Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E16281gna 1ON60560526470.0
KLTH0B01166gna 1ON57753416440.0
NDAI0I02660na 1ON59459316350.0
Kwal_33.15545na 1ON57657216330.0
SAKL0G14916gna 1ON58156016280.0
NCAS0D02260na 1ON59758516100.0
Ecym_2480na 1ON58653715910.0
Kpol_358.3na 1ON57553415850.0
Suva_16.40na 1ON60653215880.0
YPL265W (DIP5)na 1ON60853215850.0
Smik_6.473na 1ON60653415780.0
Skud_16.12na 1ON60759815620.0
TPHA0M00130singletonON61153215500.0
ACL135Wna 1ON58855815240.0
CAGL0A01199gna 1ON61353314960.0
KAFR0B06430singletonON59353514770.0
TBLA0A07060na 1ON62553114730.0
KNAG0L02460singletonON58853614650.0
KNAG0L02470singletonON63849814270.0
ZYRO0D17908gna 1ON5184467998e-99
TDEL0A08030singletonON5144407962e-98
KLLA0C02343g1.83ON5814497742e-94
Skud_14.711.84ON6125587614e-92
Ecym_80357.44ON5635567574e-92
Ecym_10871.83ON5705337532e-91
TDEL0C061701.84ON5735077506e-91
Kwal_33.134011.83ON5595557462e-90
SAKL0C02684gsingletonON5884497482e-90
NDAI0A006101.83ON5655217435e-90
SAKL0C02640gsingletonON5485287416e-90
TBLA0A054601.84ON6085647467e-90
SAKL0C02728g1.84ON5624647427e-90
Kpol_2000.641.84ON6105827458e-90
KLTH0F02398g1.83ON5555557382e-89
NCAS0A006001.83ON5445067364e-89
Smik_14.681.84ON6114947404e-89
Smik_14.671.83ON5735717375e-89
NDAI0F041901.84ON5995037379e-89
Smik_5.241.83ON5905057352e-88
YNL268W (LYP1)1.84ON6115167362e-88
SAKL0C02662g1.83ON5484927312e-88
Kwal_23.4026singletonON5345277302e-88
CAGL0J08162g1.84ON5974977343e-88
CAGL0J08184g1.83ON5725047323e-88
Skud_5.261.83ON5904617291e-87
Suva_5.41.83ON5905067291e-87
YEL063C (CAN1)1.83ON5905307273e-87
Suva_14.751.84ON6115037283e-87
Ecym_10881.84ON5675497243e-87
Kwal_33.134111.84ON5605087243e-87
KNAG0C05920singletonON5995137264e-87
Skud_14.701.83ON5735307228e-87
KNAG0F004801.84ON5975677248e-87
Kwal_26.69407.44ON5705627219e-87
YOR348C (PUT4)7.44ON6275097251e-86
TDEL0C061801.83ON5834937202e-86
TPHA0B044701.84ON5995537203e-86
YNL270C (ALP1)1.83ON5735647183e-86
KAFR0D039401.83ON5975717187e-86
KLTH0F02420g1.84ON6214557172e-85
NDAI0F042001.83ON5665507122e-85
KLLA0C02365g1.84ON5795057123e-85
SAKL0B10956g7.44ON5725497123e-85
ZYRO0F16632g1.84ON6074587133e-85
ZYRO0F16654g1.83ON5805217099e-85
Suva_14.731.83ON4974487021e-84
TBLA0A054501.83ON6064527101e-84
SAKL0F09790gsingletonON5585337061e-84
KAFR0D007001.83ON5745477053e-84
NCAS0A006101.84ON6075247049e-84
TPHA0B044801.83ON6034867031e-83
KLTH0D01474g7.44ON6244497032e-83
AFR156W7.44ON5585326973e-83
Kpol_2000.651.83ON5955036993e-83
KNAG0C007901.83ON5794466932e-82
NCAS0B085701.83ON5325166892e-82
AFR667C1.84ON5635276895e-82
AFR668W1.83ON5564826885e-82
TDEL0H040707.44ON5775046897e-82
Suva_13.517singletonON5474916869e-82
Skud_15.5157.44ON6265006901e-81
TDEL0E05750singletonON5484966842e-81
Smik_15.5327.44ON6315476892e-81
TPHA0H028507.44ON6015196863e-81
Kwal_8.590na 2ON6294306841e-80
Kpol_367.77.44ON5845656792e-80
Suva_8.4027.44ON6834676835e-80
NDAI0E038007.44ON6215276795e-80
Smik_6.482na 3ON5584916731e-79
KLTH0B00154gna 2ON5564336651e-78
CAGL0E05632g7.44ON5984616653e-78
NCAS0E022607.44ON5935326645e-78
KNAG0E003907.44ON5995126628e-78
TBLA0C01240singletonON6294676543e-76
Skud_16.2na 3ON4964566417e-76
KLTH0A00308gsingletonON5414966326e-74
KAFR0E018505.158ON5603836204e-72
KAFR0C051607.44ON5844646145e-71
KLLA0F23419g7.44ON5735226145e-71
TPHA0A047005.158ON5693896111e-70
KLLA0A11770g5.158ON5813906075e-70
YBR068C (BAP2)3.284ON6095126061e-69
SAKL0F16544gsingletonON5674716032e-69
Kpol_543.791.244ON6054426042e-69
TDEL0C00930singletonON5954966015e-69
ZYRO0C18502g7.44ON5755276006e-69
Kwal_27.126811.244ON5933945981e-68
KLLA0B14685gna 4ON5714115953e-68
CAGL0K05753g1.50ON6605856003e-68
CAGL0B03773g5.158ON6054505963e-68
KAFR0C004003.284ON5824705944e-68
Suva_4.3073.284ON6094995964e-68
SAKL0G14014g5.158ON6054605885e-67
NDAI0D021605.158ON5874475875e-67
Kpol_1010.325.158ON5995035861e-66
Ecym_47895.158ON5883895851e-66
KLTH0B02046g5.158ON5895475832e-66
Smik_2.2013.284ON6095195842e-66
Suva_3.1891.50ON6335165862e-66
KLTH0E15642g1.244ON5963915832e-66
Ecym_26643.285ON5754985795e-66
ZYRO0D03762g1.244ON6003865798e-66
Skud_7.5255.158ON6033905791e-65
KLTH0F04048gsingletonON5834305771e-65
KLLA0C01606g1.50ON6205015791e-65
KNAG0C02140singletonON5983895772e-65
Smik_16.1155.158ON6034955772e-65
YCL025C (AGP1)1.50ON6334805773e-65
Skud_2.1913.284ON6095095754e-65
Ecym_60211.244ON6003805735e-65
KAFR0D00510na 5ON6175205746e-65
YGR191W (HIP1)5.158ON6033935746e-65
Suva_11.2731.244ON6013875737e-65
Smik_3.531.50ON6334965749e-65
Skud_11.2751.244ON6023875729e-65
Kwal_23.2817na 4ON5805205691e-64
Suva_2.6881.50ON6615315732e-64
SAKL0C01232gsingletonON6134985702e-64
NCAS0I015303.284ON5955005692e-64
KNAG0H011503.284ON6174345703e-64
TPHA0B010901.244ON6064885693e-64
YDR508C (GNP1)1.50ON6635425713e-64
KNAG0J022003.284ON6074345684e-64
KAFR0A011203.284ON5924725674e-64
Kpol_1052.163.284ON6134425684e-64
YKR039W (GAP1)1.244ON6024505675e-64
Kwal_33.132041.50ON6075895667e-64
NDAI0B052201.244ON6114325667e-64
SAKL0D02970g3.284ON6015645651e-63
TPHA0A002405.158ON6034515651e-63
Smik_11.3021.244ON5533865621e-63
Smik_4.7901.50ON6635425681e-63
KAFR0D005001.50ON6174655651e-63
NCAS0A071105.158ON5925005631e-63
NCAS0D018705.158ON5955475631e-63
Skud_3.381.50ON6334365615e-63
NDAI0A074903.284ON5964375597e-63
SAKL0D00836gna 6ON6014395597e-63
NCAS0B079001.244ON6193845598e-63
KAFR0D04120na 7ON6483925619e-63
SAKL0D04664g1.244ON5934355571e-62
SAKL0D02948gna 8ON5944515561e-62
Kpol_2000.921.50ON6374605582e-62
TDEL0D00200singletonON5674155542e-62
NDAI0F043901.50ON6675065592e-62
TPHA0M012003.284ON6075155553e-62
Kwal_33.154075.158ON5874555534e-62
AGR039Cna 8ON5864495534e-62
KLTH0F01606gna 7ON6045305534e-62
TBLA0B077605.158ON6583905565e-62
KNAG0G009005.158ON6134485535e-62
NDAI0C029505.158ON6094885535e-62
KAFR0D00520na 7ON5984585526e-62
NDAI0A006401.50ON6414545539e-62
KNAG0C005901.50ON6345235539e-62
Suva_2.716singletonON6034975519e-62
Suva_7.4855.158ON6033905501e-61
TPHA0E036601.50ON6475005531e-61
AGR319W5.158ON6264605512e-61
Kpol_1065.133.284ON5964605482e-61
TBLA0I020103.285ON6284485493e-61
AGR040C3.285ON5735385454e-61
CAGL0L03267g1.244ON5974535464e-61
KLLA0A06886gsingletonON5875155446e-61
Skud_4.7841.50ON6635165478e-61
KNAG0J022103.285ON5815685421e-60
CAGL0L07546g3.284ON6344575441e-60
KLLA0A10813g1.368ON5844965402e-60
NCAS0A089201.368ON5994345412e-60
KAFR0D041401.50ON6374455414e-60
SAKL0C01650g1.50ON6135045404e-60
TBLA0A05190na 7ON6675475434e-60
NCAS0A106803.284ON5934615394e-60
Kwal_26.9612singletonON5434535364e-60
NDAI0G060301.368ON5994475395e-60
AFR230C1.244ON6043875387e-60
Smik_4.2843.284ON6044345387e-60
KLTH0F01584g1.50ON5965655378e-60
CAGL0H08393g3.284ON6124325371e-59
SAKL0D02926g3.285ON5835215341e-59
Skud_4.3003.284ON6045195352e-59
KLTH0H13398g1.368ON5874805342e-59
KLTH0C05170g3.284ON5984565342e-59
TDEL0C065101.50ON6424455372e-59
Kwal_33.14276na 6ON5964395333e-59
Kpol_543.78singletonON6054435343e-59
AEL030W1.368ON5825695323e-59
SAKL0C13992gsingletonON5524515286e-59
Suva_2.2033.284ON6044455317e-59
Sklu_YGOB_Anc_1.3681.368ON5414465251e-58
Ecym_2663na 8ON5894495281e-58
TDEL0E05700singletonON5844055272e-58
YLL061W (MMP1)na 9ON5833905235e-58
TBLA0A051801.50ON6764505286e-58
AFR698C1.50ON6095075248e-58
TBLA0C012101.368ON6004405238e-58
NDAI0A056203.284ON5714505219e-58
Smik_12.2na 9ON5834055211e-57
Kwal_34.16254singletonOFF4814335151e-57
Ecym_26623.284ON5894975211e-57
Kwal_YGOB_34.162541.368ON4914335151e-57
Kpol_534.221.368ON5924435202e-57
KNAG0F002701.50ON6344575222e-57
YDR046C (BAP3)3.284ON6044345203e-57
TBLA0G031203.284ON6734385223e-57
TPHA0B047501.50ON6395935195e-57
KLLA0F27093gsingletonON5634075155e-57
Skud_2.1923.285ON6195095185e-57
Kwal_27.105383.284ON6024535176e-57
CAGL0D02178g1.368ON5774465158e-57
NCAS0B085801.50ON6275355161e-56
AGR038C3.284ON5804375141e-56
KAFR0D04130na 5ON6444685162e-56
CAGL0B01012g1.50ON6233945142e-56
CAGL0M00154gsingletonON5505025093e-56
Kpol_1052.143.285ON6025465114e-56
TPHA0A025001.368ON5904435097e-56
ZYRO0F17446g1.50ON6333885118e-56
YOL020W (TAT2)1.368ON5924565089e-56
Ecym_10561.50ON6065005081e-55
Smik_2.2023.285ON6174815081e-55
Suva_4.3083.285ON6184485072e-55
Suva_16.18na 10ON5833815052e-55
Kpol_2002.441.50ON6274995073e-55
ADL272Wna 11ON5644395023e-55
Skud_15.1381.368ON5924475044e-55
NCAS0A004201.50ON6795485084e-55
TDEL0F02830na 12ON5614515015e-55
TPHA0A039603.284ON6154385029e-55
NCAS0J00140na 13ON5585064999e-55
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E16281g
         (605 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...  1024   0.0  
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   637   0.0  
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   634   0.0  
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   633   0.0  
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   631   0.0  
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              624   0.0  
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   617   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   615   0.0  
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   616   0.0  
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   615   0.0  
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   612   0.0  
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   606   0.0  
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     601   0.0  
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   591   0.0  
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   580   0.0  
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   573   0.0  
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   572   0.0  
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             568   0.0  
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             554   0.0  
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   312   8e-99
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            311   2e-98
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   302   2e-94
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   297   4e-92
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   296   4e-92
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   294   2e-91
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   293   6e-91
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   291   2e-90
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   292   2e-90
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   290   5e-90
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   290   6e-90
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   291   7e-90
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   290   7e-90
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   291   8e-90
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   288   2e-89
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   288   4e-89
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   289   4e-89
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   288   5e-89
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   288   9e-89
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   287   2e-88
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   288   2e-88
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   286   2e-88
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   285   2e-88
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   287   3e-88
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   286   3e-88
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   285   1e-87
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   285   1e-87
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   284   3e-87
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   285   3e-87
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   283   3e-87
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   283   3e-87
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            284   4e-87
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   282   8e-87
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                283   8e-87
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   282   9e-87
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   283   1e-86
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   281   2e-86
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   281   3e-86
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   281   3e-86
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   281   7e-86
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   280   2e-85
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            278   2e-85
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   278   3e-85
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   278   3e-85
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   279   3e-85
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   277   9e-85
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   275   1e-84
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   278   1e-84
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   276   1e-84
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   276   3e-84
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              275   9e-84
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   275   1e-83
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   275   2e-83
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   273   3e-83
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   273   3e-83
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              271   2e-82
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            270   2e-82
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   270   5e-82
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   269   5e-82
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   270   7e-82
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   268   9e-82
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   270   1e-81
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            268   2e-81
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   270   2e-81
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   268   3e-81
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   268   1e-80
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   266   2e-80
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   267   5e-80
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     266   5e-80
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   263   1e-79
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   260   1e-78
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   260   3e-78
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     260   5e-78
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   259   8e-78
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   256   3e-76
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   251   7e-76
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   248   6e-74
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   243   4e-72
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   241   5e-71
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   241   5e-71
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   239   1e-70
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   238   5e-70
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   238   1e-69
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   236   2e-69
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   237   2e-69
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   236   5e-69
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   235   6e-69
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   234   1e-68
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   233   3e-68
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   235   3e-68
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   234   3e-68
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                233   4e-68
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   234   4e-68
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   231   5e-67
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    230   5e-67
