Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E17733g3.189ON21121111081e-156
SAKL0C10494g3.189ON2302344761e-59
KLTH0G16060g3.189ON2132084646e-58
Kwal_56.231143.189ON2102124193e-51
KAFR0A012303.189ON2202224142e-50
TBLA0F007503.189ON2341743675e-43
ZYRO0A04928g3.189ON2512423642e-42
Skud_2.1263.189ON2041123569e-42
KNAG0J012603.189ON1941113559e-42
NCAS0E016003.189ON2292183501e-40
Smik_2.1333.189ON2041353472e-40
Suva_2.1413.189ON2041113431e-39
Suva_4.2383.189ON2332303414e-39
Skud_4.2423.189ON2322293381e-38
YDL010W (GRX6)3.189ON2311623345e-38
YBR014C (GRX7)3.189ON2032113316e-38
AER017C3.189ON2161043203e-36
Smik_4.2233.189ON2322283214e-36
NDAI0G018003.189ON2222203161e-35
TDEL0D043203.189ON2432393172e-35
CAGL0I04554g3.189ON2262253041e-33
Ecym_53133.189ON2482212946e-32
Kpol_1045.693.189ON2622522712e-28
TPHA0H006303.189ON1911162522e-26
SAKL0H06468g8.679ON2581422083e-19
KAFR0A038708.679ON2671711971e-17
Kpol_1072.148.679ON2501221751e-14
NCAS0C013408.679ON3571271692e-13
KLLA0D05973g8.679ON2811301663e-13
NDAI0K013508.679ON2711171654e-13
TBLA0B038208.679ON2511881611e-12
TPHA0G015908.679ON2971251612e-12
KLLA0C01298g1.38ON107931503e-12
CAGL0M02167g8.679ON2331821547e-12
NCAS0B016408.679ON2402121522e-11
KNAG0C004501.38ON157971454e-11
KLTH0D11308g8.679ON2711151504e-11
Suva_2.6931.38ON143981445e-11
NDAI0E011508.679ON2361691478e-11
CAGL0K05813g1.38ON142901428e-11
TPHA0B03560singletonON106941391e-10
NCAS0B088701.38ON109901391e-10
YDR513W (GRX2)1.38ON143981412e-10
Kpol_2002.361.38ON109951382e-10
Skud_4.7881.38ON145981402e-10
Smik_4.7941.38ON143951393e-10
Ecym_23948.679ON2811261409e-10
TBLA0A050801.38ON1181011331e-09
Kpol_2000.991.38ON141951305e-09
Kwal_26.88148.679ON2751141346e-09
YPL156C (PRM4)8.679ON2841261339e-09
Skud_16.1268.679ON2871241321e-08
Smik_6.3538.679ON2861261321e-08
NDAI0A003801.38ON109901242e-08
Kwal_33.131661.38ON138961262e-08
NDAI0F044301.38ON136981252e-08
Skud_3.271.38ON110811232e-08
Smik_3.421.38ON110811232e-08
AFR710W1.38ON111981233e-08
Ecym_10441.38ON158931253e-08
Suva_16.1548.679ON2831241275e-08
NCAS0A003601.38ON138951201e-07
YCL035C (GRX1)1.38ON110811181e-07
ZYRO0F17732g1.38ON139951192e-07
KNAG0G025808.679ON2781681222e-07
TDEL0C066401.38ON143951173e-07
Suva_3.1781.38ON316901214e-07
SAKL0C01320g1.38ON165961166e-07
KAFR0D003601.38ON109901121e-06
TPHA0E037301.38ON106921092e-06
TDEL0E05740singletonON108901092e-06
KLTH0F01276g1.38ON138911094e-06
TPHA0B048201.38ON138881042e-05
ACR146W8.679ON21362992e-04
KNAG0F002501.38ON14282780.060
SAKL0H04136g4.211ON11096750.096
Kpol_513.118.519ON14794700.86
Ecym_42248.348ON46670701.6
KNAG0J017308.679ON19656681.7
NDAI0J024104.275ON94945674.3
Kwal_23.30812.219ON54486664.7
ZYRO0F13970g8.348ON47259655.8
KLLA0B04994g4.328ON39875655.9
NDAI0H009205.614ON61329656.4
NDAI0E028908.519ON155102636.8
NCAS0B022908.519ON13997619.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E17733g
         (211 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa] ...   431   e-156
SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar...   187   1e-59
KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} simil...   183   6e-58
Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {O...   166   3e-51
KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.18...   164   2e-50
TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.18...   145   5e-43
ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {O...   144   2e-42
Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}...   141   9e-42
KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {O...   141   9e-42
NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON...   139   1e-40
Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}...   138   2e-40
Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}...   136   1e-39
Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W (...   135   4e-39
Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W (...   134   1e-38
YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-gol...   133   5e-38
YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}  G...   132   6e-38
AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON} Sy...   127   3e-36
Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W (...   128   4e-36
NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON...   126   1e-35
TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON...   126   2e-35
CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some si...   121   1e-33
Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON} ...   117   6e-32
Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {...   108   2e-28
TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.18...   101   2e-26
SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {O...    85   3e-19
KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.67...    80   1e-17
Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON...    72   1e-14
NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {O...    70   2e-13
KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some si...    69   3e-13
NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {O...    68   4e-13
TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON...    67   1e-12
TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON...    67   2e-12
KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {O...    62   3e-12
CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {...    64   7e-12
NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679      63   2e-11
KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON} ...    60   4e-11
KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some si...    62   4e-11
Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W...    60   5e-11
NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON...    61   8e-11
CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly...    59   8e-11
TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON}      58   1e-10
NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1....    58   1e-10
YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}  GRX2Cytop...    59   2e-10
Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON...    58   2e-10
Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W...    59   2e-10
Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W...    58   3e-10
Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON} ...    59   9e-10
TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {...    56   1e-09
Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON} (21954...    55   5e-09
Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C ...    56   6e-09
YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}  ...    56   9e-09
Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {O...    55   1e-08
Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C (...    55   1e-08
NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON} ...    52   2e-08
Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {O...    53   2e-08
NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {...    53   2e-08
Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON} YC...    52   2e-08
Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON} YC...    52   2e-08
AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic h...    52   3e-08
Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON} si...    53   3e-08
Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {O...    54   5e-08
NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON} ...    51   1e-07
YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}  GRX...    50   1e-07
ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} simil...    50   2e-07
KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.67...    52   2e-07
TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1....    50   3e-07
Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}...    51   4e-07
SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {O...    49   6e-07
KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON} ...    48   1e-06
TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38...    47   2e-06
TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {...    47   2e-06
KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {O...    47   4e-06
TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1....    45   2e-05
ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic hom...    43   2e-04
KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON} ...    35   0.060
SAKL0H04136g Chr8 complement(386608..386940) [333 bp, 110 aa] {O...    33   0.096
Kpol_513.11 s513 complement(30908..31351) [444 bp, 147 aa] {ON} ...    32   0.86 
Ecym_4224 Chr4 complement(468353..469753) [1401 bp, 466 aa] {ON}...    32   1.6  
KNAG0J01730 Chr10 (316411..317001) [591 bp, 196 aa] {ON} Anc_8.6...    31   1.7  
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    30   4.3  
Kwal_23.3081 s23 (148637..150271) [1635 bp, 544 aa] {ON} YIL136W...    30   4.7  
ZYRO0F13970g Chr6 (1149055..1150473) [1419 bp, 472 aa] {ON} simi...    30   5.8  
KLLA0B04994g Chr2 complement(453048..454244) [1197 bp, 398 aa] {...    30   5.9  
NDAI0H00920 Chr8 (205900..207741) [1842 bp, 613 aa] {ON} Anc_5.614     30   6.4  
NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519      29   6.8  
NCAS0B02290 Chr2 (383984..384403) [420 bp, 139 aa] {ON} Anc_8.519      28   9.4  

>KLLA0E17733g Chr5 complement(1571724..1572359) [636 bp, 211 aa]
           {ON} similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 211

 Score =  431 bits (1108), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 211/211 (100%), Positives = 211/211 (100%)

Query: 1   MLSKRSLRLVSLTGMVIFVLFFIRHNAESVTRSYVGKESSNLANDAKVESDINNIQEGIA 60
           MLSKRSLRLVSLTGMVIFVLFFIRHNAESVTRSYVGKESSNLANDAKVESDINNIQEGIA
Sbjct: 1   MLSKRSLRLVSLTGMVIFVLFFIRHNAESVTRSYVGKESSNLANDAKVESDINNIQEGIA 60

Query: 61  ETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYNAEAEYKNILSQSPIVVFSKSYCP 120
           ETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYNAEAEYKNILSQSPIVVFSKSYCP
Sbjct: 61  ETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYNAEAEYKNILSQSPIVVFSKSYCP 120

Query: 121 FSTRLKNLLKEYEFDPIYTIVELDKHENGAELQKYIGSKTGRSTVPNVIINGISRGGSDE 180
           FSTRLKNLLKEYEFDPIYTIVELDKHENGAELQKYIGSKTGRSTVPNVIINGISRGGSDE
Sbjct: 121 FSTRLKNLLKEYEFDPIYTIVELDKHENGAELQKYIGSKTGRSTVPNVIINGISRGGSDE 180

Query: 181 FAGLHEDNSLLQSLKTWAGSTLSVKKAAAAT 211
           FAGLHEDNSLLQSLKTWAGSTLSVKKAAAAT
Sbjct: 181 FAGLHEDNSLLQSLKTWAGSTLSVKKAAAAT 211

>SAKL0C10494g Chr3 (955694..956386) [693 bp, 230 aa] {ON} similar to
           Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 230

 Score =  187 bits (476), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 107/234 (45%), Positives = 142/234 (60%), Gaps = 39/234 (16%)

Query: 1   MLSKRSLRLVSLTGMVIFVLFFIRHNAESVTRSYVGKESSNLAN---------------- 44
           ML+KR+LR++++TG ++F++FFI  NA +V    V  ++S  AN                
Sbjct: 1   MLTKRNLRVLTITGFLVFLIFFIVQNANTVA---VANKNSGRANGVPPSSKLIHSDGDEQ 57

Query: 45  -----------DAKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEV 93
                      D+ V ++I  IQ+ IA  +            K  A     KDS   + V
Sbjct: 58  EVAVQKQQEKEDSAVNAEIAQIQQEIAGNQGGGGSNSGRTGNKVSAA----KDS---SSV 110

Query: 94  ETYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAEL 152
           E +NA  EY +IL +SP+VVFSKSYCPFST+LK+LL +EY+F P Y ++ELDKHE+GAEL
Sbjct: 111 E-FNAAKEYASILEESPMVVFSKSYCPFSTKLKDLLAQEYQFTPSYVVLELDKHEHGAEL 169

Query: 153 QKYIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKK 206
           QKYIG  TGRSTVPNV+IN +SRGGSD+   LH+D  LL SLK W G  L+V K
Sbjct: 170 QKYIGDVTGRSTVPNVVINRVSRGGSDDLRALHKDGKLLDSLKEWGGKQLTVSK 223

>KLTH0G16060g Chr7 (1406291..1406932) [642 bp, 213 aa] {ON} similar
           to Saccharomyces cerevisiae YDL010W Hypothetical ORF or
           YBR014C uniprot|P38068 Saccharomyces cerevisiae YBR014C
           Hypothetical ORF
          Length = 213

 Score =  183 bits (464), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 99/208 (47%), Positives = 133/208 (63%), Gaps = 4/208 (1%)

Query: 1   MLSKRSLRLVSLTGMVIFVLFFIRHNAESVTRSYVGKESSNLANDAKVESDINNIQEGIA 60
           MLSKR+LR+   TG+++ +++FI  NA +   S     S   A+ A + S  N+   G  
Sbjct: 1   MLSKRNLRVFVFTGVLLVLIYFIIQNAHTTVTSGNSSLSGQTASGAVIHSKGNHKSSGEV 60

Query: 61  ETKSNAVVADTSNAVKNMAGPNGVKD-SDFAAEVETYNAEAEYKNILSQSPIVVFSKSYC 119
           +   +  + +  N V  + G +G    +DF  E E ++   EY+ IL+  P++VFSKS C
Sbjct: 61  DPSVDKEIQEIKNEV-GIKGDDGASSGTDFTQEKE-FDPAKEYQYILANRPMIVFSKSRC 118

Query: 120 PFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQKYIGSKTGRSTVPNVIINGISRGGS 178
           PFS +LK+LL KE+EF P Y +VELDKHE+GAELQK+IGS TGRSTVPNVIING+SRGG 
Sbjct: 119 PFSKKLKDLLAKEFEFSPSYMVVELDKHEHGAELQKHIGSLTGRSTVPNVIINGVSRGGC 178

