
Sbjct: 125 GLTISSISYAVAYTKHQEFQNTNIL--KNPTDDDFPHEAVVREML 167

>YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}
           TVP18Integral membrane protein localized to late Golgi
           vesicles along with the v-SNARE Tlg2p; may interact with
           ribosomes, based on co-purification experiments
          Length = 167

 Score =  177 bits (448), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 90/165 (54%), Positives = 112/165 (67%), Gaps = 2/165 (1%)

Query: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGL 66
           L    NV GMV DLKS NFS+YG+W  Y+NII C+A GIAN+FH             QGL
Sbjct: 5   LGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISIIQGL 64

Query: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126
           +ILFIE+PFLLKICPLSDNFI F+ +F+TN  R LFYL M  IQ+ SI V +TSLIVVAV
Sbjct: 65  VILFIEIPFLLKICPLSDNFIEFIKRFETNGWRCLFYLAMAIIQYISIAVMATSLIVVAV 124

Query: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
           GL+I++  YA+     QEF+N+ I+  +        +EAVVR+ML
Sbjct: 125 GLTISSISYAVAYTKHQEFQNTNII--KNPTDDDFPHEAVVREML 167

>TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  174 bits (441), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 85/165 (51%), Positives = 111/165 (67%), Gaps = 2/165 (1%)

Query: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGL 66
           L+   N++G+V  LKS NFS+YGQW  Y+NI+ C+A GIAN+FH             Q  
Sbjct: 5   LQEFLNINGIVRGLKSFNFSLYGQWFGYINILLCVALGIANLFHVNPVIAFGIVSIIQSF 64

Query: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126
           IILF+EVPFLLKICPLSDNFI F+  F TN  R +FY+ M  +QWCSII+++TSLIVVA+
Sbjct: 65  IILFVEVPFLLKICPLSDNFIAFIKHFQTNGFRCIFYIAMATVQWCSIILKATSLIVVAI 124

Query: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
           GL+I+A  YA+     QEF+N +I+  +         EAVVR+ML
Sbjct: 125 GLTISAISYAVAYFKNQEFQNVSII--KNPTDDDFPREAVVREML 167

>NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  173 bits (438), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 84/160 (52%), Positives = 111/160 (69%), Gaps = 2/160 (1%)

Query: 12  NVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGLIILFI 71
           N++G+V DLKS NFS+YG+W  Y+NII C+  GI+N+FH             QGL+ILFI
Sbjct: 10  NIAGIVKDLKSFNFSVYGRWFGYINIILCIGLGISNLFHVNAVIAFGIVSIIQGLVILFI 69

Query: 72  EVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAVGLSIT 131
           E+PFLLKICPLS+ FI F+ +F+TN  R +FYLVM  IQ+CSI + +TSLIVVAVGL+I+
Sbjct: 70  EIPFLLKICPLSERFIEFIKRFETNGYRCVFYLVMAIIQYCSIALMATSLIVVAVGLTIS 129

Query: 132 ATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
           +  YA+     QEF+N+ IL  +         EAVVR+ML
Sbjct: 130 SISYAIAFTNHQEFQNTQIL--KNPTDPDFPREAVVREML 167

>TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON}
           Anc_2.534 YMR071C
          Length = 204

 Score =  169 bits (427), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 84/165 (50%), Positives = 112/165 (67%), Gaps = 1/165 (0%)

Query: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGL 66
           +K   N +GM+ DLKS NFS+YGQ+  Y+NII C+A GIAN+FH             Q L
Sbjct: 41  IKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAIVQSL 100

Query: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126
           +ILFIE+PFLLKICPLSDNF+ FV  F+TN  R LF+  M  +QWCS+I++ TSLIVVA+
Sbjct: 101 VILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLIVVAI 160

Query: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
           GLSI+A  YA+     QEF++++ +  +        +EAVVR+ML
Sbjct: 161 GLSISAAFYAIAFFKKQEFQHTSNVI-KNPTDDDFPHEAVVREML 204

>KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  165 bits (418), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 115/165 (69%), Gaps = 2/165 (1%)