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   230   1e-66
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   229   1e-66
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   229   2e-66
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   229   2e-66
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   230   2e-66
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   229   2e-66
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   227   5e-66
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   227   8e-66
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   227   1e-65
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   226   1e-65
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   227   1e-65
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   226   2e-65
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   226   2e-65
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   226   3e-65
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   226   4e-65
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   225   5e-65
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      225   6e-65
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   225   6e-65
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   225   7e-65
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   225   9e-65
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   224   9e-65
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   223   1e-64
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   225   2e-64
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   224   2e-64
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              223   2e-64
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              224   3e-64
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   223   3e-64
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   224   3e-64
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   223   4e-64
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   223   4e-64
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   223   4e-64
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   223   5e-64
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   222   7e-64
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   222   7e-64
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   222   1e-63
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   222   1e-63
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   221   1e-63
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   223   1e-63
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      222   1e-63
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   221   1e-63
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   221   1e-63
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   220   5e-63
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   219   7e-63
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   219   7e-63
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   219   8e-63
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   220   9e-63
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   219   1e-62
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   218   1e-62
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   219   2e-62
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                218   2e-62
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   219   2e-62
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   218   3e-62
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   217   4e-62
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   217   4e-62
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   217   4e-62
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   218   5e-62
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   217   5e-62
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    217   5e-62
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   217   6e-62
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   217   9e-62
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   217   9e-62
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   216   9e-62
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   216   1e-61
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   217   1e-61
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   216   2e-61
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   215   2e-61
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   216   3e-61
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   214   4e-61
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   214   4e-61
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   214   6e-61
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   215   8e-61
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   213   1e-60
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   214   1e-60
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   212   2e-60
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   213   2e-60
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              213   4e-60
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   212   4e-60
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   213   4e-60
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   212   4e-60
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   211   4e-60
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   212   5e-60
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   211   7e-60
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   211   7e-60
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   211   8e-60
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   211   1e-59
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   210   1e-59
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   210   2e-59
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   210   2e-59
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   210   2e-59
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   211   2e-59
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   209   3e-59
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   210   3e-59
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   209   3e-59
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   207   6e-59
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   209   7e-59
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   206   1e-58
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   207   1e-58
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   207   2e-58
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   206   5e-58
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   207   6e-58
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   206   8e-58
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   206   8e-58
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            205   9e-58
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    205   1e-57
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   202   1e-57
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   205   1e-57
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   202   1e-57
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   204   2e-57
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   205   2e-57
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   204   3e-57
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              205   3e-57
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   204   5e-57
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   202   5e-57
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   204   5e-57
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   203   6e-57
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   202   8e-57
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   203   1e-56
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   202   1e-56
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              203   2e-56
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   202   2e-56
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   200   3e-56
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   201   4e-56
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   200   7e-56
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   201   8e-56
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   200   9e-56
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   200   1e-55
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   200   1e-55
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   199   2e-55
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   199   2e-55
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   199   3e-55
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   197   3e-55
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   198   4e-55
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   200   4e-55
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   197   5e-55
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              197   9e-55
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      196   9e-55
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   197   1e-54
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      196   2e-54
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   196   2e-54
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    194   3e-54
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   196   3e-54
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   196   3e-54
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   196   5e-54
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   195   7e-54
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   192   8e-54
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   194   1e-53
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   193   2e-53
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   193   2e-53
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   193   3e-53
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   192   3e-53
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   193   3e-53
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   192   4e-53
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   192   5e-53
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   191   1e-52
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   191   1e-52
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   191   2e-52
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   190   2e-52
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   190   3e-52
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   189   3e-52
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   188   7e-52
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   188   8e-52
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                189   9e-52
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              188   1e-51
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   187   5e-51
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   186   1e-50
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   186   1e-50
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   185   2e-50
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   185   2e-50
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              184   3e-50
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   185   3e-50
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   184   4e-50
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   184   5e-50
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   184   5e-50
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   183   6e-50
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              182   1e-49
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   186   1e-49
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   182   2e-49
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   182   2e-49
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   182   2e-49
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   182   3e-49
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                182   3e-49
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   181   3e-49
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   185   4e-49
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      181   7e-49
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   181   7e-49
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   182   2e-48
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   179   2e-48
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   179   2e-48
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   179   3e-48
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   179   4e-48
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   177   1e-47
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   176   2e-47
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   176   4e-47
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   175   7e-47
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   177   8e-47
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   174   1e-46
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   177   2e-46
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   176   3e-46
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   171   2e-45
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   174   2e-45
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   171   2e-45
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   171   3e-45
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   173   3e-45
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   170   3e-45
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   173   4e-45
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   171   2e-44
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   169   9e-44
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   166   1e-43
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   168   2e-43
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              164   5e-43
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   166   6e-43
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   164   3e-42
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   163   5e-42
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   163   6e-42
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   161   3e-41
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     147   7e-39
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     147   8e-39
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   154   1e-38
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   150   3e-37
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   147   3e-37
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   145   9e-37
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   148   1e-36
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   134   5e-33
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         113   6e-27
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   110   1e-26
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     84   8e-17
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      81   4e-16
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          78   1e-15
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    70   2e-13
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      66   2e-12
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          61   3e-10
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    55   6e-08
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    45   3e-04
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      39   0.008
TBLA0G00720 Chr7 complement(163147..164988) [1842 bp, 613 aa] {O...    37   0.17 
ZYRO0A08844g Chr1 (704383..705783) [1401 bp, 466 aa] {ON} highly...    37   0.20 