Query: 179 DEFAGLHEDNSLLQSLKTWAGSTLSVKK 206
           D+F  L E   LL SLKTW    L+V K
Sbjct: 179 DDFEKLQEKGELLSSLKTWCDKALTVSK 206

>Kwal_56.23114 s56 complement(406920..407552) [633 bp, 210 aa] {ON}
           YBR014C - Hypothetical ORF [contig 183] FULL
          Length = 210

 Score =  166 bits (419), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 95/212 (44%), Positives = 136/212 (64%), Gaps = 15/212 (7%)

Query: 1   MLSKRSLRLVSLTGMVIFVLFFIRHNAESVTRSYVGKESSNLANDAKVESDINNIQEGIA 60
           M SKR+LR+ S T ++IF+++FI  NA+  T S VGK     A + K E+ I +    +A
Sbjct: 1   MPSKRNLRVFSFTAVLIFLIYFIVQNAQ--TSSDVGK-----AINRKPETLIGD--GVVA 51

Query: 61  ETK-SNAVVADTSNAVKNMAGPNGVKDSDFAAEVET---YNAEAEYKNILSQSPIVVFSK 116
           + K +  +  D   A++N+    G+K+        T   ++   EY+ ILS SP++VFSK
Sbjct: 52  KAKETTKIDEDVDQAIRNIQEEVGIKEGSSGKSEPTRKAFDPAMEYQQILSNSPMIVFSK 111

Query: 117 SYCPFSTRLKNLLK-EYEFDPIYTIVELDKHENGAELQKYIGSKTGRSTVPNVIINGISR 175
           S CP+S ++K LLK EYEF P Y +VELD+H++G ELQ YIG  T R+TVPNV+I+G+SR
Sbjct: 112 SMCPYSAKMKELLKQEYEFTPDYLVVELDRHDHGKELQDYIGKVTNRATVPNVVIHGVSR 171

Query: 176 GGSDEFAGLHEDNSLLQSLKTWA-GSTLSVKK 206
           GG D+F  L +   LL+SL+ W+ G TLSV K
Sbjct: 172 GGYDDFKALLDKGKLLESLQDWSDGKTLSVSK 203

>KAFR0A01230 Chr1 (240673..241335) [663 bp, 220 aa] {ON} Anc_3.189
           YDL010W
          Length = 220

 Score =  164 bits (414), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 90/222 (40%), Positives = 130/222 (58%), Gaps = 28/222 (12%)

Query: 1   MLSKRSLRLVSLTGMVIFVLFFIRHNAESVTRSYVGKESSNLA---------------ND 45
           +L+KR++R+VS+T +++ ++FF+  +A S+T S     S  +A               ++
Sbjct: 4   ILNKRNIRIVSVTSILLLLVFFVIRDANSITLSQSISNSETVAKTDLDGASASNKKKTDN 63

Query: 46  AKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYNAEAEYKNI 105
           ++   +I+ I++ I  T  + V A  +N            + +      T+NA  EY +I
Sbjct: 64  SEATEEIDRIKQEIGITDDSPVPATNAN------------EQNEENTAVTFNAAKEYASI 111

Query: 106 LSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQKYIGSKTGRST 164
           L  SP+VVFSKS+CPFS +LK L   EY+F P + IVELDKH++G  LQ YI  KTGR T
Sbjct: 112 LELSPMVVFSKSFCPFSAKLKELFANEYQFTPNFYIVELDKHQHGDLLQAYIKEKTGRGT 171

Query: 165 VPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKK 206
           VPNV+ING+SRGGSD+   LH D  LL SLKTW      VK+
Sbjct: 172 VPNVVINGVSRGGSDDLRALHADGKLLDSLKTWGSGNFQVKQ 213

>TBLA0F00750 Chr6 (190701..191405) [705 bp, 234 aa] {ON} Anc_3.189
           YDL010W
          Length = 234

 Score =  145 bits (367), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 111/174 (63%), Gaps = 5/174 (2%)

Query: 35  VGKESSNLANDAKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVE 94
           +  +SS   NDA V++  + I++ +             +++   A  N + ++D   E  
Sbjct: 59  ISDKSSEKGNDAGVDAQFDKIKQEVGLDTGKTTQGGLPSSI-GTATDNKISNND---ENG 114

Query: 95  TYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQ 153
           T++A  EY  IL  SP+++FSKSYCPFS+ LK LL KE+ F P Y ++ELD+H +GAELQ
Sbjct: 115 TFDAAKEYAMILDLSPVIIFSKSYCPFSSNLKQLLSKEFSFTPNYYVIELDRHSHGAELQ 174

Query: 154 KYIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKKA 207
            YI  KT RSTVPN+I+NGISRGG DE   L+++  LL++L  W+ +T +VK+A
Sbjct: 175 AYIAKKTDRSTVPNMIVNGISRGGRDEIVALNDEGKLLEALNDWSDNTFTVKQA 228

>ZYRO0A04928g Chr1 complement(396257..397012) [756 bp, 251 aa] {ON}
           weakly similar to Saccharomyces cerevisiae YDL010W
           Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
           cerevisiae YBR014C Hypothetical ORF
          Length = 251

 Score =  144 bits (364), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 136/242 (56%), Gaps = 43/242 (17%)

Query: 2   LSKRSLRLVSLTGMVIFVLFFIRHNAESVTRSYVGKESSNLAN----------------- 44
           L+KR+LR++S+T +++ ++FF+  NA SV+   +G ESS+LAN                 
Sbjct: 5   LNKRNLRVLSITSLLLLLVFFVVQNANSVS---IG-ESSSLANANSNEDQTLTSAGTSIN 60

Query: 45  ---------------------DAKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGPNG 83
                                D+ V+++I  I++ +   K++ +   +S ++        
Sbjct: 61  KESKEEVVTEKQKAKEKQPEGDSVVDAEIGKIKQEVGIGKTDDLETGSSGSISGGGVVGK 120

Query: 84  VKDSDFAAEVETYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVE 142
              +   A+   ++   EY  IL  SPI+VFSKS CP+S +LK LL KEY F P Y ++E
Sbjct: 121 GGSASEHAQQTEFDPVKEYAMILDFSPIIVFSKSTCPYSKKLKELLDKEYSFTPSYFVIE 180

Query: 143 LDKHENGAELQKYIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTL 202
           LD+H NGAELQKY+  KTGRSTVPNVIING SRGG+DEF  LH +  LL S K W+  T 
Sbjct: 181 LDRHHNGAELQKYVEQKTGRSTVPNVIINGKSRGGNDEFRSLHNEGKLLSSFKDWSQGTF 240

Query: 203 SV 204
           +V
Sbjct: 241 TV 242

>Skud_2.126 Chr2 complement(240244..240858) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  141 bits (356), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 66/112 (58%), Positives = 83/112 (74%), Gaps = 1/112 (0%)

Query: 95  TYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLKE-YEFDPIYTIVELDKHENGAELQ 153
           T++A AEY  IL  SP VVFSK+ CP+S +LK+LL E Y   P Y +VELD+HE+G EL+
Sbjct: 85  TFDAAAEYGKILEYSPFVVFSKTGCPYSKKLKSLLAESYAITPSYYVVELDEHEHGKELK 144

Query: 154 KYIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVK 205
            YIG KTGRSTVPNV+INGISRGG  E A LHE+++L+ S K W+    +VK
Sbjct: 145 DYIGDKTGRSTVPNVVINGISRGGYTEMAALHENDTLVDSFKEWSSDKFTVK 196

>KNAG0J01260 Chr10 complement(225941..226525) [585 bp, 194 aa] {ON}
           Anc_3.189 YDL010W
          Length = 194

 Score =  141 bits (355), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 82/111 (73%), Gaps = 1/111 (0%)

Query: 95  TYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLKE-YEFDPIYTIVELDKHENGAELQ 153
            ++   EY +ILS+SP+V+FSKSYCP+S +LK LL   ++F P YT+VELD+HE+G ELQ
Sbjct: 81  VFSPAVEYDSILSRSPVVIFSKSYCPYSAKLKKLLAAGFKFTPAYTVVELDEHEHGPELQ 140

Query: 154 KYIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSV 204
           KYI  KTGRSTVPN+I+NG+S GG D+   L E+  LL  L  W GS ++V
Sbjct: 141 KYIAEKTGRSTVPNLIVNGVSHGGCDDIVALSENGKLLDRLNEWGGSAVNV 191

>NCAS0E01600 Chr5 complement(304962..305651) [690 bp, 229 aa] {ON}
           Anc_3.189
          Length = 229

 Score =  139 bits (350), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 129/218 (59%), Gaps = 12/218 (5%)

Query: 1   MLSKRSLRLVSLTGMVIFVLFFIRHNA--ESVTRSYVGKESSNLA---------NDAKVE 49
           +L+KR++R+V +T  ++ ++FFI  +A   + T     K+S+  A         +D  + 
Sbjct: 4   VLNKRNIRVVGITAALLCLVFFIIQSANNSAFTTESPSKQSNKPALNSLVGAHGDDLNIP 63

Query: 50  SDINNIQEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYNAEAEYKNILSQS 109
           +  N +Q+ +    +    ++++N ++     +  ++ D +     ++   EY  IL++ 
Sbjct: 64  ATHNVLQDNVESAPTVETESESNNNMELDESADSAQEKDASTTAPDFDVAKEYAAILAKG 123

Query: 110 PIVVFSKSYCPFSTRLKNLLK-EYEFDPIYTIVELDKHENGAELQKYIGSKTGRSTVPNV 168
           P+V+FSKS CP+S++LK LL+  ++F P   IVELDKHE+G  LQ YI  +TGR TVPN+
Sbjct: 124 PMVIFSKSTCPYSSKLKKLLRTNFQFSPEPVIVELDKHEHGDVLQGYIKEETGRGTVPNL 183

Query: 169 IINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKK 206
           I+ G+SRGGSD+   L ++ +LL+ LKTW    L V +
Sbjct: 184 IVGGLSRGGSDDIQKLFDEGTLLKELKTWGFGDLEVTQ 221

>Smik_2.133 Chr2 complement(246955..247569) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  138 bits (347), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 67/135 (49%), Positives = 92/135 (68%), Gaps = 4/135 (2%)

Query: 72  SNAVKNMAGPNGVKDSDFAAEVETYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLKE 131
           S+A K +  P+   ++   A+   ++A AEY  IL +SP++VFSKS+CPFS +LK LL E
Sbjct: 65  SDANKQVKEPDETNENSEEAQ---FDAAAEYDKILKKSPMIVFSKSFCPFSKKLKTLLAE 121

Query: 132 -YEFDPIYTIVELDKHENGAELQKYIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSL 190
            Y F P Y +VELDK E+ +ELQ++I   TGR TVPNV+I+GISRGG DE   LHE++ L
Sbjct: 122 SYTFSPSYYVVELDKREHTSELQEHIEKSTGRRTVPNVVIDGISRGGCDEITALHENDKL 181

Query: 191 LQSLKTWAGSTLSVK 205
           L S K W+    +V+
Sbjct: 182 LNSFKEWSSGKFTVE 196

>Suva_2.141 Chr2 complement(245683..246297) [615 bp, 204 aa] {ON}
           YBR014C (REAL)
          Length = 204

 Score =  136 bits (343), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 63/111 (56%), Positives = 82/111 (73%), Gaps = 1/111 (0%)

Query: 96  YNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLKE-YEFDPIYTIVELDKHENGAELQK 154
           ++A  EY+ IL QS +VVFSKSYCPFS +LKNLL E Y+F P Y +VELD+H +  ELQ 
Sbjct: 86  FDAATEYETILKQSHMVVFSKSYCPFSKKLKNLLAESYKFSPSYHVVELDQHGHTDELQD 145

Query: 155 YIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVK 205
           YI   TGR TVPNVIING+S+GG D+   LH+++ LL+SLK W+    +V+
Sbjct: 146 YIEKVTGRRTVPNVIINGVSKGGCDDMVTLHKEDKLLESLKEWSNGAFTVE 196

>Suva_4.238 Chr4 (425601..426302) [702 bp, 233 aa] {ON} YDL010W
           (REAL)
          Length = 233

 Score =  135 bits (341), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 81/230 (35%), Positives = 130/230 (56%), Gaps = 36/230 (15%)