Query: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGL 66
           +K   NV+G+V DLKS NFS+YG+W  Y+NII C+A GI+N+FH             QGL
Sbjct: 5   IKQFINVAGIVKDLKSFNFSVYGRWFGYINIILCIALGISNLFHVNAVIAFGIISIIQGL 64

Query: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126
           IILFIE+PFLLKICPLSDNF+ F+ +F+TN  R +FYLVM  IQ+CSII+ +TSLIVVA+
Sbjct: 65  IILFIEIPFLLKICPLSDNFVEFIKRFETNGYRCVFYLVMAIIQYCSIILMATSLIVVAI 124

Query: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
            L+++   Y + A   QEF+N+ I+  +        +EAVVR+ML
Sbjct: 125 CLTVSCASYGIAAFKKQEFQNTNII--KNPTDTDFPHEAVVREML 167

>Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to
           Ashbya gossypii AGL072W
          Length = 167

 Score =  165 bits (418), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 2/165 (1%)

Query: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGL 66
           LKS  NV G+V+DLKS NFS+YG+W  Y+NII C+A GIANIFH             QG 
Sbjct: 5   LKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILALGQGF 64

Query: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126
            +LF+EVPFL+KICPLS+ F+  V  F++N++R + Y VM  IQW S++ + TSL+V+A+
Sbjct: 65  FLLFVEVPFLVKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLVVLAI 124

Query: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
            L+++A  YA G    QEFK S +L  RG  + +  +EA VR+ML
Sbjct: 125 CLTVSAIFYASGWLTKQEFKESNVL--RGPGSDTFPHEASVREML 167

>Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  164 bits (416), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 112/165 (67%), Gaps = 2/165 (1%)

Query: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGL 66
           L    NV GMV DLKS NFS+YG+W  Y+NII C+A GIAN+FH             QGL
Sbjct: 5   LGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISIIQGL 64

Query: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126
           IILFIE+PFLLKICPLSDNFI F+ KF+TN  R +FYL M  IQ+ SI V +TSLIVVAV
Sbjct: 65  IILFIEIPFLLKICPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLIVVAV 124

Query: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
           GL+I++  YA+     QEF+N+ I+  +        +EAVVR+ML
Sbjct: 125 GLTISSISYAVAYTKHQEFQNTNII--KNPTDDDFPHEAVVREML 167

>AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR071C (TVP18)
          Length = 167

 Score =  163 bits (412), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 105/164 (64%), Gaps = 2/164 (1%)

Query: 8   KSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGLI 67
           KS  NV G++ADL+S NFS+YG+W  Y+NI+ CLA GIANIFH             QGL+
Sbjct: 6   KSFVNVPGILADLRSFNFSVYGRWFGYINILLCLALGIANIFHFSIVIAFAIVAIVQGLL 65

Query: 68  ILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAVG 127
           ++F+EVP LLKICPLSDNFIG V K DTN RR L Y  +  +Q+ S+ VQ TSL+ VA+G
Sbjct: 66  LIFVEVPILLKICPLSDNFIGLVKKCDTNGRRTLLYTALAIVQYASLSVQVTSLLAVAIG 125

Query: 128 LSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
           L+I+A  Y  G    QEF    ++  R     +   EA VR++L
Sbjct: 126 LTISAIFYGTGYLKKQEFLEGNVI--RNPTDPAFMREAAVREVL 167

>CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {ON}
           highly similar to uniprot|Q04767 Saccharomyces
           cerevisiae YMR071c
          Length = 167

 Score =  162 bits (410), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 76/160 (47%), Positives = 107/160 (66%), Gaps = 2/160 (1%)

Query: 12  NVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGLIILFI 71
           N++G++ DLKS NFS+YG+W  Y+NI  C+A GIAN+FH             QGLIILFI
Sbjct: 10  NIAGLLKDLKSFNFSVYGKWFGYINIFLCIALGIANLFHVSAVIAFGIVGIVQGLIILFI 69

Query: 72  EVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAVGLSIT 131
           E+PFLLKICPLSD FI F+ +F+TN  R +FY +M  +Q+CS+ V +TSL+V+ + L+I+
Sbjct: 70  EIPFLLKICPLSDRFIEFIKRFETNGYRCIFYTLMAIVQYCSLAVMTTSLLVLGITLTIS 129