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score = 1024 bits (2647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/605 (85%), Positives = 516/605 (85%)

Query: 1   MAEKVYLDAQLSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDV 60
           MAEKVYLDAQLSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDV
Sbjct: 1   MAEKVYLDAQLSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDV 60

Query: 61  KNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
           KNVVTHTSEFDGKHDGIRLKKALEARHVSM                              
Sbjct: 61  KNVVTHTSEFDGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIA 120

Query: 121 XXFVGLLVFFVMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLT 180
             FVGLLVFFVMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLT
Sbjct: 121 YAFVGLLVFFVMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLT 180

Query: 181 AGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXX 240
           AGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVM      
Sbjct: 181 AGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIIL 240

Query: 241 XXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELC 300
                    PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELC
Sbjct: 241 LLVLACGGGPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELC 300

Query: 301 GIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXX 360
           GIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLI            
Sbjct: 301 GIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASAS 360

Query: 361 PFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQ 420
           PFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQ
Sbjct: 361 PFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQ 420

Query: 421 GVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRV 480
           GVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRV
Sbjct: 421 GVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRV 480

Query: 481 QGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXX 540
           QGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF            
Sbjct: 481 QGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYII 540

Query: 541 XXXXXKLWYKTKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLAAHGKDLKWCYEKI 600
                KLWYKTKIIPSEEVDLVSFKEAV             RAAHLAAHGKDLKWCYEKI
Sbjct: 541 SYIGYKLWYKTKIIPSEEVDLVSFKEAVDLEEEEGKMLDEERAAHLAAHGKDLKWCYEKI 600

Query: 601 FGWVM 605
           FGWVM
Sbjct: 601 FGWVM 605

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/534 (59%), Positives = 379/534 (70%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DGKH+GIRLKKALEARHVSM                                FVGLLV+ 
Sbjct: 43  DGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT 102

Query: 131 VMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190
           VM+CLGEMAA+IPLDGFTSY++RY DPALGFAVGY YLFKY+I+ PNQLTAGA+V+QYWV
Sbjct: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162

Query: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXP 250
            R+KVNPGVWITI LV I+ IN +GVRFFGE E+++S+VK+ VM               P
Sbjct: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 222

Query: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310
           NH+  GF+YW++PGAFK YS AI+G+KG+FVSFASVF LALFAY GTELCGIV +E KNP
Sbjct: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNP 282

Query: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAG 370
           R++VP+AIKLT+YRI++FY+ISI LLGM V +NDPLLI            PFVVAI NAG
Sbjct: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAG 342

Query: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430
           IPVLPHI NAC+L+FVFSA NSDLYVASR+LYGLAID KAP+IFAKTN  GVPY+SL V 
Sbjct: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402

Query: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490
           VLF LLAYMNVSSGS+++F YFVN VSIFGLLSWISILITY+RF KA   Q  DKS  +Y
Sbjct: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462

Query: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK 550
            +P QP+  W SLFFC LIGLIKN+  FLG TFDYK+F                 KL ++
Sbjct: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522

Query: 551 TKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLAAHGKDLKWCYEKIFGWV 604
           +K+I  E+VDL +FK A+             R   L +  K+L W Y+   GW+
Sbjct: 523 SKLIKPEDVDLYTFKAAIDAEEEEGKLLELERKEQLKSSPKNLTWFYDTFLGWI 576

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/593 (54%), Positives = 399/593 (67%), Gaps = 22/593 (3%)

Query: 10  QLSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSE 69
           QL + +    I++++L  DD   +ER+            +   +S   +D  N+      
Sbjct: 21  QLPKKEFKLPIQEEELINDD---LERN------------ISSASSQDENDSYNI------ 59

Query: 70  FDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVF 129
            DGK +G RLKKAL+ARHVSM                                FVGLLVF
Sbjct: 60  -DGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVF 118

Query: 130 FVMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
           F M+CLGEMA YIPLDGFTSY++RY DPALGFAVGYAYLFKY+I+ PNQLTA ALVIQYW
Sbjct: 119 FTMACLGEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYW 178

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
           VD++KVNPGVW+TI LV I++IN  GVRFFGE E+++S+ K+ VM               
Sbjct: 179 VDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGG 238

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
           P+H+ LGF+YW++PG+FKEYS  ITG  GRFV+F SVFV A +AYLG EL GIV +E +N
Sbjct: 239 PDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQN 298

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           PRK++PKAIKLTMYRI++FYLISIFLLGMCV ++DPLLI            PFVVAI+N+
Sbjct: 299 PRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINS 358

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
           GI  LPHI+NAC+L+FVFSA NSDLYV+SRSLY LAIDNKAP+IFAKTN+ G+PY++L V
Sbjct: 359 GINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSV 418

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
            VLF LLAYM VSS S+++F YFVN VSIFG+LSWISILITYI FD+A R QG+DKST A
Sbjct: 419 SVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFA 478

Query: 490 YQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWY 549
           Y +P QPYGAWFSLFFC LI LIKNF  FL   FDYK+F                 K  Y
Sbjct: 479 YVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTY 538

Query: 550 KTKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLAAHGKDLKWCYEKIFG 602
           KTK+I   +VDL +FK A+             +A  +  +GK+ +W Y+K  G
Sbjct: 539 KTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLG 591

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/572 (56%), Positives = 392/572 (68%), Gaps = 9/572 (1%)

Query: 42  DGQSDSKVHGITSGHGSDVKNVVTHTSE---------FDGKHDGIRLKKALEARHVSMXX 92
           D   + K  G+   + +  + +VT  SE          DGKH+GIRLKK LEARHVSM  
Sbjct: 4   DTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIA 63

Query: 93  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPLDGFTSYST 152
                                         FVGLLV+ VMSCLGEMAA+IPLDGFTSY++
Sbjct: 64  IGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYAS 123

Query: 153 RYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITIN 212
           RY DPA+GFAVGY+YLFKY+I+ PNQLTAGA+V+Q+WV RD+VNPGVWITI L  I+ IN
Sbjct: 124 RYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLIN 183

Query: 213 FLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTA 272
            +GVRFFGE E+++S+VK+ VM               PNH+  GF++W++PGAFK YS A
Sbjct: 184 TVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEA 243

Query: 273 ITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLIS 332
           I+G+KG+FVSFASVF LALFAY GTELCGIV +E KNPR++VP+AIKLT+YRI+VFY+I+
Sbjct: 244 ISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVIT 303

Query: 333 IFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANS 392
           I LLGM V +NDP L+            PFVVAI NA IPVLPHI N C+L+FVFSA NS
Sbjct: 304 ILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNS 363

Query: 393 DLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYF 452
           DLYVASRSLYGLAID KAPRIFA TNK GVPY+SL + VLF LLAYMNVSSGS++VF YF
Sbjct: 364 DLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYF 423

Query: 453 VNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLI 512
           VN VSIFGLLSWI+ILITYIRFDKA RVQ  DKS+L+Y +  QP+  + +LFFC LIGLI
Sbjct: 424 VNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLI 483

Query: 513 KNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTKIIPSEEVDLVSFKEAVXXXX 572
           KN+  FLG  FDYK+F                 K+ Y+TK+I  E+VDL +FK+A+    
Sbjct: 484 KNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAIDAEE 543

Query: 573 XXXXXXXXXRAAHLAAHGKDLKWCYEKIFGWV 604
                    R  ++    K+ KW YE   GW+
Sbjct: 544 EEYKLLEKERLENMENSPKNFKWFYETFLGWI 575

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/560 (57%), Positives = 389/560 (69%), Gaps = 1/560 (0%)

Query: 45  SDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXX 104
           +   V  +   +  D+ +  +H +  DGKHDGIRLKK LEARHVSM              
Sbjct: 22  TSKDVENLDLSNQDDISSQESHLN-IDGKHDGIRLKKELEARHVSMIAIGGSLGTGLLIG 80

Query: 105 XXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVG 164
                             FVG LV+ VM+CLGEMA YIPLDGFTSY++RY DPALGFAVG
Sbjct: 81  TGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYASRYCDPALGFAVG 140

Query: 165 YAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEY 224
           Y+YLFKY II PNQLTA ALV+QYWV R+KVNPGVWITI LV I+TIN +GV+FFGE E+
Sbjct: 141 YSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINVVGVKFFGEFEF 200

Query: 225 YISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFA 284
           ++S+ K+ VM               P+H+ LGF+++K+PGAF+ YS AI+G+KG+FVSF 
Sbjct: 201 WLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFV 260

Query: 285 SVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFND 344
           +VFV ALFAYLGTELCGIV +ECKNPR+ VP+AIKLT+YRI+VFYL++IFLLGM V +ND
Sbjct: 261 AVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYND 320

Query: 345 PLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGL 404
           PLL+            PFVVAI NAGIPVLPHI NAC+L+FVFSA NSDLYVASRSLYGL
Sbjct: 321 PLLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGL 380

Query: 405 AIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSW 464
           AIDNKAP+IFAKTNK GVPY SL++ +LF LLAYMNVSSGS++VF YFVN VSIFGL+SW
Sbjct: 381 AIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSW 440

Query: 465 ISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFD 524
           I+ILITYI FD+A R QG+DKSTLAY +PL   GA+F+LFFC LI LIKNF  FLG  FD
Sbjct: 441 IAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFD 500

Query: 525 YKSFXXXXXXXXXXXXXXXXXKLWYKTKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAA 584
           YK+F                 K    TK +  EE DL +FKE +             +  
Sbjct: 501 YKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKE 560

Query: 585 HLAAHGKDLKWCYEKIFGWV 604
            + +  K+ KW YEK  GW+
Sbjct: 561 KMESSPKNFKWFYEKFLGWI 580

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/585 (55%), Positives = 390/585 (66%), Gaps = 7/585 (1%)

Query: 15  DTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKH 74
           D  E+    Q   D      +  +L +D   ++     ++   +D  NV       DGK 
Sbjct: 14  DRYEEYFDPQKKVDSKTFPTQERELLHDDLENNISLSTSAEDQNDSYNV-------DGKT 66

Query: 75  DGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSC 134
           +G RLKK LE R VSM                                FVGLLVFF M+ 
Sbjct: 67  EGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMAS 126

Query: 135 LGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDK 194
           LGEMA+YIPLDGFTSY+TRYADPALGFAVGY YLFKY+I+ PNQLTA ALVIQYW+ R+K
Sbjct: 127 LGEMASYIPLDGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPREK 186

Query: 195 VNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEV 254
           VNPGVWITI LV I+ IN LGV+FFGE E+++S+ K+ VM               PNH+ 
Sbjct: 187 VNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNHDR 246