Query: 4   KRSLRLVSLTGMVIFVLFFIRHNAESVT-----------------RSYVGKESSNLAN-- 44
           KR+ R++S+T +++ ++FFI  NA  +                   S  G+ S  +A+  
Sbjct: 6   KRNARILSITMLLLLLVFFIAQNANFLAIETKEEEKPPQLLDIDKNSISGRSSRRIASVP 65

Query: 45  -------DAKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYN 97
                  +++V+ +IN I++ +   +  A   D+ +A+K+  G    K          +N
Sbjct: 66  TSTTNKGNSEVDEEINEIKQKVGLQQPIASADDSLSAIKSDKGTGTGKG---------FN 116

Query: 98  AEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLK-EYEFDPIYTIVELDKHENGAELQKYI 156
            + EY  +L  +P+++FSKS C +S  LK LL+ EY+F P Y I+ELDKH +G EL++YI
Sbjct: 117 VQQEYSLMLDLAPVIIFSKSTCSYSKGLKELLESEYQFVPNYYIIELDKHAHGEELREYI 176

Query: 157 GSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKK 206
            S TGR TVPN++ING+SRGGS+E   LH    LL SL+ W+G   +V++
Sbjct: 177 KSTTGRGTVPNLLINGVSRGGSEEIKRLHSQGKLLSSLQEWSGGKFTVEQ 226

>Skud_4.242 Chr4 (427070..427768) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  134 bits (338), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 82/229 (35%), Positives = 128/229 (55%), Gaps = 35/229 (15%)

Query: 4   KRSLRLVSLTGMVIFVLFFIRHNAESVT----------------RSYVGKESSNLAND-- 45
           KR+ R++S+T +++ ++FFI  NA  +T                 S     S  LA +  
Sbjct: 6   KRNARILSITMLLLLLVFFIVQNANFLTIETKEEKPFQVFSTNMDSLSVGSSKKLATEPT 65

Query: 46  -------AKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYNA 98
                  ++V+ +IN I++ +   +  A   D+ +A+K+  G         +   + +N 
Sbjct: 66  SAIKKGSSEVDEEINEIKQKVGLQQPIASADDSLSALKSDKG---------SGTGKGFNV 116

Query: 99  EAEYKNILSQSPIVVFSKSYCPFSTRLKNLLK-EYEFDPIYTIVELDKHENGAELQKYIG 157
           + EY  +L  SP+++FSKS CP+S  +K LL+ EY+F P Y I+ELDKH +G ELQ+YI 
Sbjct: 117 QKEYSLMLDLSPVIIFSKSVCPYSRNMKELLENEYQFLPNYYIIELDKHGHGEELQEYIR 176

Query: 158 SKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKK 206
             TGR  VPN++INGISRGG++E  GLH    LL SL+ W+    SV++
Sbjct: 177 LMTGRGAVPNLLINGISRGGNEEIRGLHSQGKLLGSLQAWSNGKFSVEQ 225

>YDL010W Chr4 (432330..433025) [696 bp, 231 aa] {ON}  GRX6Cis-golgi
           localized monothiol glutaredoxin that binds an
           iron-sulfur cluster; more similar in activity to dithiol
           than other monothiol glutaredoxins; involved in the
           oxidative stress response; functional overlap with GRX7
          Length = 231

 Score =  133 bits (334), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 69/162 (42%), Positives = 102/162 (62%), Gaps = 10/162 (6%)

Query: 46  AKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYNAEAEYKNI 105
           ++V+ +IN I++ +   +  A V D+ +A+KN  G    K          +N + EY  I
Sbjct: 72  SEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITK---------AFNVQKEYSLI 122

Query: 106 LSQSPIVVFSKSYCPFSTRLKNLLK-EYEFDPIYTIVELDKHENGAELQKYIGSKTGRST 164
           L  SPI++FSKS C +S  +K LL+ EY+F P Y I+ELDKH +G ELQ+YI   TGR T
Sbjct: 123 LDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGRGT 182

Query: 165 VPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKK 206
           VPN+++NG+SRGG++E   LH    LL+SL+ W+    SV++
Sbjct: 183 VPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQ 224

>YBR014C Chr2 complement(266725..267336) [612 bp, 203 aa] {ON}
           GRX7Cis-golgi localized monothiol glutaredoxin; more
           similar in activity to dithiol than other monothiol
           glutaredoxins; involved in the oxidative stress
           response; does not bind metal ions; functional overlap
           with GRX6
          Length = 203

 Score =  132 bits (331), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 119/211 (56%), Gaps = 25/211 (11%)

Query: 1   MLSKRSLRLVSLTGMVIFVLFFIRHNA-----ESVTRSYVGKESSNLANDAKVESDINNI 55
           +++KR++R++ +T +++ V+FF+  N+     ES+T  +          D+ V  D +  
Sbjct: 4   VINKRNVRVLVITNLLLIVVFFVLRNSNASVNESITTHHP---------DSLVTFDNSGN 54

Query: 56  QEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYNAEAEYKNILSQSPIVVFS 115
             G  ++     V DT N     A     ++ D  +    ++A AEY  I+ QSP++VFS
Sbjct: 55  APGTHQS-----VHDTVNTQDKEA-----EEVDKNSGDAEFDAAAEYNKIMEQSPMIVFS 104

Query: 116 KSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQKYIGSKTGRSTVPNVIINGIS 174
           K+ CP+S +LK LL   Y F P Y +VELD+HE+  ELQ  I   TGR TVPNVII G S
Sbjct: 105 KTGCPYSKKLKALLTNSYTFSPSYYVVELDRHEHTKELQDQIEKVTGRRTVPNVIIGGTS 164

Query: 175 RGGSDEFAGLHEDNSLLQSLKTWAGSTLSVK 205
           RGG  E A LH+++ LL S K W+    +VK
Sbjct: 165 RGGYTEIAELHKNDELLDSFKKWSDGAFTVK 195

>AER017C Chr5 complement(660137..660787) [651 bp, 216 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL010W and
           YBR014C
          Length = 216

 Score =  127 bits (320), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 61/104 (58%), Positives = 73/104 (70%), Gaps = 1/104 (0%)

Query: 96  YNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLKE-YEFDPIYTIVELDKHENGAELQK 154
           ++A   Y  ILS S +VVFSKS CP S+ LK LL   YEF P Y +VELDKH NGAELQK
Sbjct: 98  FDAAKTYNEILSLSSMVVFSKSTCPLSSGLKQLLNNNYEFLPDYQVVELDKHANGAELQK 157

Query: 155 YIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWA 198
           Y+   T RSTVPN++ING+SRGG D    LH+   LL+SL+ WA
Sbjct: 158 YVTKTTARSTVPNLVINGVSRGGHDSIMELHKTGELLESLRKWA 201

>Smik_4.223 Chr4 (414277..414975) [699 bp, 232 aa] {ON} YDL010W
           (REAL)
          Length = 232

 Score =  128 bits (321), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 84/228 (36%), Positives = 131/228 (57%), Gaps = 33/228 (14%)

Query: 4   KRSLRLVSLTGMVIFVLFFIRHNAESVTRSYVGKESSNLANDAKVESDINNIQEGIAETK 63
           KR+ R++S+T +++ ++FF+  NA  +T     +ESS L      +S++NN+    AE+ 
Sbjct: 6   KRNARILSITMLLLLLVFFVAQNANFLTLETKERESSEL-----FDSEMNNL---AAEST 57

Query: 64  SNAVVADTS-------------NAVKNMAGPNG--VKDSDFAAEVET---------YNAE 99
              V   TS             N +K   G     + D D  + +++         +N +
Sbjct: 58  RKYVAVPTSATNKGSSEVDEEINEIKQKVGLQRPILSDDDSLSAIKSDKQSGTGKLFNVQ 117

Query: 100 AEYKNILSQSPIVVFSKSYCPFSTRLKNLLK-EYEFDPIYTIVELDKHENGAELQKYIGS 158
            EY  +L  SP+++FSKS C +S  +K LL+ EY+F P Y I+ELDKH +G ELQ+YI  
Sbjct: 118 KEYSLMLDLSPVIIFSKSSCSYSKGMKELLENEYQFVPNYYIIELDKHGHGEELQEYIKL 177

Query: 159 KTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKK 206
           KTGR TVPN+++NGISRGG++E   LH    LL+SL++W+    SV++
Sbjct: 178 KTGRGTVPNLLVNGISRGGNEEIRKLHSQGKLLESLQSWSDGKFSVEQ 225

>NDAI0G01800 Chr7 complement(394930..395598) [669 bp, 222 aa] {ON}
           Anc_3.189
          Length = 222

 Score =  126 bits (316), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/220 (34%), Positives = 122/220 (55%), Gaps = 17/220 (7%)

Query: 1   MLSKRSLRLVSLTGMVIFVLFFIRHNAESVTRSYVGKESSNLANDAKVESDINNIQEGIA 60
           +L+KR++R++  T ++I +  F+  NA + T +      S +       +D N+I +   
Sbjct: 4   VLNKRNIRVLITTCVLIVIGVFVFQNANASTYTSSKALKSTI-------TDTNSIVQAHG 56

Query: 61  ETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYNAEAE--------YKNILSQSPIV 112
           E ++   + +  N+  +       +DS   A+     AEAE        Y +IL + P+V
Sbjct: 57  EDENIPALKNVDNSPVSTE-ITSEEDSKINADSSIVQAEAEVPFDVAKEYTSILQRGPMV 115

Query: 113 VFSKSYCPFSTRLKNLLK-EYEFDPIYTIVELDKHENGAELQKYIGSKTGRSTVPNVIIN 171
           +FSK++CP+S  LK LL   ++ +P   ++ELDKHE+G ELQ YI  +TGR TVPN+IIN
Sbjct: 116 IFSKTFCPYSKALKELLSTNFQINPQPIVIELDKHEHGEELQAYIKEQTGRGTVPNLIIN 175

Query: 172 GISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKKAAAAT 211
           G S+GGSD+   L ++N LL SL  W+     V+    A+
Sbjct: 176 GNSKGGSDDMKKLFDENVLLDSLNEWSNGAYEVQATETAS 215

>TDEL0D04320 Chr4 complement(789241..789972) [732 bp, 243 aa] {ON}
           Anc_3.189 YDL010W
          Length = 243

 Score =  126 bits (317), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 133/239 (55%), Gaps = 41/239 (17%)

Query: 2   LSKRSLRLVSLTGMVIFVLFFIRHNAESVT------------------------------ 31
           L KR+LR++S+T +++ ++FF+  NA S++                              
Sbjct: 5   LKKRNLRVLSVTALLLLLVFFVVQNANSISFGEEELKAATFVNPVASGLTSAGTAVHNND 64

Query: 32  RSYVGKESSNLAND---AKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGPNGVKDSD 88
              V KES     D   A V+++I+ I++ +    ++   A   N++   AG +G KD  
Sbjct: 65  EIVVDKESGKKGKDQESALVDAEIDKIKQEV----NSGSGASKDNSISQKAG-SGSKDGT 119

Query: 89  FAAEVETYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHE 147
             +E E ++   EY  IL  SP++VFSKS+CP+S+RLK LL KEY   P Y ++ELDKH+
Sbjct: 120 -VSEGE-FDPAKEYSMILGISPVIVFSKSFCPYSSRLKELLTKEYTITPSYVVIELDKHK 177

Query: 148 NGAELQKYIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKK 206
           +G  LQK+I  KTGR+TVPN++ING SRGG D+   LH    LL+SL  W     +VK+
Sbjct: 178 HGVALQKFIEKKTGRATVPNLMINGKSRGGFDDIKALHSKGELLESLNKWGDGDFTVKQ 236

>CAGL0I04554g Chr9 (407790..408470) [681 bp, 226 aa] {ON} some
           similarities with uniprot|P38068 Saccharomyces
           cerevisiae YBR014c
          Length = 226

 Score =  121 bits (304), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 113/225 (50%), Gaps = 31/225 (13%)

Query: 12  LTGMVIFVLFFIRH-----NAESVTRSYVGKESSNLAN---------DAKVESDINNIQE 57
           LTG++  +L+F+ H     +A+S  R  VG  S N            +A++  + NNI++
Sbjct: 2   LTGVLFTILYFLSHFSGPSSADSAFRQ-VGPGSRNSKGGGNLGPPIMEAEMNGNTNNIEK 60

Query: 58  GIAETKSNAVVAD--TSNAVKNMAGPNGVKDSD-------------FAAEVETYNAEAEY 102
             A  K+    ++  TSN    + G     DS+               A    Y+   E+
Sbjct: 61  AEAGNKAMDTTSNSGTSNENAQLPGSKDQTDSNSNSLSNKEGQEDAEEAADAEYSPAKEF 120