Query: 132 ATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171
           A  Y +     QEF N+ I+  +        ++AVVR+ML
Sbjct: 130 AVSYGIAFTKHQEFANTNII--KNPTDEDFPHDAVVREML 167

>ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {ON}
           similar to uniprot|Q04767 Saccharomyces cerevisiae
           YMR071C TVP18 Tlg2-Vesicle Protein of 18 kDa Integral
           membrane vesicle protein
          Length = 166

 Score =  159 bits (401), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 108/157 (68%), Gaps = 3/157 (1%)

Query: 16  MVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHXXXXXXXXXXXXXQGLIILFIEVPF 75
           +V  LKS NFS+YG++++YLNIIFC+AFGIAN+FH             QG IILF+EVPF
Sbjct: 12  LVQGLKSYNFSLYGKYVAYLNIIFCIAFGIANLFHVNAVIAFGVISIVQGAIILFLEVPF 71

Query: 76  LLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAVGLSITATVY 135
           LL+ICPLSDNFI FVS+F+TN  R +FY+    +QW S+ ++ TSLIVVAVGL+I+A  Y
Sbjct: 72  LLRICPLSDNFIEFVSRFETNGWRTIFYIFNAVLQWASLALKITSLIVVAVGLTISAAFY 131

Query: 136 ALGAAAGQEFKNSAILSDRGRVAASVT-NEAVVRDML 171
            +     Q F+NS+ + +   V   V  NE  VR+ML
Sbjct: 132 GVAYFKHQNFQNSSHIKE--PVGEGVEANEQNVREML 166

>Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON}
           complement(17797..18189) [393 nt, 131 aa]
          Length = 130

 Score =  121 bits (303), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 61/131 (46%), Positives = 84/131 (64%), Gaps = 1/131 (0%)

Query: 41  LAFGIANIFHXXXXXXXXXXXXXQGLIILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRA 100
           +A GIAN+FH             Q LIILF+EVPFLLKICPLS+NFI F+  F+TN  R 
Sbjct: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60

Query: 101 LFYLVMCAIQWCSIIVQSTSLIVVAVGLSITATVYALGAAAGQEFKNSAILSDRGRVAAS 160
           +FY +M  +QWCS+ +  TSLIVVA+ L+I+A  YA+     QEF+++  +  +      
Sbjct: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVI-KNPTDDD 119

Query: 161 VTNEAVVRDML 171
             ++AVVR+ML
Sbjct: 120 FPHDAVVREML 130

>Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}
           YMR071C - Hypothetical ORF [contig 55] FULL
          Length = 64

 Score = 56.6 bits (135), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 106 MCAIQWCSIIVQSTSLIVVAVGLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEA 165
           M A+QWCSI +  TSLIVVAVGL+I+A  Y++     Q+F+ ++++ +         +EA
Sbjct: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPAD--EDFPHEA 58

Query: 166 VVRDML 171
           VVR+ML
Sbjct: 59  VVREML 64

>KLLA0E17161g Chr5 (1526177..1527430) [1254 bp, 417 aa] {ON} similar
           to uniprot|P38211 Saccharomyces cerevisiae YBR004C GPI18
           Functional ortholog of human PIG-V which is a
           mannosyltransferase that transfers the second mannose in
           glycosylphosphatidylinositol biosynthesis the authentic
           non-tagged protein was localized to mitochondria
          Length = 417

 Score = 28.5 bits (62), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 7/44 (15%)

Query: 11  FNVSGMVADLKSSNFSIYG-------QWISYLNIIFCLAFGIAN 47
           F++ GM+    S +F +YG       +WISYL   FC AF   N
Sbjct: 171 FSLLGMLFRQWSISFDVYGNLHMDKLKWISYLLSSFCFAFAFLN 214

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.141    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,557,496
Number of extensions: 435887
Number of successful extensions: 1187
Number of sequences better than 10.0: 21
Number of HSP's gapped: 1199
Number of HSP's successfully gapped: 21
Length of query: 171
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 69
Effective length of database: 41,785,467
Effective search space: 2883197223
Effective search space used: 2883197223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 61 (28.1 bits)