Query: 255 LGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAV 314
           LGF++WK+PGAF  YS AITG  G+FV+F SVFV A FAYLGTEL GIVV E +NPRK+V
Sbjct: 247 LGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSV 306

Query: 315 PKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVL 374
           PKAIKLTMYRII+FYLISI LLGMCV ++DPLL+            PFVVAIVN+GI VL
Sbjct: 307 PKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVL 366

Query: 375 PHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFA 434
           PHI NAC+L+FVFSA NSDLYVASRSLY LAIDNKAP+IFA+TN+ G+PY+SL + VLF 
Sbjct: 367 PHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFC 426

Query: 435 LLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPL 494
           LLAYM+VSSGS+++F YFVN VSIFGLLSWI IL+TY+ FD+A R QGIDKST +Y +P 
Sbjct: 427 LLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPG 486

Query: 495 QPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTKII 554
           Q YGA+F+LFFC LI LIKNF  FLG  FDYK+F                 KL YKTKII
Sbjct: 487 QRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGYKLIYKTKII 546

Query: 555 PSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLAAHGKDLKWCYEK 599
              EVDL +FK A+             R   + A+G++ +W Y+K
Sbjct: 547 DPLEVDLYTFKAAIDQEEEDGKLEDIARKERIKANGRNFEWFYDK 591

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/537 (57%), Positives = 368/537 (68%), Gaps = 2/537 (0%)

Query: 70  FDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVF 129
           +DGKH GIRLKK L+ARHVSM                                 +G +VF
Sbjct: 49  YDGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVF 108

Query: 130 FVMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
            VMSCLGEMAAYIPLDGFTSY+TRYADPALGFAVGY YLFKY ++ PNQLTA ALV+QYW
Sbjct: 109 TVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
           V R KVNPGVWIT+ L  I+TIN +GV+FFGE E+++S+ K+ VM               
Sbjct: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGG 228

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAIT--GAKGRFVSFASVFVLALFAYLGTELCGIVVSEC 307
           P+H  LGF+YWK+PG FK YS A++  G KG+FVSFASVFV ALFAYLGTELCGIV +EC
Sbjct: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288

Query: 308 KNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIV 367
           KNPR+ VP+AIKLT+YRI+VFYL ++FLLG+ V +NDPLL+            P+VVAI 
Sbjct: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIK 348

Query: 368 NAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSL 427
           NAGIPVLPHI NAC+L FVFSA NSDLYV SRSLYGLAID KAP+IFAKTN  GVPY SL
Sbjct: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408

Query: 428 LVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKST 487
            +  LF  LAYMNVSS +  +F+YFVN  SIFGLLSWISILITYI FD+AFRVQGIDK+T
Sbjct: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468

Query: 488 LAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKL 547
           L+YQ+P QP  AW +L FC+++ L+KNF  FLGDTFDYK+F                 K+
Sbjct: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528

Query: 548 WYKTKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLAAHGKDLKWCYEKIFGWV 604
            +KTK I S  VDL ++K A+                    HG   K  Y+ IFGW+
Sbjct: 529 VHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWI 585

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/534 (57%), Positives = 371/534 (69%), Gaps = 1/534 (0%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DGK DG+RLKK L+ARH+SM                                FVG+LVFF
Sbjct: 42  DGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFF 101

Query: 131 VMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190
           VM+CLGEMA YIPLDGFTSY+TRY DPALGFAVGY YLFKY+II PNQLTAGALVIQYW+
Sbjct: 102 VMACLGEMATYIPLDGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWI 161

Query: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXP 250
           DR+ VNPGVWITI LV I+ IN +GVR+FGE E+++S+ KI VM               P
Sbjct: 162 DRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGP 221

Query: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310
           NH+ LGF+YWKNPGAFK YS +ITG+KG+FVSF +VFV ALFAYLG EL GIV +E +NP
Sbjct: 222 NHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENP 281

Query: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAG 370
           R+ +P+AIKLTMYRII+FY+++IFLLGMCV +NDP L+            PFVVAI N+G
Sbjct: 282 RRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSG 341

Query: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430
           +  LPHI N C+LIFVFSA NSDLYV +RSLY LAID KAP++FAKTN+ GVPY +L   
Sbjct: 342 VRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGC 401

Query: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490
            LF LLAYMNVSSGS+++F YFVN VSIFG+LSWISILITYI F +A   Q +D+++ AY
Sbjct: 402 FLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAY 461

Query: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK 550
           ++P QPYGA+ +LFFC+LI  IKNF  F+G+ FDYKSF                 K+ YK
Sbjct: 462 RAPFQPYGAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYK 520

Query: 551 TKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLAAHGKDLKWCYEKIFGWV 604
           TK++ +EE DL SFKEA+                 L    K LKW YEK  G++
Sbjct: 521 TKLVKAEEADLYSFKEAIDREEAEGKIKEAEAKERLKNSKKSLKWFYEKYLGYI 574

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/532 (57%), Positives = 373/532 (70%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DGK +  RL+K L+ARH+SM                                FVGLLVFF
Sbjct: 72  DGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFF 131

Query: 131 VMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190
            M+CLGEMA+YIPLDGFTSY++RY DPALGFA+GY YLFKY+I+ PNQLTA ALVIQYWV
Sbjct: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 191

Query: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXP 250
            RD+VNPGVWITI LV I+ IN +GVRFFGE E+++S+ K+ VM               P
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310
           +H+ LGF+YW++PGAFKEYSTAITG+KG+FV+FASVFV +LF+Y G EL GIV SE KNP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNP 311

Query: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAG 370
           RK+VPKAIKLT+YRIIVFYL ++FLLGMCV +NDP L+            PFVVAI N+G
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSG 371

Query: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430
           I VLPHI N C+L+FVFSA NSDLYV+SR+LY LAID KAP+IFAKT+K GVPY++L+V 
Sbjct: 372 IKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVS 431

Query: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490
           VLF  LAYMNVS+GS+++F YFVN VS+FG+LSWI+ILI YI FD+A R QG+DKS  AY
Sbjct: 432 VLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAY 491

Query: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK 550
            +P Q YGA+F+LFFCILI LIKNF  FLG TFDYK+F                 KL YK
Sbjct: 492 VAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYK 551

Query: 551 TKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLAAHGKDLKWCYEKIFG 602
           TK++   + DL + KE               +   L  +GK+L+W YEK  G
Sbjct: 552 TKVVKPADADLYTLKEIYDREEEQGKLQDQEKEERLQRNGKNLEWFYEKFLG 603

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/532 (57%), Positives = 374/532 (70%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DGK +  RL+K L+ARH+SM                                FVGLLVF+
Sbjct: 74  DGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFY 133

Query: 131 VMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190
            M+CLGEMA+YIPLDGFTSY++RY DPALGFA+GY YLFKY+I+ PNQLTA ALVIQYW+
Sbjct: 134 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193

Query: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXP 250
            RD+VNPGVWITI LV I+ IN +GV+FFGE E+++S+ K+ VM               P
Sbjct: 194 SRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 253

Query: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310
           NH+ LGF+YW++PGAFKEYSTAITG KG+FVSF +VFV +LF+Y G EL GIV SE +NP
Sbjct: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313

Query: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAG 370
           RK+VPKAIKLT+YRIIVFYL ++FLLGMCV +NDP L+            PFVVAI N+G
Sbjct: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373

Query: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430
           I VLPHI NAC+L+FVFSA NSDLYV+SR+LY LAID KAP+IFAKT++ GVPY +L++ 
Sbjct: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433

Query: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490
           VLF  LAYMNVSSGS+++F YFVN VS+FG+LSWI+ILI YI FDKA R QGIDKS  AY
Sbjct: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493

Query: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK 550
            +P Q YGA+F+LFFCILI LIKNF  FLG  FDYK+F                 KL YK
Sbjct: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553

Query: 551 TKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLAAHGKDLKWCYEKIFG 602
           TK+I S +VDL +FKE               +   L ++GK+++W YEK  G
Sbjct: 554 TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLG 605

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/534 (57%), Positives = 372/534 (69%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DGK +  RLKK L+ARH+SM                                FVGLLVFF
Sbjct: 72  DGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFF 131

Query: 131 VMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190
            M+CLGEMA+YIPLDGFTSY++RY DPALGFA+GY YLFKY+I+ PNQLTA ALVIQYW+
Sbjct: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191

Query: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXP 250
            RD+VNPGVWITI LV I+ IN +GV+FFGE E+++S+ K+ VM               P
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310
           +H+ LGF+YW++PGAFKEYSTAITG+ G+F SF +VFV +LF+Y G EL GIV SE +NP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311

Query: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAG 370
           RK+VPKAIKLT+YRIIVFYL ++FLLGMCV +NDP L+            PFVVAI N+G
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371

Query: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430
           I VLPHI NAC+L+FVFSA NSDLYV+SR+LY LAID KAP+IFAKT+K GVPY +L++ 
Sbjct: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431

Query: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490
           VLF  LAYMNVSSGS+++F YFVN VS+FG+LSWI+ILI YI FDKA R QGIDKS  AY
Sbjct: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491

Query: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK 550
            +P Q YGA+F+L FCILI LIKNF  FLG  FDYK+F                 KL YK
Sbjct: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551

Query: 551 TKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLAAHGKDLKWCYEKIFGWV 604
           TK+I S +VDL +FKE               R   L  +GK+++W YEK  G +
Sbjct: 552 TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRI 605

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/598 (53%), Positives = 393/598 (65%), Gaps = 16/598 (2%)

Query: 8   DAQLSRVDTDE-DIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTH 66
           DA  S+ + D   +++Q+++   NI +E       +    S+    TS    D    V  
Sbjct: 24  DAYYSKQNPDSFPVKEQEIY---NIDLE-------ENNVSSRSSTFTSPSARDDSFAVP- 72

Query: 67  TSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGL 126
               DGK +  RL+K L+ARH+SM                                FVGL
Sbjct: 73  ----DGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGL 128

Query: 127 LVFFVMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVI 186
           LVFF M+CLGEMA+YIPLDGFTSY++RY DPALGFA+GY YLFKY+I+ PNQLTA ALVI
Sbjct: 129 LVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVI 188

Query: 187 QYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXX 246
           QYWV RD+VNPGVWITI +V I+ IN +GV+FFGE E+++S+ K+ VM            
Sbjct: 189 QYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIML 248

Query: 247 XXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSE 306
              P+H+ LGF+YW++PGAFKEYS AI G KG+FVSF +VFV +LF+Y G EL GIV SE
Sbjct: 249 GGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSE 308