Query: 103 KNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQKYIGSKTG 161
           + ++  +PIV+FSKSYCPFS  LK LL K Y  DP Y  VE+D+H NG +L  YI   TG
Sbjct: 121 QKLVKSAPIVIFSKSYCPFSKNLKKLLDKNYRLDPAYVAVEVDQHPNGDKLYSYIKKLTG 180

Query: 162 RSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKK 206
           R+TVPN+I NG S+GG D+   LH  N L   L  W    L V K
Sbjct: 181 RNTVPNLIANGDSKGGFDDMLALHNSNELESKLIEWGVGELQVSK 225

>Ecym_5313 Chr5 complement(633521..634267) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AER017C
          Length = 248

 Score =  117 bits (294), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 116/221 (52%), Gaps = 10/221 (4%)

Query: 1   MLSKRSLRLVSLTG---MVIFVLFFIRHNAESVTRSYVGKESSNLANDAKVESDI----N 53
            L+K++ R++ +T    +V F+LF       S+  S    E          E DI    N
Sbjct: 28  FLTKKAGRILLVTTVLFIVSFLLFQHSTTGNSLFNSPFPGEGRKQPKRPIAEEDIATEAN 87

Query: 54  NIQEGIAETKSNAVVADTSNAVKNMAGP--NGVKDSDFAAEVETYNAEAEYKNILSQSPI 111
           + ++G    + N  V D +        P  N    ++ +++   YN    Y+ IL  +P+
Sbjct: 88  SNKDGQISNRKNDHVVDVTTVNDKAKKPSSNQPNIAEDSSDNIGYNPADRYQKILDMAPV 147

Query: 112 VVFSKSYCPFSTRLKNLLKE-YEFDPIYTIVELDKHENGAELQKYIGSKTGRSTVPNVII 170
           ++FSK+ CP+S +LK+LL + Y+F P Y ++ELD  +   ELQ YI  +TGR TVPN+++
Sbjct: 148 IIFSKTTCPYSLKLKSLLTQNYQFTPDYVVIELDLEKRTKELQFYISQQTGRKTVPNLLV 207

Query: 171 NGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKKAAAAT 211
           NG S GG DE + LH    LL+S++ W+   ++V     +T
Sbjct: 208 NGKSMGGHDEISALHSKGELLKSIEDWSDKKVTVTPKQKST 248

>Kpol_1045.69 s1045 complement(161501..162289) [789 bp, 262 aa] {ON}
           complement(161503..162291) [789 nt, 263 aa]
          Length = 262

 Score =  108 bits (271), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/252 (28%), Positives = 125/252 (49%), Gaps = 52/252 (20%)

Query: 3   SKRSLRLVSLTGMVIFVLFFIRHNAESVTRSYVGK--------------ESSNL------ 42
           +KR++R++S+TG+++FV+F I  N   +     G               +S N+      
Sbjct: 6   NKRNIRILSITGVLLFVIFLISQNNNGMLTDPSGLISDAFESTSVKGMIDSDNVRVGGKV 65

Query: 43  -----------ANDAKVESDINNIQEGIA---------ETKSNAVVADTS--------NA 74
                      A D KV ++I+ I+E +             +  +  D +        + 
Sbjct: 66  RYSSDDLVKGTAKDDKVNAEIDKIKEEVGLPFNDNNNNNIANKKLTTDNNKNNVVNEKST 125

Query: 75  VKNMAGPNGVKDSDFAAEVETYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLKE-YE 133
           V+N A    V+     +E   ++   EY  I   SPI++++K++CP+  RL  LL+E Y 
Sbjct: 126 VQNNAAQRAVQG---GSEPVKFDPAQEYAIISELSPIILYTKTFCPYCKRLAKLLEESYS 182

Query: 134 FDPIYTIVELDKHENGAELQKYIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQS 193
           F P +  V+LDKH +G ELQ+++  +TG +TVPN +ING S GG D+   LHE   L+++
Sbjct: 183 FQPEFHAVKLDKHTHGDELQQFVNKQTGHNTVPNFVINGKSLGGYDDILKLHEAGKLIET 242

Query: 194 LKTWAGSTLSVK 205
           ++  +  ++ VK
Sbjct: 243 IQEMSDYSVVVK 254

>TPHA0H00630 Chr8 (125748..126323) [576 bp, 191 aa] {ON} Anc_3.189
           YDL010W
          Length = 191

 Score =  101 bits (252), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 72/116 (62%), Gaps = 1/116 (0%)

Query: 96  YNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLKE-YEFDPIYTIVELDKHENGAELQK 154
           ++   EY NI+  +P+V+FSK++CP+  RLK LL + Y F P   I+ELDKH NG EL  
Sbjct: 70  FDPAQEYINIMEMAPVVLFSKTFCPYCKRLKKLLADNYRFSPDIKIIELDKHPNGDELFS 129

Query: 155 YIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKKAAAA 210
           YI  +T  +TVPN+I+NG S GG D    L +D  + Q+++  +  ++ V    AA
Sbjct: 130 YIKQQTSHTTVPNLIVNGKSLGGFDSIKKLQDDKLVEQTIQKDSDFSVIVSSKDAA 185

>SAKL0H06468g Chr8 complement(569965..570741) [777 bp, 258 aa] {ON}
           weakly similar to uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 258

 Score = 84.7 bits (208), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 79/142 (55%), Gaps = 19/142 (13%)

Query: 82  NGVKDSDFAAEVETYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTI 140
           +G K++D   E   ++    +K ILS SP+V+F+KS    S  LKNLL KEY+  P   +
Sbjct: 114 DGHKNTD---ESLAFDPSINFKEILSTSPVVIFTKSSDLGSQYLKNLLTKEYQISPQVAV 170

Query: 141 VELDKHENGAELQKYI------GSKTGRST------VPNVIINGIS---RGGSDEFAGLH 185
           VELDKH  G ELQ YI        K+  S       VP + ING+S   +G  D+   LH
Sbjct: 171 VELDKHAKGKELQDYIKLNKLTAYKSNLSPSDDIPEVPYLFINGVSIINKGLKDDIKKLH 230

Query: 186 EDNSLLQSLKTWAGSTLSVKKA 207
           +D SLL  L+++AG  +  +KA
Sbjct: 231 KDGSLLDKLRSFAGEKVMFEKA 252

>KAFR0A03870 Chr1 (787414..788217) [804 bp, 267 aa] {ON} Anc_8.679
           YPL156C
          Length = 267

 Score = 80.5 bits (197), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/171 (32%), Positives = 88/171 (51%), Gaps = 9/171 (5%)

Query: 47  KVESDINNI--QEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYNAEAEYKN 104
           K E ++N+I  QE I+ T  N +  D     K +  P+ +K      E  +++ E  +  
Sbjct: 98  KNEMELNSIRVQEQIS-TILNEMSTDKILKPKKLLSPSKLKK--LNPESASFDVETNFNE 154

Query: 105 ILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQKYIGSK---T 160
           IL+ SP+V+F K+    S   KNLL +EYE  P   +V+LDKH NGA+LQ+YI      T
Sbjct: 155 ILNTSPVVLFIKTSDKQSNYFKNLLLREYEISPEVAVVDLDKHSNGAKLQEYIRKNKLMT 214

Query: 161 GRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSVKKAAAAT 211
               +P + IN ++   +D     H+D +LL++ K      +  KK  A +
Sbjct: 215 KDQKLPYLFINSVAITNNDNLKKFHKDGTLLENFKKLGNGKIMFKKIEAPS 265

>Kpol_1072.14 s1072 complement(30780..31532) [753 bp, 250 aa] {ON}
           complement(30780..31532) [753 nt, 251 aa]
          Length = 250

 Score = 72.0 bits (175), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 64/122 (52%), Gaps = 11/122 (9%)

Query: 96  YNAEAEYKNILSQSPIVVFSKSYCPFSTRLKN-LLKEYEFDPIYTIVELDKHENGAELQK 154
           ++AE  +K I++ SP+V+F KS  P S  LKN LL+EYE  P   +V+LD+H  G  LQK
Sbjct: 122 FDAERNFKEIINTSPVVIFIKSSDPASHYLKNLLLREYEVSPEMAVVDLDRHVQGQLLQK 181

Query: 155 YI-------GSKTGRSTVPNVIINGIS---RGGSDEFAGLHEDNSLLQSLKTWAGSTLSV 204
           YI       G       VP + ING+S    G   +         LL  LK++A   + +
Sbjct: 182 YIKAYQLTSGENGNPPEVPYLFINGVSVINNGIEKDIKQAQTKGILLDKLKSFASDNVMI 241

Query: 205 KK 206
           +K
Sbjct: 242 QK 243

>NCAS0C01340 Chr3 complement(245717..246790) [1074 bp, 357 aa] {ON}
           Anc_8.679
          Length = 357

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 70/127 (55%), Gaps = 13/127 (10%)

Query: 93  VETYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLKE-YEFDPIYTIVELDKHENGAE 151
           V+ ++ E  +  I+  SP V+F KS    S  L+ LLKE YE  P   +V+LDKH NG E
Sbjct: 225 VKPFDPERSFNQIIHTSPAVLFIKSSSTDSLNLRKLLKEEYEISPELAVVDLDKHSNGVE 284

Query: 152 LQKYIGSK---TGRST-----VPNVIING---ISRGGSDEFAGLHEDNSLLQSLKTWA-G 199
           L++YI      T   T     VP + +NG   I+ G S + + LH++  LL+ L++ + G
Sbjct: 285 LEQYIKQNKLLTEERTNSPINVPYLFLNGNSVINNGLSKDISKLHKNGHLLEKLRSLSDG 344

Query: 200 STLSVKK 206
             + VKK
Sbjct: 345 HIMFVKK 351

>KLLA0D05973g Chr4 (512611..513456) [846 bp, 281 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 281

 Score = 68.6 bits (166), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 66/130 (50%), Gaps = 16/130 (12%)

Query: 94  ETYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLK-EYEFDPIYTIVELDKHENGAEL 152
           E ++    ++ IL+ SP+++F KS    S  LKN+L  EY F P   +V+LDKH+ G  +
Sbjct: 146 ERFSPSLGFQQILNTSPVILFIKSSEKNSVDLKNVLTLEYTFSPEIIVVDLDKHQFGDSM 205

Query: 153 QKYI------------GSKTGRSTVPNVIINGIS---RGGSDEFAGLHEDNSLLQSLKTW 197
           Q+YI            G  +    VP + ING+S   +   D+    H D SLL  L+  
Sbjct: 206 QEYIQLNRLATYKSNYGESSKSPDVPYLFINGVSLINKSLKDDILNKHADGSLLSKLRHV 265

Query: 198 AGSTLSVKKA 207
           A S +S+ K 
Sbjct: 266 ADSKVSISKV 275

>NDAI0K01350 Chr11 complement(308152..308967) [816 bp, 271 aa] {ON}
           Anc_8.679
          Length = 271

 Score = 68.2 bits (165), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 64/117 (54%), Gaps = 13/117 (11%)

Query: 95  TYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLLK-EYEFDPIYTIVELDKHENGAELQ 153
           ++NAE  +K IL+ SP V+F KS    S  LKNLL  EYE  P   IV+L+KH NG +L 
Sbjct: 140 SFNAEDNFKQILNTSPAVLFIKSSEWDSQYLKNLLSIEYEISPQLAIVDLEKHSNGNQLL 199

Query: 154 KYI-------GSKTGRST--VPNVIINGIS---RGGSDEFAGLHEDNSLLQSLKTWA 198
            YI        S    ST  +P + ING+S    G S +   LH +  LL  LK+++
Sbjct: 200 NYIKKNKLLPPSNKASSTPNLPYLFINGVSIINNGLSKDIKQLHSNGHLLNKLKSYS 256

>TBLA0B03820 Chr2 complement(878781..879536) [756 bp, 251 aa] {ON}
           Anc_8.679 YPL156C
          Length = 251

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/188 (30%), Positives = 86/188 (45%), Gaps = 20/188 (10%)

Query: 33  SYVGKESSNLANDAKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAE 92
           ++V  +   + N  KVE  I+ I   I       +  D   +      P G         
Sbjct: 73  NFVHTQEEPVLNSIKVEEQISTILNDITNHHPTKLPVDDIPSSTRDPNPTG--------- 123

Query: 93  VETYNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNL-LKEYEFDPIYTIVELDKHENGAE 151
             +YN E  +K IL+ SP+V+F +S    S  +K L L EYE  P + IV+LD H+NG  
Sbjct: 124 --SYNPELNFKQILNTSPMVLFIRSSQKSSKFIKKLFLNEYEISPEFAIVDLDLHKNGNI 181