Query: 307 CKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAI 366
            +NPRK+VPKAIKLT+YRIIVFYL ++FLLGMCV +NDP LI            PFVVAI
Sbjct: 309 AQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAI 368

Query: 367 VNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWS 426
            N+GI VLPHI NAC+L+FVFSA NSDLYV+SR+LY LAID KAP+IF+KTNK GVPY +
Sbjct: 369 QNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNA 428

Query: 427 LLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKS 486
           L+  VLF  LAYMNVS+GS+++F YFVN VS+FG+LSWI+ILI YI FDKA R QGIDKS
Sbjct: 429 LIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKS 488

Query: 487 TLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXK 546
             AY +P Q YGA+F+L FCI I LIKNF  FLG  FDYK+F                 K
Sbjct: 489 KFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYK 548

Query: 547 LWYKTKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLAAHGKDLKWCYEKIFGWV 604
           L YKTK+I S +VDL +FKE               +   L  +GK+++W YEK  G +
Sbjct: 549 LIYKTKVIKSTDVDLYTFKEIYDREEEQGKIEDQEKEERLKKNGKNMEWFYEKFLGHI 606

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/532 (56%), Positives = 366/532 (68%), Gaps = 3/532 (0%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DGK DG RLKK L+ARH+SM                                FVG LVFF
Sbjct: 74  DGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFF 133

Query: 131 VMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190
            M+ LGEMAAYIPLDGFTSY++RY DPALGFAVGY+YLFKY+II PNQLTA ALVIQYWV
Sbjct: 134 TMAALGEMAAYIPLDGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWV 193

Query: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXP 250
           DRD VNPGVWITI LV II IN +GV++FGE E+++S+ KI VM               P
Sbjct: 194 DRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGP 253

Query: 251 NHEVLGFKYWKNPGAFKEYSTA---ITGAKGRFVSFASVFVLALFAYLGTELCGIVVSEC 307
           NH+ LGF+YWK PGAFK YS++   I G+ G+FV+F +VFV ALFAYLG EL GIV +E 
Sbjct: 254 NHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEA 313

Query: 308 KNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIV 367
           +NPR+ +P+AIKLT++RI+ FY+ +IFLLGMCV ++DPLL+            PFVVAI 
Sbjct: 314 ENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQ 373

Query: 368 NAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSL 427
           N+G+ VLPHI N C+L+FVFSA NSDLYV +RSLY LA+D KAP+IFAKTN+ GVPY ++
Sbjct: 374 NSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAM 433

Query: 428 LVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKST 487
              VLF LLAYMNVSSGS+E+F YFVN VSIFG+LSW SILIT+I FD+A R QGID+ST
Sbjct: 434 GGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRST 493

Query: 488 LAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKL 547
            AY +P QPYG++F+LFFC+L+ LIKNF  FLG+ FDYK+F                 KL
Sbjct: 494 FAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKL 553

Query: 548 WYKTKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLAAHGKDLKWCYEK 599
           +YKTK +   E DL S+K AV             R   L    KDL+W YEK
Sbjct: 554 YYKTKTVKPHEADLNSYKAAVDREEEEGKIKEAERKERLKHGKKDLEWFYEK 605

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/558 (53%), Positives = 368/558 (65%), Gaps = 3/558 (0%)

Query: 50  HGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXX 109
            G+   H S  +   +    +DGKH+GIRLKK L+ARHVSM                   
Sbjct: 30  RGLRHTHSSTDQEAQSVDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSL 89

Query: 110 XXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLF 169
                         +G +VF VMSCLGEMAAYIPLDGFTSY+TRYADPALGFAVG+AYLF
Sbjct: 90  MRAGPGSILIAYSIMGWVVFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGWAYLF 149

Query: 170 KYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAV 229
           KY ++ PNQLTAGALVIQ+W+   +V+PGVWIT++L  I+ IN +GVRFFGE E+++S+ 
Sbjct: 150 KYLVLTPNQLTAGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSF 209

Query: 230 KITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYS---TAITGAKGRFVSFASV 286
           K+ VM               P H+ LGF+YW +PGAFKEYS   T I G  G+FV+F SV
Sbjct: 210 KVLVMLCVMILLLVLALGGGPTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSV 269

Query: 287 FVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPL 346
           FV ALFAYLGTELCGIV +ECK+PR+ VP+AIKLT+YRI+VFYL++IFLLGMCV +NDPL
Sbjct: 270 FVYALFAYLGTELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPL 329

Query: 347 LIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAI 406
           L+            P+VVAI NA IPVLP++ NAC+L FVFSA NSDLYV SRSLYGLAI
Sbjct: 330 LMQASSAEVSAAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAI 389

Query: 407 DNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWIS 466
           D KAP++FA+TNK GVPY +L    LF  LAYM+VS  +   F YFVN  SIFGL+SW+S
Sbjct: 390 DGKAPKLFARTNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVS 449

Query: 467 ILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYK 526
           ILITYI FD+AFR QGI KSTL+Y +P QPY  W +L FCI + LIKNF AF+G   D  
Sbjct: 450 ILITYICFDRAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVP 509

Query: 527 SFXXXXXXXXXXXXXXXXXKLWYKTKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHL 586
           +F                 K+ +KTK IPS+EVDL +FKEA+                 L
Sbjct: 510 TFITGYIGLPIYIFCFIGYKIVHKTKWIPSKEVDLFTFKEAIDLEEEECIRERALMKEQL 569

Query: 587 AAHGKDLKWCYEKIFGWV 604
           A  G   K  Y+ + GW+
Sbjct: 570 AKGGLSWKKIYDNVLGWI 587

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/533 (55%), Positives = 362/533 (67%), Gaps = 1/533 (0%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DGK +  RL+K L+ARH+SM                                FVG+LVFF
Sbjct: 78  DGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFF 137

Query: 131 VMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190
            M+ LGEMA+YIPLDGFTSY++RY DPALGFAVGYAYL KY I+ PNQLTA ALVIQYW+
Sbjct: 138 TMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197

Query: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXP 250
           DR++VNPGVWITI LV I+ +NF+GV+FFGE E+++S  K+ VM               P
Sbjct: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257

Query: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310
            H+ LGF+++ +PGAFK YS +I G+KG+FV+F +V V ALFAYLG EL GIV +E  NP
Sbjct: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAANP 317

Query: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAG 370
           RK++PKAIKLTMYRIIVFYL++IFLLGMCV ++DPLL             P+VVAI+N+G
Sbjct: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSG 377

Query: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430
           I  LPHI NAC+L+FVFSA NSDLYVASR+LYGLAIDNKAP+IFA TN+ GVPY+SLL+ 
Sbjct: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437

Query: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490
             F LLAYM+VSSGS+++F YFVN VSIFGLLSWISILITY+ F +A + Q +D+S  AY
Sbjct: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497

Query: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK 550
           ++P QPYG++F+L FCILI  IKNF  FL   FDYK+F                 K   K
Sbjct: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557

Query: 551 TKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLA-AHGKDLKWCYEKIFG 602
           TKI   EEVDL +FK A+             R   L  +  K   W YEK+ G
Sbjct: 558 TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVLG 610

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/535 (54%), Positives = 352/535 (65%), Gaps = 3/535 (0%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DGK +G RLKK L+ARHVSM                                FVG+LVFF
Sbjct: 56  DGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFF 115

Query: 131 VMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190
            MSCLGEMAA+IPLDGFTSY++RY DPALGFAVGY+YL KY I+  NQLTAGA+V+QYWV
Sbjct: 116 TMSCLGEMAAFIPLDGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWV 175

Query: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXP 250
           DRD +NPGV+ITI L+ I+TIN  GV+ FGE E+++S+ K+ VM               P
Sbjct: 176 DRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGP 235

Query: 251 NHEVLGFKYWKNPGAFKEYSTAITGA---KGRFVSFASVFVLALFAYLGTELCGIVVSEC 307
           NH+ LGF+YW++PG+FK YS++I       G+FVSF S FV ALF YLG EL GIV +E 
Sbjct: 236 NHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEA 295

Query: 308 KNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIV 367
           +NPRK +PKAIKLTMYRII+FY+I+I LL MCV +NDPLL+            PFVVAI 
Sbjct: 296 QNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIE 355

Query: 368 NAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSL 427
           N+GI +LPHI N C+L FV SAANSDLYVASRSLY LAIDNKAP+ F KTNK G+PYWSL
Sbjct: 356 NSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSL 415

Query: 428 LVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKST 487
                F+ LAYMNVSS +S VF YFVN VSIFG++SWI IL+TYI FDKA + QG+DKS 
Sbjct: 416 AFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSN 475

Query: 488 LAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKL 547
             Y +P QPYGA+F+LFFC ++ L+KNF  FLG  FDYK+F                 K+
Sbjct: 476 FTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKI 535

Query: 548 WYKTKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLAAHGKDLKWCYEKIFG 602
            YKTK    EEVDLV+ K  +             R   L    KD  W Y++  G
Sbjct: 536 VYKTKTHRPEEVDLVTLKALIDQEEEDGKIEDAEREERLKNGNKDWAWFYDRFLG 590

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/531 (55%), Positives = 355/531 (66%), Gaps = 3/531 (0%)

Query: 73  KH-DGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFV 131
           KH DG  LKK L+ARHVSM                                FVG+LVFF 
Sbjct: 94  KHTDG--LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFT 151

Query: 132 MSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVD 191
           M+ +GEMA+YIP+DGFTSY++RY DPALGFAVGY YLFKY I+ PNQLTA +LVIQYW+D
Sbjct: 152 MAAIGEMASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211

Query: 192 RDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPN 251
           RD VNPGVWITI LV I+ IN  GV+FFGE E+++S+ K+ VM               P+
Sbjct: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPD 271

Query: 252 HEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPR 311
           H+ LGF+YW++PGAFK YS AI G+ G+FV+F SVFV ALFAYLG EL GIV +E  NPR
Sbjct: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331

Query: 312 KAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGI 371
           K+VP+A+KLT++RI++FYL++IFLLGMCV +NDP L+            PFVVAI N+GI
Sbjct: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGI 391

Query: 372 PVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGV 431
            VLPHI NAC+LIFVFSA NSDLYV SRSLY LA+D KAP IF +T   G+P++SL V V
Sbjct: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451

Query: 432 LFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQ 491
           LFALLAYMNVSSGS++VF YFVN VSIFGLLSWI I ITYI F +A +VQG+D+S  AY 
Sbjct: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511