Query: 152 LQKYIGS-----KTGRSTVPNVIINGISRGGSD---EFAGLHEDNSLLQSLKTWAGSTLS 203
           LQ YI +     K     VP + ING+S   S+   +   LH ++ LL  LK+ AG  + 
Sbjct: 182 LQNYIQTKKIINKDDTLDVPYLFINGVSVINSNLNKDIISLHVNDLLLDKLKSLAGDNVM 241

Query: 204 VKKAAAAT 211
            +K    +
Sbjct: 242 FQKKGVPS 249

>TPHA0G01590 Chr7 complement(326061..326954) [894 bp, 297 aa] {ON}
           Anc_8.679 YPL156C
          Length = 297

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 63/125 (50%), Gaps = 14/125 (11%)

Query: 96  YNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQK 154
           ++A A YK I++ S +V+F KS    S  +K LL   YE  P   IV+LD+H  GA L  
Sbjct: 166 FDAAANYKEIINTSRVVLFMKSSDSQSNEIKKLLLNSYEILPEIAIVDLDRHVQGALLHD 225

Query: 155 YIGSKT-----------GRSTVPNVIINGIS--RGGSDEFAGLHEDNSLLQSLKTWAGST 201
           YI  K             +  VP ++ING+S     +  F  LH +  LLQ LK  AG +
Sbjct: 226 YIAKKKILTNQLGYHKDDQLEVPFLVINGVSFVTSSNKNFHKLHNEGLLLQKLKNLAGDS 285

Query: 202 LSVKK 206
           + + K
Sbjct: 286 VMISK 290

>KLLA0C01298g Chr3 complement(101676..101999) [324 bp, 107 aa] {ON}
           weakly similar to uniprot|P25567 Saccharomyces
           cerevisiae YCL037C SRO9 Associates with translating
           ribosomes and weakly similar to uniprot|Q12034
           Saccharomyces cerevisiae YDR515W SLF1 RNA binding
           protein that associates with polysomes
          Length = 107

 Score = 62.4 bits (150), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 56/93 (60%), Gaps = 2/93 (2%)

Query: 100 AEYKNILSQSPIVVFSKSYCPFS-TRLKNLLKEYEFDP-IYTIVELDKHENGAELQKYIG 157
           A  + +++ S I V SK+YCP+    LK L +E + D  + T+++L++ E+G+++Q  + 
Sbjct: 8   ARVQGLINSSKIFVASKTYCPYCQATLKTLFEEKKVDKKLATVLQLNQLEDGSDIQDALA 67

Query: 158 SKTGRSTVPNVIINGISRGGSDEFAGLHEDNSL 190
             TG+ TVPN+ ING   GG+ +   L+    L
Sbjct: 68  EITGQKTVPNIFINGKHIGGNSDLQELNNSGDL 100

>CAGL0M02167g Chr13 complement(259132..259833) [702 bp, 233 aa] {ON}
           some similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156c PRM4
          Length = 233

 Score = 63.9 bits (154), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 86/182 (47%), Gaps = 30/182 (16%)

Query: 55  IQEGIAET---KSNAVVADTS-NAVK------NMAGPNGVKDSDFAAE--VETYNAEAEY 102
           IQ  IA T    SNA++   S N++K      N      +  S  A +  V  Y+ E  +
Sbjct: 45  IQSIIASTDSLNSNALIGKASVNSIKKESNNLNSVAHTSMSSSSVAKDGTVIEYDPEKNF 104

Query: 103 KNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQKYIGSKTG 161
           K I++ SP V+F +S    S  L+ LL ++YE  P   IV+LDKH++   L+++I S   
Sbjct: 105 KQIINTSPAVLFIRSSEYESNILRKLLTRDYEITPELAIVDLDKHDHDVLLERHILSHKI 164

Query: 162 RST--------------VPNVIING---ISRGGSDEFAGLHEDNSLLQSLKTWAGSTLSV 204
           +ST               P + ING   I+ G +D+    HE   LL  LK +AG  +  
Sbjct: 165 KSTKVEVLKSTSVKQAKAPYLFINGHSLINNGIADDILKFHEKGQLLTKLKAFAGENIVF 224

Query: 205 KK 206
            K
Sbjct: 225 NK 226

>NCAS0B01640 Chr2 (268028..268750) [723 bp, 240 aa] {ON} Anc_8.679
          Length = 240

 Score = 63.2 bits (152), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 91/212 (42%), Gaps = 35/212 (16%)

Query: 5   RSLRLVSLT----GMVIFVLFFIRHNAESVTRSYVGKESSNLANDAK-----VESDINNI 55
           R+ R+VS T    G++ F++F           ++      N+AND       +  D+  +
Sbjct: 33  RTARIVSSTLLVLGLITFLVF-----------TWNDYSEQNIANDPNPTRSLLSEDLLML 81

Query: 56  QEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYNAEAEYKNILSQSPIVVFS 115
                E KS   +      V +   P     +   +    +N +  +  I+  SP+V+F 
Sbjct: 82  ANTFDEIKSRTSI------VSHQERPTTTLQA-LPSHAAAFNVQQHFTQIIHTSPVVLFM 134

Query: 116 KSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQKYI------GSKTGRSTVPNV 168
           KS    S  +++LL KEYE  P   +V+LDKH +GA LQ YI         T    +P +
Sbjct: 135 KSSQDDSRLMRDLLQKEYEISPEIAVVDLDKHTHGAALQDYIRLNKLDNRGTAYVKLPYL 194

Query: 169 IIN-GISRGGSDEFAGLHEDNSLLQSLKTWAG 199
            IN             LH+D +LL++ K  AG
Sbjct: 195 FINEQFVHVDVKNVKSLHKDGALLKTFKDAAG 226

>KNAG0C00450 Chr3 complement(77334..77807) [474 bp, 157 aa] {ON}
           Anc_1.38 YCL035C
          Length = 157

 Score = 60.5 bits (145), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 53/97 (54%), Gaps = 2/97 (2%)

Query: 101 EYKNILSQSPIVVFSKSYCPFS-TRLKNLLKEYEFDPIYTIV-ELDKHENGAELQKYIGS 158
           + K ++ + PI V SK+YCP+    LK L KE E      +V +LD+  +G E+Q+ +  
Sbjct: 57  QVKELIGEKPIFVASKTYCPYCRATLKTLFKELEIPESEAVVLQLDEMPDGPEIQEALFD 116

Query: 159 KTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLK 195
             G+ TVPN+ I G   GG+D+   L +   L   LK
Sbjct: 117 INGQKTVPNIYIKGQHIGGNDDLQTLKKAGKLEGLLK 153

>KLTH0D11308g Chr4 (925622..926437) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q12498 Saccharomyces
           cerevisiae YPL156C PRM4 Pheromone-regulated protein
           predicted to have 1 transmembrane segment
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 271

 Score = 62.4 bits (150), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 62/115 (53%), Gaps = 13/115 (11%)

Query: 96  YNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQK 154
           ++  A ++ ILS SP+V+F  S    S RL+ LL ++YE  P   +V+L+KH  GA+L+ 
Sbjct: 143 FDPAANFQEILSASPVVLFVDS-AQDSERLRALLQRDYEVSPAPAVVDLEKHSRGAQLET 201

Query: 155 YI---GSKTGRSTV-----PNVIINGISRGGSD---EFAGLHEDNSLLQSLKTWA 198
           YI    +K   +T      P + +NG S   SD   +   LH  N LL  LKT A
Sbjct: 202 YIRYYRTKPASATAVPRQPPYLFVNGNSVINSDFQSDIQDLHAQNELLAKLKTVA 256

>Suva_2.693 Chr2 (1223806..1224237) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 60.1 bits (144), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 54/98 (55%), Gaps = 2/98 (2%)

Query: 100 AEYKNILSQSPIVVFSKSYCPFS-TRLKNLLKEYEFDPIYTIV-ELDKHENGAELQKYIG 157
           A  K+++ Q  + V +K+YCP+    L  L +E        +V ELD+  NG+E+Q  + 
Sbjct: 42  AHVKDLIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKAVVLELDEMSNGSEIQDALE 101

Query: 158 SKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLK 195
             +G+ TVPNV ING   GG+ +   L ++  L + LK
Sbjct: 102 EISGQKTVPNVYINGKHIGGNSDLEALKKNGKLAELLK 139

>NDAI0E01150 Chr5 complement(228591..229301) [711 bp, 236 aa] {ON}
           Anc_8.679
          Length = 236

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 88/169 (52%), Gaps = 26/169 (15%)

Query: 3   SKRSLRLVS----LTGMVIFVLFFIRH----------NAESVTRSYVGKESSNLANDAKV 48
           SKR+LR++S    L G+  F+ F              NA SV  S    +S+ ++ +   
Sbjct: 12  SKRNLRVISSALLLLGVTSFLYFTWNDYSEKLSNPSTNASSVISS---TQSTLISQNILD 68

Query: 49  ESDINNIQEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYNAEAEYKNILSQ 108
           ES + NIQ      K N  +    N +K  +  + +  S  ++ ++++N E  +  IL  
Sbjct: 69  ESQLRNIQ------KVNDEILTIKNQIKTTSILSPIPTS--SSPIQSFNPEVNFFQILET 120

Query: 109 SPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQKYI 156
           SP+V+F KS    S  ++++L KEYE  P   +V+LDKH++G EL+++I
Sbjct: 121 SPMVLFIKSSERDSKIIRDILTKEYEISPELAVVDLDKHKHGDELEEFI 169

>CAGL0K05813g Chr11 (570054..570482) [429 bp, 142 aa] {ON} highly
           similar to uniprot|P17695 Saccharomyces cerevisiae
           YDR513w TTR1
          Length = 142

 Score = 59.3 bits (142), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 51/90 (56%), Gaps = 2/90 (2%)

Query: 103 KNILSQSPIVVFSKSYCPFSTRLKNLLKEYEFDPI--YTIVELDKHENGAELQKYIGSKT 160
           KN++ Q  I V SKSYCP+    K  L E    P+    ++ELD+ E G+++Q+ +    
Sbjct: 44  KNMIGQKKIFVASKSYCPYCRAAKQTLFEELKVPMDKAVVLELDEIEEGSDIQQALAEIN 103

Query: 161 GRSTVPNVIINGISRGGSDEFAGLHEDNSL 190
           G++TVPN+ I+G   GG+ +   L +   L
Sbjct: 104 GQNTVPNIYIDGQHIGGNSDLQKLKQTGKL 133

>TPHA0B03560 Chr2 complement(832814..833134) [321 bp, 106 aa] {ON} 
          Length = 106

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 54/94 (57%), Gaps = 3/94 (3%)

Query: 103 KNILSQSPIVVFSKSYCPFSTRLKN-LLKEYEFDP-IYTIVELDKHENGAELQKYIGSKT 160
           K +++  PI V +KSYCP+    K+ L KE        T+++LD+ ++G  +Q  +   T
Sbjct: 10  KELIAAKPIFVAAKSYCPYCQASKSTLFKELNVPADKATVLDLDQMQDGQAIQAILAELT 69

Query: 161 GRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSL 194
            ++TVPN+ ING   GG+ +   L ++N  LQ L
Sbjct: 70  QQNTVPNIFINGKHIGGNSDLQAL-KNNGELQKL 102

>NCAS0B08870 Chr2 (1703167..1703496) [330 bp, 109 aa] {ON} Anc_1.38
           YCL035C
          Length = 109

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 52/90 (57%), Gaps = 2/90 (2%)

Query: 103 KNILSQSPIVVFSKSYCPFS-TRLKNLLKEYEFDPIYTIV-ELDKHENGAELQKYIGSKT 160
           K ++++  I V SK+YCP+    +K L KE        +V +L++ ++GAE+Q+ +    
Sbjct: 11  KQLINEKEIFVASKTYCPYCHATIKTLFKELNVPKSKALVLQLNEMDDGAEIQQALFEIN 70

Query: 161 GRSTVPNVIINGISRGGSDEFAGLHEDNSL 190
           G+ TVPN+ ING   GG+D+   L E   L
Sbjct: 71  GQKTVPNIYINGKHVGGNDKLQDLKESGEL 100

>YDR513W Chr4 (1471017..1471448) [432 bp, 143 aa] {ON}
           GRX2Cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase involved
           in maintaining redox state of target proteins, also
           exhibits glutathione peroxidase activity, expression
           induced in response to stress
          Length = 143

 Score = 58.9 bits (141), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 54/98 (55%), Gaps = 2/98 (2%)

Query: 100 AEYKNILSQSPIVVFSKSYCPFS-TRLKNLLKEYEFDPIYTIV-ELDKHENGAELQKYIG 157
           A  K+++ Q  + V +K+YCP+    L  L +E        +V ELD+  NG+E+Q  + 
Sbjct: 42  AHVKDLIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALE 101

Query: 158 SKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLK 195
             +G+ TVPNV ING   GG+ +   L ++  L + LK
Sbjct: 102 EISGQKTVPNVYINGKHIGGNSDLETLKKNGKLAEILK 139

>Kpol_2002.36 s2002 complement(73659..73988) [330 bp, 109 aa] {ON}
           complement(73659..73988) [330 nt, 110 aa]
          Length = 109

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 53/95 (55%), Gaps = 4/95 (4%)

Query: 103 KNILSQSPIVVFSKSYCPF--STRLKNLLKEYEFDPIYTIV-ELDKHENGAELQKYIGSK 159
           K ++ + P+ V +KSYCP   +TR + L +EY       +V ELD   +GAE+Q+ +   
Sbjct: 11  KTMIGEKPVFVAAKSYCPHCRATR-ETLFEEYNLPREKALVLELDLMTDGAEIQEALAEI 69

Query: 160 TGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSL 194
           T + TVPN+ I G   GG+ +   L +D  L + L
Sbjct: 70  THQDTVPNIFIYGQHVGGNSDLQALKKDGQLKEML 104

>Skud_4.788 Chr4 (1391142..1391579) [438 bp, 145 aa] {ON} YDR513W
           (REAL)
          Length = 145

 Score = 58.5 bits (140), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 53/98 (54%), Gaps = 2/98 (2%)

Query: 100 AEYKNILSQSPIVVFSKSYCPFS-TRLKNLLKEYEFDPIYTIV-ELDKHENGAELQKYIG 157
           A  K+++ Q  + V +K+YCP+    L  L +E        +V ELD+  NG+E+Q  + 
Sbjct: 42  AHVKDLIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALE 101

Query: 158 SKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLK 195
             +G+ TVPNV ING   GG+ +   L +   L + LK
Sbjct: 102 EISGQRTVPNVYINGKHIGGNSDLESLKKSGKLAEILK 139

>Smik_4.794 Chr4 (1393831..1394262) [432 bp, 143 aa] {ON} YDR513W
           (REAL)
          Length = 143

 Score = 58.2 bits (139), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 54/95 (56%), Gaps = 2/95 (2%)

Query: 103 KNILSQSPIVVFSKSYCPFS-TRLKNLLKEYEFDPIYTIV-ELDKHENGAELQKYIGSKT 160
           K++++Q  + V +K+YCP+    L  L +E        +V ELD+  NG+E+Q  +   +
Sbjct: 45  KDLIAQKDVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEIS 104

Query: 161 GRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLK 195
           G+ TVPNV ING   GG+ +   L ++  L + LK
Sbjct: 105 GQKTVPNVYINGKHIGGNSDLETLKKNGKLAEILK 139

>Ecym_2394 Chr2 complement(763799..764644) [846 bp, 281 aa] {ON}
           similar to Ashbya gossypii ACR146W
          Length = 281

 Score = 58.5 bits (140), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 16/126 (12%)

Query: 102 YKNILSQSPIVVFSKSYCPFSTRLKNLLK-EYEFDPIYTIVELDKHENGAELQKYI---- 156
           ++ IL+ SP+VVF+K     S  LKNLL  EYE  P   IV+L KH+ G ELQKYI    
Sbjct: 154 FQEILNTSPVVVFAKGMNRDSEYLKNLLHAEYEVTPEIAIVDLMKHDQGDELQKYIMLNK 213

Query: 157 --------GSKTGRSTVPNVIINGIS---RGGSDEFAGLHEDNSLLQSLKTWAGSTLSVK 205
                    +      VP + ING+S        +    H    L++ L+++AG  +  K
Sbjct: 214 LNTYNTHYDASDDIPDVPYLFINGVSVINVSLEKDIKLQHTSGLLIEKLRSFAGEKVKFK 273

Query: 206 KAAAAT 211
           + +  +
Sbjct: 274 RLSPPS 279

>TBLA0A05080 Chr1 complement(1251350..1251706) [357 bp, 118 aa] {ON}
           Anc_1.38 YCL035C
          Length = 118

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 54/101 (53%), Gaps = 10/101 (9%)

Query: 101 EYKNILSQSPIVVFSKSYCPFSTRLKNLLKEYEFDPIYT------IVELDKHENGAELQK 154
           + K  ++  PI V  KS CP+S +    L    FD ++       ++ +D+ ENGAE+++
Sbjct: 19  QVKAWINAKPIFVARKSDCPYSKKTLETL----FDDLHVPKDKVLLITVDEIENGAEVKQ 74

Query: 155 YIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLK 195
            I   TG+ TVPN  ING   GG+D+   L +   L + L+
Sbjct: 75  AIIDYTGQKTVPNTYINGRHIGGNDDLQKLKQTGELQELLR 115

>Kpol_2000.99 s2000 (219541..219966) [426 bp, 141 aa] {ON}
           (219541..219966) [426 nt, 142 aa]
          Length = 141

 Score = 54.7 bits (130), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%), Gaps = 2/95 (2%)

Query: 103 KNILSQSPIVVFSKSYCPFS-TRLKNLLKEYEFDPIYTIV-ELDKHENGAELQKYIGSKT 160
           K ++ Q  + V +KSYCP+    L+ L  +Y      ++V +L++ E+G ++Q  +   T
Sbjct: 43  KELIGQKKVFVAAKSYCPYCQASLQTLFTDYHVPKDKSLVLQLNQMEDGDDIQAALAEIT 102

Query: 161 GRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLK 195
           G+ TVPN+ I+G   GG+ +   L     L + LK
Sbjct: 103 GQRTVPNIYIDGKHIGGNSDLQQLKSSGKLDELLK 137

>Kwal_26.8814 s26 (953489..954316) [828 bp, 275 aa] {ON} YPL156C
           (PRM4) -  [contig 68] FULL
          Length = 275

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 64/114 (56%), Gaps = 12/114 (10%)

Query: 96  YNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQK 154
           ++A A +  IL+ SP+V+F  S    S  L++LL + YE  P   +V+L+KH  GA+L+ 
Sbjct: 148 FDAAASFSEILNTSPVVIFVDS-AQDSELLRSLLHRHYEVSPAPAVVDLEKHSRGAQLES 206

Query: 155 YIG-SKTGRSTVPN------VIINGISRGGSD---EFAGLHEDNSLLQSLKTWA 198
           +I   KT +++ P+      + +NG S   +D   +   LH  N LL+ L++ A
Sbjct: 207 FIRLYKTDQTSNPSPREPPYLFVNGQSVINTDFKSDIQDLHAQNKLLEKLRSVA 260

>YPL156C Chr16 complement(255913..256767) [855 bp, 284 aa] {ON}
           PRM4Pheromone-regulated protein proposed to be involved
           in mating; predicted to have 1 transmembrane segment;
           transcriptionally regulated by Ste12p during mating and
           by Cat8p during the diauxic shift
          Length = 284

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 63/126 (50%), Gaps = 17/126 (13%)

Query: 96  YNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQK 154
           ++   ++ +I+  SP V+F KS    S  LKNLL +E+E  P    V+L+KH +G EL+K
Sbjct: 154 FDPRTDFLDIIRTSPAVLFIKSSQADSIFLKNLLQREFEISPELATVDLEKHSHGYELEK 213

Query: 155 YIGSKTGRSTV-----------PNVIINGIS---RGGSDEFAGLHEDNSLLQSLKTWAGS 200
           YI  K  +  +           P + +NGIS   RG   +    H    LL  LK+ A  
Sbjct: 214 YI--KQNKLNIDTSAALESIQSPYLFLNGISVINRGMVRDIIEPHSKGLLLPLLKSEARG 271

Query: 201 TLSVKK 206
            L V+K
Sbjct: 272 NLLVEK 277

>Skud_16.126 Chr16 complement(227492..228355) [864 bp, 287 aa] {ON}
           YPL156C (REAL)
          Length = 287

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 65/124 (52%), Gaps = 13/124 (10%)

Query: 96  YNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQK 154
           ++ +  + +I+S SP V+F KS    S  LKNLL +E+E  P    V+L+KH +G +L+K
Sbjct: 157 FDPKVSFLDIISTSPAVLFIKSSQMDSIFLKNLLQREFEISPELATVDLEKHSHGYQLEK 216

Query: 155 Y-------IGSKTGRSTV--PNVIINGIS---RGGSDEFAGLHEDNSLLQSLKTWAGSTL 202
           Y       I   T   ++  P + +NG+S    G + +    H +  LL  LK+ A   L
Sbjct: 217 YIKQNKLSINPSTALESIHSPYLFLNGVSVINNGMAKDIIEPHSEGLLLSILKSEARGNL 276

Query: 203 SVKK 206
            V+K
Sbjct: 277 LVEK 280

>Smik_6.353 Chr6 (567550..568410) [861 bp, 286 aa] {ON} YPL156C
           (REAL)
          Length = 286

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 63/126 (50%), Gaps = 17/126 (13%)

Query: 96  YNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQK 154
           ++ +A + +I+  SP V+F KS    S  L+NLL KE+E  P    V+L+KH  G EL+K
Sbjct: 156 FDPKANFLDIIKTSPAVLFIKSSQSDSIFLRNLLQKEFEISPELATVDLEKHSRGYELEK 215

Query: 155 YIGSKTGRSTV-----------PNVIINGIS---RGGSDEFAGLHEDNSLLQSLKTWAGS 200
           YI  K  +  +           P + +NG+S    G   +    H   SLL  LK+ A  
Sbjct: 216 YI--KQNKLNIDPDIALESIHPPYLFLNGVSLINNGIEKDIIEPHSKGSLLSVLKSEARG 273

Query: 201 TLSVKK 206
            L V+K
Sbjct: 274 NLLVEK 279

>NDAI0A00380 Chr1 complement(64438..64767) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 53/90 (58%), Gaps = 2/90 (2%)

Query: 103 KNILSQSPIVVFSKSYCPFS-TRLKNLLKEYEFDPIYTIV-ELDKHENGAELQKYIGSKT 160
           K ++++  I + SK+YCP+  + +K L +E +      +V +L++ ++GA++Q+ +    
Sbjct: 11  KEMINEKEIFIASKTYCPYCFSTIKTLFEELKVPKSKALVLQLNEMDDGADIQEALFEIN 70

Query: 161 GRSTVPNVIINGISRGGSDEFAGLHEDNSL 190
           G+ TVPN+ ING   GG+ +   L E   L
Sbjct: 71  GQKTVPNIYINGKHIGGNSQLQDLKESGEL 100

>Kwal_33.13166 s33 complement(102922..103338) [417 bp, 138 aa] {ON}
           YCL035C (GRX1) - Glutaredoxin [contig 121] FULL
          Length = 138

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 4/96 (4%)

Query: 103 KNILSQSPIVVFSKSYCPFSTRLKNLL---KEYEFDPIYTIVELDKHENGAELQKYIGSK 159
           + ++  + I V SK+YCP+      LL   K+   D +Y +V+LD  + G+E+Q+ +   
Sbjct: 40  QGLIKNNKIFVASKTYCPYCQATLKLLFEDKKLTKDQVY-VVQLDTIKEGSEIQEALAEI 98

Query: 160 TGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLK 195
           +G+ TVPNV I+G   GG+ +   L     L   LK
Sbjct: 99  SGQKTVPNVYISGEHIGGNSDLQALESSGKLDALLK 134

>NDAI0F04430 Chr6 complement(1083612..1084022) [411 bp, 136 aa] {ON}
           Anc_1.38 YCL035C
          Length = 136

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 56/98 (57%), Gaps = 11/98 (11%)

Query: 100 AEY-KNILSQSPIVVFSKSYCPFSTRLKNLLKEYEFDPIYT------IVELDKHENGAEL 152
            EY + ++ ++ +++F+KSYCP+    K+ +    F+ I        +++LD  +NG E+
Sbjct: 36  VEYVQKLIKENKVIIFAKSYCPYCKAAKHTI----FEEINVPKSKALVLDLDLMDNGQEI 91

Query: 153 QKYIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSL 190
           Q+ + +  G+ TVP+V ING   GG+ E   +++   L
Sbjct: 92  QQALLAINGQKTVPHVYINGEFIGGNSEVQKIYKSGEL 129