Query: 492 SPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKT 551
           +P QPYG +FSL +C+ I  IKNF  FLG +FDYK+F                 K   KT
Sbjct: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571

Query: 552 KIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLAAHGKDLKWCYEKIFG 602
           KI+ S EVDL + KE               +   L  +   L+W YEK  G
Sbjct: 572 KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLG 622

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/536 (58%), Positives = 367/536 (68%)

Query: 67  TSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGL 126
             +FDGK    RLKK L+ARHVSM                                FVG+
Sbjct: 50  NEQFDGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGV 109

Query: 127 LVFFVMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVI 186
           LVFFVMSC+GEMAAYIPLDGFTSY++RY DPALGFAVGYAYL KY+I+ PNQLTA ALVI
Sbjct: 110 LVFFVMSCIGEMAAYIPLDGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVI 169

Query: 187 QYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXX 246
           QYW+ R+KVNPGVWITI+LV I+ IN  GV+FFGE E+++S+ K+ VM            
Sbjct: 170 QYWIPREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIML 229

Query: 247 XXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSE 306
              P H+ LGF+YWK+PGAFKEYS +I G  GRFVSF S FV  LF YLG EL GIV +E
Sbjct: 230 GGTPTHDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAE 289

Query: 307 CKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAI 366
            +NPRK +PKAIKLTM+RII+FY+I+IFLLGMCV  NDPLL+            PFVVAI
Sbjct: 290 AENPRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAI 349

Query: 367 VNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWS 426
           VN+GI  LPHI NAC+L+FVFSA NSDLYVASR+LY LAIDNKAP+IFAKTN+ G+PY S
Sbjct: 350 VNSGIEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNS 409

Query: 427 LLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKS 486
           L V VLF LLAYM+VSSGS+++F YFVN VSI G+L+WISILITYI FD+A R QGIDKS
Sbjct: 410 LGVAVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKS 469

Query: 487 TLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXK 546
           T AY +PLQPYGA+FSLFFC L+ LIKNF  FL   FDY++F                 K
Sbjct: 470 TFAYVAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYK 529

Query: 547 LWYKTKIIPSEEVDLVSFKEAVXXXXXXXXXXXXXRAAHLAAHGKDLKWCYEKIFG 602
              KTKI   EEVDL SFK A+              A  +  +GK+ +W YE   G
Sbjct: 530 FVKKTKIRKPEEVDLFSFKAAIDQEEEDGRIKDAATAERIKKNGKNWEWFYETYLG 585

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/498 (56%), Positives = 346/498 (69%), Gaps = 3/498 (0%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DGK++GIRLKK L++RH+SM                                FVG++VFF
Sbjct: 57  DGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFF 116

Query: 131 VMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190
            M+CLGEMA +IPLDGFTSY++RY DPALGFAVGYAYL KY+I+ PNQLTA A+V+QYWV
Sbjct: 117 TMACLGEMATFIPLDGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWV 176

Query: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXP 250
            RD VNPG+W+T++   I  IN  GVRFFGE E+++S++K+ +M                
Sbjct: 177 PRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAG 236

Query: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310
           +H+ LGF+YWK+PGAF +YS  I+G+ G+FVSF +V VL +FAYLG EL GIV +E  NP
Sbjct: 237 SHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNP 296

Query: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAG 370
           R++VPKAIKLT YRI+VFY++SIFLLGMCVP+ND  L+            PF +AI+NAG
Sbjct: 297 RRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTAS--PFSIAILNAG 354

Query: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430
           I VLP I N C+LIFVFSAANSDLYVASR+LY LA+DNKAP+IFA TN+ G+PY SL V 
Sbjct: 355 ITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVS 414

Query: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490
            LF LLAYM VSS S++VF YFVN VSI GLL+WISILITYI FD+A R Q +DKST AY
Sbjct: 415 CLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAY 474

Query: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK 550
            +P QPYGA+ SLFFC LI +IKNF  FLG  FDYK+F                 K+  K
Sbjct: 475 VAPFQPYGAYVSLFFCCLIAIIKNFTVFLGH-FDYKTFITGYIGLPIFVLCYFGYKITCK 533

Query: 551 TKIIPSEEVDLVSFKEAV 568
           ++I  +  VDLVS K  V
Sbjct: 534 SEIRSARYVDLVSQKSLV 551

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  312 bits (799), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 168/446 (37%), Positives = 250/446 (56%), Gaps = 11/446 (2%)

Query: 123 FVGLLVFFVMSCLGEMAAYIPLD-GFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
           F G L+  V+  L EMA++ P+D GF+ Y  RY DPA GFA G+ Y  KY I++   LTA
Sbjct: 76  FTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTA 135

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
             LVI YW  R  VN GVW+T+L V +  +NFL V++FGEIE  ++  K+ V+       
Sbjct: 136 FGLVIGYW--RPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITC 193

Query: 242 XXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCG 301
                   PNH   GF+YW+  GA       + G  G+F+ + +  V ++F ++G+E+ G
Sbjct: 194 LIITCGGAPNHTTTGFRYWRESGALPYL---VGGGTGKFLGWWACVVQSIFGFMGSEMIG 250

Query: 302 IVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCV-PFNDPLLIXXXXXXXXXXXX 360
           IV  E  NP+K +PK+     +RI   Y+  +F+LG+ + P N  L+             
Sbjct: 251 IVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLV---HAHSTDANAS 307

Query: 361 PFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQ 420
           PFV+AI ++GI VLP+ +NA +L+F+ S+AN+D+Y+ SR LYGLA D  AP+IF   N+ 
Sbjct: 308 PFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRF 367

Query: 421 GVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRV 480
            VP    + G L   LAYMN    ++ VF+Y  + VS+FG+L+W  ILI YI +D+A + 
Sbjct: 368 KVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKA 427

Query: 481 QGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXX 540
           +GI    + ++   QPY A+ +LFF  +I     + AF+   F YK+F            
Sbjct: 428 KGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFI-IKFHYKTFITSYIGVFANIL 486

Query: 541 XXXXXKLWYKTKIIPSEEVDLVSFKE 566
                KL++KTK +   E+   +  E
Sbjct: 487 MVIGYKLYFKTKFVKPSEISFRTRNE 512

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  311 bits (796), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 166/440 (37%), Positives = 251/440 (57%), Gaps = 11/440 (2%)

Query: 123 FVGLLVFFVMSCLGEMAAYIPLD-GFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
           F G ++  V+  L EMAA+ P+D GF+ Y T+Y DPA GFA G+ Y  KY I++   LTA
Sbjct: 77  FTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSANLTA 136

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
             LVI YW  R  +N  VW+T+L      +NFL VR+FG++E +++  K+T++       
Sbjct: 137 FGLVIGYW--RPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIFIVC 194

Query: 242 XXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCG 301
                   P+H  +GF+YW+  G F  Y   + G  G+F+ + +  + ++F ++G+E+ G
Sbjct: 195 LVITCGGGPDHTTIGFRYWRESG-FLPY--LVKGNTGKFLGWWACVIQSIFGFMGSEMIG 251

Query: 302 IVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCV-PFNDPLLIXXXXXXXXXXXX 360
           I+  E  NPRK +PKA +  + RI VFY+  +F+LG+ V P N  L+             
Sbjct: 252 IIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLV---HAHSTDANAS 308

Query: 361 PFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQ 420
           PFV+AI  +GI VLP  +NA +L+F+ S+A +D+Y+ SR LYGLA D  AP+IF + NK 
Sbjct: 309 PFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLNKH 368

Query: 421 GVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRV 480
            +P    +VG L   LAYMN    ++ VF Y  + VS+FG+L+W  IL+ YI +D+  + 
Sbjct: 369 KIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVVKS 428

Query: 481 QGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXX 540
            G+    + ++ P QPY A+ +LFF  +I     + AF+   F+YK F            
Sbjct: 429 HGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFI-LKFNYKLFITSYIGIFANVL 487

Query: 541 XXXXXKLWYKTKIIPSEEVD 560
                KL+YKTK +  EE+ 
Sbjct: 488 LVLGYKLYYKTKWVKPEEIT 507

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  302 bits (774), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 163/449 (36%), Positives = 248/449 (55%), Gaps = 5/449 (1%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           +G      +K+AL+ RHVSM                                 +G L + 
Sbjct: 65  EGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYS 124

Query: 131 VMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
           V   LGEMA +IP+   FT +S R+  PA+G A GY Y F + I    +L+    +IQYW
Sbjct: 125 VTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW 184

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
            D   +    WI I  V +++ N   V+++GE E++++++K+  +               
Sbjct: 185 TDAVPLE--AWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAG 242

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
           P   + GF+YW+ PG +     A    K RF+ + S  + A F Y GTEL GI   E KN
Sbjct: 243 PEGPI-GFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKN 301

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           PRKAVP+AI    +RI++FY+ S+F +G+ VP+NDP L             PF++AI+N 
Sbjct: 302 PRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKL-EGSDNGSYIAQSPFLIAILNC 360

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
             PVLPHI NA IL  + SA NS++YV SR L+GL+ +N AP+ F+KT K GVP+ ++L+
Sbjct: 361 RTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLI 420

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
             +F  LAY+NVS+ + EVF + +N  +I G ++W+ I I++IRF +  + +GI +  L 
Sbjct: 421 TAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLP 480

Query: 490 YQSPLQPYGAWFSLFFCILIGLIKNFPAF 518
           Y++   PY A+++ FF  +I +I+ F AF
Sbjct: 481 YKAKFMPYAAYYAAFFITVIIIIQGFTAF 509

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  297 bits (761), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 187/558 (33%), Positives = 285/558 (51%), Gaps = 25/558 (4%)

Query: 10  QLSRVDTDE---DIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTH 66
           +LS   TDE   +++K++L  DD I    S  L  +    S++     G   +      H
Sbjct: 45  KLSSYCTDEKQYNMKKKRLLQDDAIA---SVNLITNSLPRSQIASHEVGDEEEDDEEEAH 101

Query: 67  TSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGL 126
              ++ KH    +K+AL+ RH+ M                                F+G 
Sbjct: 102 ---YEDKH----VKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGT 154

Query: 127 LVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALV 185
           +V+F+   LGEMA +IP+    T +S R+  PA G A GY Y F + I    +++    V
Sbjct: 155 VVYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQV 214

Query: 186 IQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXX 245
           IQYW D  KV   VWI I  V I  +NF  V+ +GE E+++++VK  V+           
Sbjct: 215 IQYWTD--KVPLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVK--VLAIMGYLIYALV 270