>Skud_3.27 Chr3 complement(48731..49063) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 2/81 (2%)

Query: 103 KNILSQSPIVVFSKSYCPFS-TRLKNLLKEYEFDPIYTIV-ELDKHENGAELQKYIGSKT 160
           K ++++  I V SK+YCP+    L  L ++ +      +V +L++ E+GA++Q  +    
Sbjct: 11  KELIAEKEIFVASKTYCPYCHAALNTLFQQLKVPKSKVLVLQLNEMEDGADIQAALYEIN 70

Query: 161 GRSTVPNVIINGISRGGSDEF 181
           G+ TVPNV ING   GG+D+ 
Sbjct: 71  GQRTVPNVYINGKHIGGNDDL 91

>Smik_3.42 Chr3 complement(62546..62878) [333 bp, 110 aa] {ON}
           YCL035C (REAL)
          Length = 110

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 47/81 (58%), Gaps = 2/81 (2%)

Query: 103 KNILSQSPIVVFSKSYCPFSTRLKNLLKEYEFDP--IYTIVELDKHENGAELQKYIGSKT 160
           K +++ + I V SK+YCP+     N L E    P     +++L++ ++GAE+Q  +    
Sbjct: 11  KELIADNEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNEMKDGAEIQAALCEIN 70

Query: 161 GRSTVPNVIINGISRGGSDEF 181
           G+ TVPN+ ING   GG+D+ 
Sbjct: 71  GQRTVPNIYINGKHIGGNDDL 91

>AFR710W Chr6 (1744868..1745203) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL035C (GRX1) and
           YDR513W (TTR1)
          Length = 111

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query: 101 EYKNILSQSPIVVFSKSYCPFSTRLKNLLKEYEFDPIYTI--VELDKH-ENGAELQKYIG 157
           + + ++ Q+ + + SK+YCP+    K  L E +  P   +  +ELD   E GA +Q  + 
Sbjct: 9   QVQALIQQNRVFIASKTYCPYCQAAKRTLLEEKRVPASAVKLLELDTMGEEGAVIQAALQ 68

Query: 158 SKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLK 195
             +G+ TVPN+ ING   GG+ +   L     L Q L+
Sbjct: 69  ELSGQRTVPNIYINGRHVGGNSDLEALKASGELDQLLE 106

>Ecym_1044 Chr1 complement(84062..84538) [477 bp, 158 aa] {ON}
           similar to Ashbya gossypii AFR710W
          Length = 158

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 3/93 (3%)

Query: 101 EYKNILSQSPIVVFSKSYCPFSTRLKNLLKEYEFDPI--YTIVELD-KHENGAELQKYIG 157
           + ++++ QS I V SK+YCP+  R K  L E +  P+    ++ELD   + G ++Q  + 
Sbjct: 57  QVQSLIKQSKIFVASKTYCPYCRRAKKTLFEDKKIPLPEAKVLELDIMGQEGVDIQAALL 116

Query: 158 SKTGRSTVPNVIINGISRGGSDEFAGLHEDNSL 190
             +G+ TVPN+ I G   GG+ E   L     L
Sbjct: 117 ELSGQRTVPNIYIGGKHIGGNSELQALESSGEL 149

>Suva_16.154 Chr16 complement(265047..265898) [852 bp, 283 aa] {ON}
           YPL156C (REAL)
          Length = 283

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 63/124 (50%), Gaps = 13/124 (10%)

Query: 96  YNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQK 154
           ++ +  + +I++ SP V+F KS    S  LK LL +E+E  P   IV+L+KH  G EL+K
Sbjct: 153 FDPKVNFLDIINTSPAVLFIKSSQMDSVFLKRLLQREFETSPELAIVDLEKHSYGYELEK 212

Query: 155 YI-------GSKTGRSTV--PNVIINGIS---RGGSDEFAGLHEDNSLLQSLKTWAGSTL 202
           YI          T    +  P + +NG+S    G + +    H    LL  LK+ AG  L
Sbjct: 213 YIKENKLDVDPSTALEAIHSPYLFLNGVSVINNGIARDIIEPHSKGLLLPVLKSKAGGNL 272

Query: 203 SVKK 206
            V+K
Sbjct: 273 LVEK 276

>NCAS0A00360 Chr1 complement(54875..55291) [417 bp, 138 aa] {ON}
           Anc_1.38 YCL035C
          Length = 138

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 55/95 (57%), Gaps = 4/95 (4%)

Query: 103 KNILSQSPIVVFSKSYCPFS--TRLKNLLKEYEFDPIYTIV-ELDKHENGAELQKYIGSK 159
           + ++ ++ I+VF+KSYCP+S  TR + L  + +      +V ELD  ++G E+Q+ + + 
Sbjct: 40  QKLIKENKIIVFAKSYCPYSIATR-RTLFNDCKVPQSKALVLELDLMQDGQEIQQALLAI 98

Query: 160 TGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSL 194
            G+ TVP+V I G   GG+ E   + +   L + L
Sbjct: 99  NGQKTVPHVYIAGEFIGGNHELQQIFQSGELQKKL 133

>YCL035C Chr3 complement(60841..61173) [333 bp, 110 aa] {ON}
           GRX1Hydroperoxide and superoxide-radical responsive
           heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair; protects
           cells from oxidative damage
          Length = 110

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 47/81 (58%), Gaps = 2/81 (2%)

Query: 103 KNILSQSPIVVFSKSYCPFSTRLKNLLKEYEFDP--IYTIVELDKHENGAELQKYIGSKT 160
           K++++++ I V SK+YCP+     N L E    P     +++L+  + GA++Q  +    
Sbjct: 11  KDLIAENEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGADIQAALYEIN 70

Query: 161 GRSTVPNVIINGISRGGSDEF 181
           G+ TVPN+ ING   GG+D+ 
Sbjct: 71  GQRTVPNIYINGKHIGGNDDL 91

>ZYRO0F17732g Chr6 (1469710..1470129) [420 bp, 139 aa] {ON} similar
           to uniprot|P17695 Saccharomyces cerevisiae YDR513W TTR1
           Glutaredoxin (thioltransferase) (glutathione
           reductase)and similar to uniprot|P25373 Saccharomyces
           cerevisiae YCL035c
          Length = 139

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 2/95 (2%)

Query: 103 KNILSQSPIVVFSKSYCPFS-TRLKNLLKEYEFDPIYTIV-ELDKHENGAELQKYIGSKT 160
           K ++ Q  + V SK+YCP+    LK L  + +F     IV +L+  ++G ++Q  +    
Sbjct: 45  KGLIGQKKLFVASKTYCPYCQATLKTLFTDLQFPEAQAIVLQLNTIDDGQDIQDALYEIN 104

Query: 161 GRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLK 195
           G+ TVPN+ I+G   GG+ +   L+    L   LK
Sbjct: 105 GQRTVPNIYIDGKHIGGNSDLQELNASGKLQALLK 139

>KNAG0G02580 Chr7 (585685..586521) [837 bp, 278 aa] {ON} Anc_8.679
           YPL156C
          Length = 278

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 78/168 (46%), Gaps = 20/168 (11%)

Query: 44  NDAKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGPNGVKDSDFAAEVETYNAEAEYK 103
           N  KV+ +I+ +++ I          D     K +A       ++  A+   ++  + + 
Sbjct: 103 NSQKVDQEISAVRKEIDAQTQPTARGDRRKKKKVLA-------TELLADDAPWDPLSTFT 155

Query: 104 NILSQSPIVVFSKS--YCPFSTRLKNLLK-EYEFDPIYTIVELDKHENGAELQKYIGSK- 159
            +++ SP+V+F KS      +  ++ +L  EYE  P   +V+LDKH  G ELQ YI ++ 
Sbjct: 156 EVMNMSPVVLFIKSSERNSLADHVRKVLSTEYEISPGAAVVDLDKHRYGEELQNYIETQK 215

Query: 160 -TGRST--VPNVIINGISRGGSD------EFAGLHEDNSLLQSLKTWA 198
             G S+  +P + +N +   G+       EF  LH   +LL   K  A
Sbjct: 216 LPGGSSQQLPYLFVNRVPVIGAGEIDSVAEFKRLHSTGALLDRFKQLA 263

>TDEL0C06640 Chr3 (1213768..1214199) [432 bp, 143 aa] {ON} Anc_1.38
           YCL035C
          Length = 143

 Score = 49.7 bits (117), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 54/95 (56%), Gaps = 2/95 (2%)

Query: 103 KNILSQSPIVVFSKSYCPFS-TRLKNLLKEYEFDPIYTIV-ELDKHENGAELQKYIGSKT 160
           K++++++ I V SK+YCP+    LK L  +       ++V +L+  ++GAE+Q+ +    
Sbjct: 45  KDLIAKNKIFVASKTYCPYCQATLKTLFDDLNVPKSKSLVLQLNTMDDGAEIQEALFEIN 104

Query: 161 GRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLK 195
           G+ +VPN+ I+G   GG+ +   L     L + LK
Sbjct: 105 GQKSVPNIYIDGKHIGGNSDLQELKNAGKLDEVLK 139

>Suva_3.178 Chr3 complement(270878..271828) [951 bp, 316 aa] {ON}
           YCL035C (REAL)
          Length = 316

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 103 KNILSQSPIVVFSKSYCPFSTRLKNLLKEYEFDPI--YTIVELDKHENGAELQKYIGSKT 160
           K ++++  I V SK+YCP+     N L +    P     +++L++ ++G ++Q  +    
Sbjct: 217 KELIAEKEIFVASKTYCPYCHAALNTLFQKMNVPKSKVLVLQLNEMKDGVDIQAALYQLN 276

Query: 161 GRSTVPNVIINGISRGGSDEFAGLHEDNSL 190
           G+ TVPN+ ING   GG+D+   L E   L
Sbjct: 277 GQRTVPNIYINGKHIGGNDDLQELRETGEL 306

>SAKL0C01320g Chr3 complement(118401..118898) [498 bp, 165 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 Hydroperoxide and superoxide-radical
           responsive heat-stable glutathione-dependent disulfide
           oxidoreductase with active site cysteine pair protects
           cells from oxidative damage and similar to
           uniprot|P17695 Saccharomyces cerevisiae YDR513w
           cytoplasmic glutaredoxin, thioltransferase,
           glutathione-dependent disulfide oxidoreductase
          Length = 165

 Score = 49.3 bits (116), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 55/96 (57%), Gaps = 7/96 (7%)

Query: 103 KNILSQSPIVVFSKSYCPFS-TRLKNLL--KEYEFDPIYTIVELDKHENGAELQKYIGSK 159
           + ++ QS I V SK+YCP+    L+ L   K+   D I  +++L++ ++GAE+Q  +   
Sbjct: 67  QTLIKQSKIFVASKTYCPYCQATLRTLFDDKKVPNDKI-KVLQLNQLDDGAEIQDALQEI 125

Query: 160 TGRSTVPNVIINGISRGGS---DEFAGLHEDNSLLQ 192
           +G+ TVPN+ I G   GG+    E A   E + LL+
Sbjct: 126 SGQRTVPNIYILGKHIGGNSDLQELAAAGELDRLLE 161

>KAFR0D00360 Chr4 complement(54064..54393) [330 bp, 109 aa] {ON}
           Anc_1.38 YCL035C
          Length = 109

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 103 KNILSQSPIVVFSKSYCPFS-TRLKNLLKEYEFDPIYTIV-ELDKHENGAELQKYIGSKT 160
           K+++++  + V SKSYCP+S   L  L  E        +V ++++   G+++Q  +   T
Sbjct: 11  KDLINEKDVFVASKSYCPYSKAALNTLFTELNVPTSKALVLQVNQLPEGSDIQDALLELT 70

Query: 161 GRSTVPNVIINGISRGGSDEFAGLHEDNSL 190
           G+ TVPN+ I G   GG+D+   L +   L
Sbjct: 71  GQRTVPNIYIKGKHIGGNDDLQILKQSGKL 100

>TPHA0E03730 Chr5 (787911..788231) [321 bp, 106 aa] {ON} Anc_1.38
           YCL035C
          Length = 106

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 101 EYKNILSQSPIVVFSKSYCPFSTRLK-NLLKEYE-FDPIYTIVELDKHENGAELQKYIGS 158
           E + ++ + P+ + +KSYC  S   K  L  EY   D   T++ELDK  +G  +   +  
Sbjct: 8   EVQKMIDEKPVFIATKSYCNESNAAKGTLFDEYSILDDEATVLELDKMSDGEAVLFALSK 67

Query: 159 KTGRSTVPNVIINGISRGGSDEFAGLHEDNSL 190
            + +ST+PN+ I G   GG  +   ++E   L
Sbjct: 68  ISQQSTLPNIFIKGKHIGGYQDLKEMNESGEL 99

>TDEL0E05740 Chr5 complement(1072231..1072557) [327 bp, 108 aa] {ON}
           Anc_1.38 YCL035C
          Length = 108

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 103 KNILSQSPIVVFSKSYCPFSTRLKNLLKEYEFDPI--YTIVELDKHENGAELQKYIGSKT 160
           K ++  + +V+FSK++CP+         E    P+    +++LDK ++G+E+Q  +    
Sbjct: 11  KELVEDNKVVIFSKTFCPYCKATLKTFDEARL-PVGLVRVLQLDKLDDGSEIQDALYELN 69

Query: 161 GRSTVPNVIINGISRGGSDEFAGLHEDNSL 190
           G+ TVP++ I     GG+ E   L  +  L
Sbjct: 70  GQKTVPSIYILKRHIGGNSELQKLKHEGVL 99

>KLTH0F01276g Chr6 complement(101034..101450) [417 bp, 138 aa] {ON}
           similar to uniprot|P25373 Saccharomyces cerevisiae
           YCL035C GRX1 and similar to uniprot|P17695 Saccharomyces
           cerevisiae YDR513w TTR1
          Length = 138

 Score = 46.6 bits (109), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 49/91 (53%), Gaps = 4/91 (4%)

Query: 103 KNILSQSPIVVFSKSYCPFSTRLKNLL---KEYEFDPIYTIVELDKHENGAELQKYIGSK 159
           ++++  + I V +K+YCP+      LL   K+   D +  +++LD  + G+E+Q+ +   
Sbjct: 40  RSLIKDNKIFVAAKTYCPYCNATLKLLFQDKKLRKDQVL-LLQLDTMKEGSEIQEALTEI 98

Query: 160 TGRSTVPNVIINGISRGGSDEFAGLHEDNSL 190
           +G+ TVPN+ I G   GG+ +   L     L
Sbjct: 99  SGQRTVPNIYILGEHIGGNSDLQALEASGKL 129

>TPHA0B04820 Chr2 (1130278..1130694) [417 bp, 138 aa] {ON} Anc_1.38
           YCL035C
          Length = 138

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 10/88 (11%)

Query: 105 ILSQSPIVVFSKSYCPFSTRLKNLLKEYEFDPIYT------IVELDKHENGAELQKYIGS 158
           ++ Q  + V +KSYCP+    KN L    FD +        +++LD   +G ELQ  +  
Sbjct: 42  LIKQKSVFVAAKSYCPYC---KNTLITL-FDELKVPKEKALVLQLDGMSDGLELQDTLQQ 97

Query: 159 KTGRSTVPNVIINGISRGGSDEFAGLHE 186
             G+ TVP + I+G   GG+ E   L +
Sbjct: 98  INGQRTVPQIYIDGKHVGGNSELQKLKK 125

>ACR146W Chr3 (607725..608366) [642 bp, 213 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL156C (PRM4)
          Length = 213

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 96  YNAEAEYKNILSQSPIVVFSKSYCPFSTRLKNLL-KEYEFDPIYTIVELDKHENGAELQK 154
           +     ++ I+S SP V+F K     S  L++LL  EYE  P   +V+L KH    +LQ+
Sbjct: 82  FRPAQNFQEIISTSPFVLFVKGTDESSRYLRHLLTNEYEVTPEIAVVDLSKHRYSGDLQR 141

Query: 155 YI 156
           YI
Sbjct: 142 YI 143

>KNAG0F00250 Chr6 complement(26606..27034) [429 bp, 142 aa] {ON}
           Anc_1.38 YCL035C
          Length = 142

 Score = 34.7 bits (78), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 43/82 (52%), Gaps = 2/82 (2%)

Query: 111 IVVFSKSYCPFS-TRLKNLLKEYEFDP-IYTIVELDKHENGAELQKYIGSKTGRSTVPNV 168
           + V  K++CP+    +  LL + +       +++L++ ++G E+Q+ +    G+ TVP++
Sbjct: 48  VFVAVKTWCPYCKATIVTLLDQMKVPASKIKVLKLNELKHGREIQEALFQMNGQKTVPHI 107

Query: 169 IINGISRGGSDEFAGLHEDNSL 190
            IN I  GG+ +   L     L
Sbjct: 108 YINQIFIGGNSDLEELRVSGKL 129

>SAKL0H04136g Chr8 complement(386608..386940) [333 bp, 110 aa] {ON}
           similar to uniprot|Q05926 Saccharomyces cerevisiae
           YLR364W Hypothetical ORF
          Length = 110

 Score = 33.5 bits (75), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 40/96 (41%), Gaps = 3/96 (3%)

Query: 103 KNILSQSPIVVFSKSYCPFSTRLKNLLKEYE-FDPIYT--IVELDKHENGAELQKYIGSK 159
           ++IL     V  +  +CP      ++ K+Y   D +Y   I +L   E G   +      
Sbjct: 9   QSILRAHKFVQLTAGWCPDCVYANSIWKKYGVLDKVYLFDIAKLPTREEGNAYRDAFHKI 68

Query: 160 TGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLK 195
           +G   +P + +NG   G   +   L ++  L+  LK
Sbjct: 69  SGIRWLPTIFVNGTKWGTEADLRRLDKEGKLVDELK 104

>Kpol_513.11 s513 complement(30908..31351) [444 bp, 147 aa] {ON}
           complement(30908..31351) [444 nt, 148 aa]
          Length = 147

 Score = 31.6 bits (70), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 15/94 (15%)

Query: 106 LSQSPIVVFSK-----SYCPFSTRLKNLLKEYEFDP----IYTIVELDKHENGAELQKYI 156
           +S +P+V+F K       C FS    N+L +   DP     Y ++E        EL++ I
Sbjct: 44  VSSAPVVLFMKGTPEFPQCGFSRATINILGQQGVDPQKFAAYNVLE------DPELRQGI 97

Query: 157 GSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSL 190
              +   T+P + +N    GG D    + +D  L
Sbjct: 98  KEYSEWPTIPQLYVNKEFVGGCDIITTMAQDGQL 131

>Ecym_4224 Chr4 complement(468353..469753) [1401 bp, 466 aa] {ON}
           similar to Ashbya gossypii AGL165W
          Length = 466

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 30/70 (42%)

Query: 23  IRHNAESVTRSYVGKESSNLANDAKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGPN 82
           I +  E   RS       N+     V  D+N I  G    K +A+V++ S+ +KN   P 
Sbjct: 150 INYIVEETIRSLHEVLKPNMEEQLSVAEDVNVIPPGYLALKPSALVSNPSDVLKNFMAPE 209

Query: 83  GVKDSDFAAE 92
             + SD   E
Sbjct: 210 WREKSDELVE 219

>KNAG0J01730 Chr10 (316411..317001) [591 bp, 196 aa] {ON} Anc_8.679
           YPL156C
          Length = 196

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 102 YKNILSQSPIVVFSKSYCPFSTRL-KNLLKEYEFDPIYTIVELDKHENGAELQKYI 156
           + ++ + +PIV+   S  P +  L K  ++EYE  P  T+V L+ +    EL+ ++
Sbjct: 77  FLDLFAVTPIVLLVDSTDPRAVDLEKTFMQEYEVSPPLTVVNLNSYPESRELRLFL 132

>NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {ON}
           Anc_4.275 YLR409C
          Length = 949

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 127 NLLKEYEFDPIY--TIVELDKHENGAELQKYIGSKTGRSTVPNVI 169
           N LKEY FDP    T  ++D  EN  +  +++ S+ G S  P+ I
Sbjct: 319 NSLKEYVFDPSLSTTTNDIDGGENVVQPPRFLRSRGGHSQPPSAI 363

>Kwal_23.3081 s23 (148637..150271) [1635 bp, 544 aa] {ON} YIL136W
           (OM45) - 45-kDa mitochondrial outer membrane protein
           [contig 248] FULL
          Length = 544

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 20/86 (23%)

Query: 40  SNLANDAK--VESDINNIQEGIAETKSN---AVVA------DTSNAVKNMAGPNGVKDSD 88
           S L NDA+  + +DI NI++G+ E  S+   A+V       DT++A++  AG        
Sbjct: 145 SRLVNDARDSISADIRNIKDGVTEDASSIKEALVGAKKTTEDTADAIRRRAGE------- 197

Query: 89  FAAEVETYNAEAEYKNILSQSPIVVF 114
             AE +  N     ++ +S++   +F
Sbjct: 198 --AEADVKNKATSARDTVSETKESIF 221

>ZYRO0F13970g Chr6 (1149055..1150473) [1419 bp, 472 aa] {ON} similar
           to uniprot|P09368 Saccharomyces cerevisiae YLR142W PUT1
           proline oxidase
          Length = 472

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 26/59 (44%)

Query: 23  IRHNAESVTRSYVGKESSNLANDAKVESDINNIQEGIAETKSNAVVADTSNAVKNMAGP 81
           I H  +   RS       NL N  +   D+N++  G    K +A+VA+ S  + N   P
Sbjct: 155 INHIVKETIRSVHEVLKPNLLNQLETAVDVNDVAPGYIALKPSALVANPSQVLLNFKNP 213

>KLLA0B04994g Chr2 complement(453048..454244) [1197 bp, 398 aa]
          {ON} similar to uniprot|Q2VQX1 Saccharomyces cerevisiae
          YLR443W ECM7
          Length = 398

 Score = 29.6 bits (65), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 12/75 (16%)

Query: 7  LRLVSLTGMVIFVLFFIRHNAESVTRSYVGK-ESSNLANDAKVESDINNIQEGIAETKSN 65
          LR+++  G+++FVL     +A S    Y+G+ ++SN+           NI +G+ +  S+
Sbjct: 34 LRVITSVGIIVFVLVLTAISAASPNSLYLGRLDTSNV-----------NILQGLFDKLSS 82

Query: 66 AVVADTSNAVKNMAG 80
          +VV+   + + N AG
Sbjct: 83 SVVSAKLSDINNGAG 97

>NDAI0H00920 Chr8 (205900..207741) [1842 bp, 613 aa] {ON} Anc_5.614
          Length = 613

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 161 GRSTVPNVIINGISRGGSDEFAGLHEDNS 189
           G    PN +I G+SRG    FA L+ D+S
Sbjct: 535 GHMIYPNRVIQGVSRGSMSGFAHLNSDSS 563

>NDAI0E02890 Chr5 (610133..610600) [468 bp, 155 aa] {ON} Anc_8.519
          Length = 155

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 41/102 (40%), Gaps = 15/102 (14%)

Query: 103 KNILSQSPIVVFSK-----SYCPFSTRLKNLLKEYEFDPI----YTIVELDKHENGAELQ 153
           ++ +  +P+V+F K       C FS     LL +   DP     Y ++E        EL+
Sbjct: 37  QDAIGSAPVVLFMKGTPEFPKCGFSKATIQLLGQQGVDPAKFAAYNVLE------DPELR 90

Query: 154 KYIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSLLQSLK 195
             I   T   T+P + +N    GG D    +     L + L+
Sbjct: 91  DAIKEFTEWPTIPQLFVNKEFVGGCDVITSMSRSGELAEVLE 132

>NCAS0B02290 Chr2 (383984..384403) [420 bp, 139 aa] {ON} Anc_8.519
          Length = 139

 Score = 28.1 bits (61), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 15/97 (15%)

Query: 103 KNILSQSPIVVFSKSY-----CPFSTRLKNLLKEYEFDP----IYTIVELDKHENGAELQ 153
           K+ +S +P+V+F K       C FS     LL     +P     + I+      +  EL+
Sbjct: 32  KSAVSSAPVVLFMKGTPDAPKCGFSRATVALLGYEGLNPSKFKAFNIL------DDVELR 85

Query: 154 KYIGSKTGRSTVPNVIINGISRGGSDEFAGLHEDNSL 190
             I   T   T+P + +NG   GG D    + ++  L
Sbjct: 86  DGIKEYTDWPTIPQLFVNGEFIGGCDVIVSMSKNGDL 122

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,777,908
Number of extensions: 884600
Number of successful extensions: 2842
Number of sequences better than 10.0: 111
Number of HSP's gapped: 2753
Number of HSP's successfully gapped: 113
Length of query: 211
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 106
Effective length of database: 41,441,469
Effective search space: 4392795714
Effective search space used: 4392795714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)