Query: 246 XXXXPNHE-VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVV 304
                +H+  +GF+YW+NPGA+     +    +GRF+ + S  + A F Y GTEL GI  
Sbjct: 271 IVCGGSHQGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITA 330

Query: 305 SECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVV 364
            E  NPRK VP+AI   ++RI++FY++S+F +G+ VP+N+P L             PFV+
Sbjct: 331 GEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASS---PFVI 387

Query: 365 AIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPY 424
           +I NAG   LP I NA +LI V SAANS++YV SR LY LA    AP+ F    KQGVPY
Sbjct: 388 SIQNAGTYALPDIFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPY 447

Query: 425 WSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGID 484
             +L      LLA++ V++ ++  F + +N  ++ GL +W+ I + +IRF +A   +GI 
Sbjct: 448 LGVLSTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGIS 507

Query: 485 KSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXX 544
           +  L +++ L PYGA+++ FF  +I  I+ F AF    F    F                
Sbjct: 508 RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFC--PFKVSDFFTSYISLILLAVVFTG 565

Query: 545 XKLWYKTKII-PSEEVDL 561
            +L+YK + I   E++D+
Sbjct: 566 CQLYYKCRFIWKLEDIDI 583

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  296 bits (757), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 185/556 (33%), Positives = 280/556 (50%), Gaps = 30/556 (5%)

Query: 13  RVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDG 72
            +  +  + KQ+  G   +   +S++  Y        H       SDV +        D 
Sbjct: 4   EIKKEASVSKQEFNGMKEV---KSNEETYRTS-----HSNLESQNSDVVS--------DY 47

Query: 73  KHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVM 132
           +H+   LKK L  RH+ +                                 +  +V+ +M
Sbjct: 48  EHN---LKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIM 104

Query: 133 SCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVD 191
             L EM  Y+P  G      TRY DP+LGFA G+ Y + Y ++V  +LTA A +++YW D
Sbjct: 105 CTLAEMVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTD 164

Query: 192 RDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPN 251
             +V  GVWITI L+ ++ +NF  VRF+GE E++ +++KI  +               PN
Sbjct: 165 --QVPQGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPN 222

Query: 252 HEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIVVSECKNP 310
           H+ +GF+YW+NPGAF  + T   G  GRF+   +  + + FA+ L  EL G+   E K+ 
Sbjct: 223 HDRVGFRYWRNPGAFGYHITG--GNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDT 280

Query: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFND-PLLIXXXXXXXXXXXXPFVVAIVNA 369
           R+ + KA +  +YRII FYL S  ++G+ V  ND  LL+            PFV  I N+
Sbjct: 281 RRNIEKASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANS 340

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
           GIPVL H++N  IL   +SA NS  Y +SRS+  L+    AP+IF+K N+ GVPY ++ +
Sbjct: 341 GIPVLNHVINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFL 400

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG-IDKSTL 488
             L A LAY+NVSS SS+VF +  N  +I G + W  I + YIRF KA      +D+  +
Sbjct: 401 CSLVACLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRLLDR--I 458

Query: 489 AYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLW 548
            Y+SPLQP+ A+F      +I L   +  F+   +DYK F                 K  
Sbjct: 459 PYRSPLQPFSAYFFTIVVAIITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTI 518

Query: 549 YKTK-IIPSEEVDLVS 563
           YKT+  IP +++D+++
Sbjct: 519 YKTRFCIPVDQIDVIT 534

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  294 bits (753), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 173/533 (32%), Positives = 272/533 (51%), Gaps = 25/533 (4%)

Query: 48  KVHGITSGHGSDVKNVVTHTSEFDGK-----------------HDGIRLKKALEARHVSM 90
           K H   S   S+  +V+ H  E   +                 +D   +K+ L+ RH+SM
Sbjct: 14  KQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSM 73

Query: 91  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTS 149
                                           F+G + F V   LGEMA +IP+   FT 
Sbjct: 74  ISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTM 133

Query: 150 YSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAII 209
           Y+ R+  PALG A GY Y F + +    +L+    +IQYW     V   VWI +  + + 
Sbjct: 134 YTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF--AVPLSVWIVVFWILLT 191

Query: 210 TINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEY 269
             N + VRF+GEIE++I+A+K+ +                 +   LGF+YWKNPG +   
Sbjct: 192 ASNMIPVRFYGEIEFWIAALKV-LSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMG 250

Query: 270 STAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFY 329
             +    + RF+ + S  + A F Y GTEL GI   E KNPRK VPKAI    +RI+ FY
Sbjct: 251 MISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFY 310

Query: 330 LISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSA 389
           ++S+F +G+ VP+ DP L             PFV+AI N+G  VLP + N  IL+ + SA
Sbjct: 311 ILSLFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSA 368

Query: 390 ANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVF 449
            NS++Y+ SR LYGL+    AP +F KTNKQGVP++++L   +F  LAY+N+S  + +VF
Sbjct: 369 GNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVF 428

Query: 450 TYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
            + +   ++ G  +W+ I +++IRF +  + +GI ++ L +++   P+GA+++ FF  +I
Sbjct: 429 DWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVI 488

Query: 510 GLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTK-IIPSEEVDL 561
            LI+ F +F  + F +  F                 ++ +KT+ I+  E+VD+
Sbjct: 489 ILIQGFDSFAPE-FVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDI 540

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  293 bits (750), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 166/507 (32%), Positives = 264/507 (52%), Gaps = 12/507 (2%)

Query: 60  VKNVVTHTSEFDGKHDG---IRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXX 116
           V NV     E D +  G    R+K+AL+ RH+ M                          
Sbjct: 45  VTNVCDGLEEEDAEEAGYHDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVG 104

Query: 117 XXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIV 175
                 F+G +V+F+   LGEMA +IP+    T +S R+  PA G A GY Y F + I  
Sbjct: 105 SLIAYLFMGSIVYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITY 164

Query: 176 PNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMX 235
             +++    VIQ+W     V    WI I  V +  +NF  V+ +GEIE++++++K+  + 
Sbjct: 165 AVEISVIGQVIQFWTS--AVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIV 222

Query: 236 XXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYL 295
                             + GF+YW+NPG +     +    +GRF+ + S  + A F Y 
Sbjct: 223 GYLIYALVIVCGGSSQGPI-GFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQ 281

Query: 296 GTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXX 355
           GTEL GI   E  NPRK+VP+AI   ++RI++FY++S+F +GM VPFNDP L        
Sbjct: 282 GTELVGITAGEAANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRL---ASNVA 338

Query: 356 XXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFA 415
                PFV++I NAG  VLPHI NA +++ + SAANS++YV SR LY L+    AP+ F 
Sbjct: 339 VIASSPFVISIQNAGTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFG 398

Query: 416 KTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFD 475
              + GVPY  ++   L  LLA++ V++ ++  F + +N  ++ GL +W+ I +++IRF 
Sbjct: 399 YVTRHGVPYLGVIATSLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFM 458

Query: 476 KAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXX 535
           +A + +GI +  L +++ L P+GA+++ FF  +I  I+ F AF    FD   F       
Sbjct: 459 QALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGFEAF-SPKFDVSGFFTAYISL 517

Query: 536 XXXXXXXXXXKLWYKTKII-PSEEVDL 561
                     +L+Y+ + +   E++D+
Sbjct: 518 IILVVLLIGCQLYYRCRFLWKLEDIDI 544

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  291 bits (746), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 182/555 (32%), Positives = 278/555 (50%), Gaps = 33/555 (5%)

Query: 16  TDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHD 75
           T+  +E  ++       +++ +Q   D Q  S      SGHG +                
Sbjct: 14  TETRLEDYEMGSFAEEALDQEAQSSQDSQLGS------SGHGRNA--------------- 52

Query: 76  GIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCL 135
              +++ L+ RHVSM                                F+G + + V   L
Sbjct: 53  ---VQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSL 109

Query: 136 GEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDK 194
           GEMA +IP+   FT ++ R+    LG A GY Y F + +    +L+    +I+YW     
Sbjct: 110 GEMATFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTS--A 167

Query: 195 VNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEV 254
           V    WI I  V I   N + V+F+GE +++I+ +K+  +                   V
Sbjct: 168 VPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPV 227

Query: 255 LGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAV 314
            GF+YW+NPG + +   +    +GRF+ + S  V A F Y GTEL GI   E  NPRK V
Sbjct: 228 -GFRYWRNPGPWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTV 286

Query: 315 PKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVL 374
           PKAI    +RI++FY+ S+F +G+ VPFND  L             PF++AI N+G  +L
Sbjct: 287 PKAINKVFFRILLFYVGSLFFIGLLVPFNDEKL---TSSDSYSAGSPFIIAIQNSGTKIL 343

Query: 375 PHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFA 434
           P I NA IL  + SAANS++YV SR LYGLA +  APR FA+TN+ GVP  ++L    F 
Sbjct: 344 PDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFG 403

Query: 435 LLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPL 494
            L Y++VS+G+S+ F + +N  +I G  SW+ I + ++RF +A ++QGI +  L +++ L
Sbjct: 404 FLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKL 463

Query: 495 QPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTKII 554
            P+GA++S FF  LI +I+ F + L  TF+  +F                 + WY+T+II
Sbjct: 464 MPWGAYYSAFFITLIIIIQGFTS-LAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRII 522

Query: 555 PS-EEVDLVSFKEAV 568
              E VD+ S +  V
Sbjct: 523 HRIEHVDIDSDRREV 537

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  292 bits (748), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 161/449 (35%), Positives = 243/449 (54%), Gaps = 7/449 (1%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           +G      +K+AL+ RH+SM                                F+G + +F
Sbjct: 74  EGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYF 133

Query: 131 VMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
           V   LGEMA +IP+   FT ++ R+  PA G A GY Y F + I    +L+    +IQ+W
Sbjct: 134 VTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFW 193

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
                V  G WI I  V + T N   V+++GE+E++I+ +K+  +               
Sbjct: 194 TF--AVPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG 251

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
               V GF+YW+NPG +     +    +GRF+ + S  + A F Y GTEL GI   E KN
Sbjct: 252 KTGPV-GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKN 310

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           PR+ VP+AI    +RI+ FY++S+  +G+ VPFNDP L             PFV+AI N+
Sbjct: 311 PRRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENS 367

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
           G  VLPHI NA IL  + SA NS++YV SR LYGLA +  AP++FA+  K GVPY S+L 
Sbjct: 368 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLG 427

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
              F  LAY+N+S+ + +VF + +N  +I G  +W+ I + +IRF +  + + + ++ L 
Sbjct: 428 TAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLP 487

Query: 490 YQSPLQPYGAWFSLFFCILIGLIKNFPAF 518
           +++   P+GA++S FF  LI +I+ F AF
Sbjct: 488 FKAKFMPWGAYYSAFFISLIIIIQGFTAF 516

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  290 bits (743), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 170/521 (32%), Positives = 268/521 (51%), Gaps = 12/521 (2%)

Query: 46  DSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIR---LKKALEARHVSMXXXXXXXXXXXX 102
           D  +H  T+   S    +   + E +  +  IR   +K+ L+ RH+ M            
Sbjct: 23  DYPLHRRTNSVHSIPSQITIESQEEEIANGQIREAEVKRELKQRHIGMIALGGTIGTGLF 82

Query: 103 XXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGF 161
                               F+G LV+ V   LGEMA +IP+   FT +S R+  P+ G 
Sbjct: 83  IGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGA 142

Query: 162 AVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGE 221
           A GY Y F + I    +L+    +IQ+W     +    WI+I  V ++ +N   VRF+GE
Sbjct: 143 ANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV--AWISIFWVLLVAMNMFPVRFYGE 200

Query: 222 IEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFV 281
            E++++++K+  +                   V GF+YW+NPG       A    + +F+
Sbjct: 201 FEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPV-GFRYWRNPGPMGPGIIAKNLNEAKFL 259

Query: 282 SFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVP 341
            + S  + A F Y GTEL GI   E  NPRK+VP+AIK  ++RI+ FY+ S+F +G+ VP
Sbjct: 260 GWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVP 319

Query: 342 FNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSL 401
           +NDP L             PF+++I N+G P+LPHI NA IL  + SAANS++YV SR +
Sbjct: 320 YNDPKL---TSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIM 376

Query: 402 YGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGL 461
           +GL+    APRI ++TNK GVP+ S++   LF  LAYM  S+G    F + +N   + G 
Sbjct: 377 FGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGF 436

Query: 462 LSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGD 521
            SW+ I I+++RF +A   +GI +  L +++   P  A++++FF  LI +I+ F +F   
Sbjct: 437 FSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-P 495

Query: 522 TFDYKSFXXXXXXXXXXXXXXXXXKLWYKTKII-PSEEVDL 561
           +FD   F                 +LW++ ++I   E+VD+
Sbjct: 496 SFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDI 536

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  290 bits (741), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 172/528 (32%), Positives = 268/528 (50%), Gaps = 12/528 (2%)

Query: 36  SSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXX 95
           S+Q  +  + +     + S   S  K+VV+  S   G     ++K+AL+ RH+SM     
Sbjct: 2   SAQQHHSSEKEKNSEELVS-EFSRSKDVVSLESL--GSVKETQVKRALKPRHISMIALGG 58

Query: 96  XXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRY 154
                                      F+G L + V   LGEMA +IP+   F  ++ R+
Sbjct: 59  TIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRF 118

Query: 155 ADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFL 214
             PALG A GY Y   + I    +L+    VIQ+W D   V    WI IL V +++ N  
Sbjct: 119 LSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTD--AVPLTAWIIILWVVLVSANLA 176

Query: 215 GVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAIT 274
            V+F+GE+E++I+ +K+  +                   V GF+YW+NPG +     +  
Sbjct: 177 PVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV-GFRYWRNPGPWGPGIISKD 235

Query: 275 GAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIF 334
             +GRF+ + S  + A F Y GTEL GI   E  NPRK VP+AI    +RI+ FY++S+ 
Sbjct: 236 VNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLL 295

Query: 335 LLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDL 394
            +G+ VPFNDP L             PFV+AI N+G  VLPHI NA IL  + SA NSD+
Sbjct: 296 FIGLLVPFNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDV 352

Query: 395 YVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVN 454
           Y++SR LY + ++  AP+    T K G+PY ++L   L   LAY+  S G+S VF + +N
Sbjct: 353 YISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLN 412

Query: 455 CVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKN 514
             ++ G  +W+ I + +IRF +A + QGI +  L +++   P+GA+++ FF  +I +I+ 
Sbjct: 413 ITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQG 472

Query: 515 FPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTKII-PSEEVDL 561
           F AF    F+   F                 ++W++  +   +E++DL
Sbjct: 473 FTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDL 519

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  291 bits (746), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 174/564 (30%), Positives = 292/564 (51%), Gaps = 18/564 (3%)

Query: 3   EKVYLDAQLSRVDT-DEDIEKQQLFGDDNIVIERSSQLFYDGQSD--SKVHGITSGHGSD 59
           + ++ +A+  R  T   D +K      DN ++E+      D +SD  + V+   S H S+
Sbjct: 29  QSIHSNAEKLRSTTYAYDDKKDMTVTYDNEILEKK-----DSKSDIFTSVNRYAS-HPSE 82

Query: 60  VKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 119
            +         + +    ++K+AL+ RH+ M                             
Sbjct: 83  ARISSDEYDHQEAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLI 142

Query: 120 XXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQ 178
              F+G +V+FV   LGEMA +IP+    T +S+R+  PA G + GY Y F + I    +
Sbjct: 143 AYIFMGTVVYFVTQALGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVE 202

Query: 179 LTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXX 238
           ++    VI++W    KV    WI+I  V +  +NF  V  +GEIE+++++VK+  +    
Sbjct: 203 ISVVGQVIEFWTT--KVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYL 260

Query: 239 XXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTE 298
                          + GF+YW++  A      +    + RF+ + +  + A F Y GTE
Sbjct: 261 IYALVIVCGGSKQGPI-GFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTE 319

Query: 299 LCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXX 358
           L GI   E  NPRK+VP+AI   ++RI++FY++S+F +G+ VP+NDP L           
Sbjct: 320 LVGITAGEAANPRKSVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKL---NSATSYIA 376

Query: 359 XXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTN 418
             PFV++I NAG   LPHI NA I+I + SAANS++YV+SR LY LA+   AP+IFA+  
Sbjct: 377 SSPFVISIENAGTRALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVT 436

Query: 419 KQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAF 478
            QGVP+  ++V  L  LLA++ V++ ++E F + +N  ++ GL +W+ I ++++RF +A 
Sbjct: 437 PQGVPFLGVIVTALMGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEAL 496

Query: 479 RVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXX 538
           + +GI +  L +++   PYG++++ FF  +I  I+ F AF    FD  SF          
Sbjct: 497 KYRGISRDDLPFKARFMPYGSYYACFFITVIIFIQGFTAF-SPKFDVASFFTAYISLILL 555

Query: 539 XXXXXXXKLWYKTKII-PSEEVDL 561
                  +L+Y+ +     E++D+
Sbjct: 556 AVLFIGCQLYYRCRFFWKVEDIDI 579

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  290 bits (742), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 162/464 (34%), Positives = 249/464 (53%), Gaps = 11/464 (2%)

Query: 56  HGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXX 115
           H  D  N      E D +     +K+AL+ RH+SM                         
Sbjct: 37  HSGD--NAPCEKGEGDCRET--EVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPV 92

Query: 116 XXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWII 174
                  F+G +V+FV   LGEMA +IP+    T +S R+  PA G A GY Y F + I 
Sbjct: 93  GALIAYIFIGSIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAIT 152

Query: 175 VPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVM 234
              ++     VIQYW D   V    WI I  V +   NF  V+F+GE+E+++++VK+ + 
Sbjct: 153 YAVEIAVVGQVIQYWTD--AVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKV-IA 209

Query: 235 XXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY 294
                           +   +GF+YW+NPG +     +    +GRF+ + S  + A F Y
Sbjct: 210 IVGYLIYALVIVCGGSHQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTY 269

Query: 295 LGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXX 354
            GTEL GI   E  NPRK VP+AI    +RI+ FY++S+F +G+ VP++D   +      
Sbjct: 270 QGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLFFIGLLVPYDD---LRLSNTT 326

Query: 355 XXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIF 414
                 PFV++I NAG  VLPHI NA ++I + SAANS++YV SR LY LA+   AP+ F
Sbjct: 327 AVIASSPFVISIQNAGTKVLPHIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQF 386

Query: 415 AKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRF 474
               KQGVPY  ++V  L  LLA++ V++ ++E F + VN  ++ GL +W+ I ++++RF
Sbjct: 387 GYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRF 446

Query: 475 DKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAF 518
            +  + +GI +  L +++ L P+GA+++ FF  +I +I+ F AF
Sbjct: 447 MQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKAF 490

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  291 bits (745), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 178/582 (30%), Positives = 289/582 (49%), Gaps = 27/582 (4%)

Query: 6   YLDAQLSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSD-----------SKVHGITS 54
           + D        D+ I       ++N VIE  +   +   SD           S++  + S
Sbjct: 15  HRDKDTGVSSNDDSIGNNSTMKENNEVIELINTNSFKDSSDKPPITLRKSKLSEIGSLHS 74

Query: 55  G-----HGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXX 109
           G     HG+   +    +   + ++   R+K+AL+ RH+ M                   
Sbjct: 75  GSNLHQHGTTSLHDDEESDTEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPL 134

Query: 110 XXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYL 168
                        F+G +V+FV   LGEMA +IP+    T +S R+  PA G A GY Y 
Sbjct: 135 SNAGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYW 194

Query: 169 FKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISA 228
           F + I    +++    VIQYW     V    WI I  V +  +NF  V+ +GE E++I++
Sbjct: 195 FNWAITYAVEISVIGQVIQYWTK--AVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIAS 252

Query: 229 VKITVMXXXXXXXXXXXXXXXPNHE-VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVF 287
           +K  V+                +H+  +GF+YW+NPG +     +    + RF+ + S  
Sbjct: 253 IK--VLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSL 310

Query: 288 VLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLL 347
           + A F Y GTEL GI   E  NPRK+VP+AI   ++RI +FY++S+F +G+ VPFND  L
Sbjct: 311 INAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRL 370

Query: 348 IXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAID 407
                        PFV++I NAG   LP I NA +L+ + SAANS++YV SR LY LA+ 
Sbjct: 371 ---ANDSAVIASSPFVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALT 427

Query: 408 NKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISI 467
             AP+IF+   K GVPY  ++      LLA++ V++ ++  F + +N  ++ GL +W+ I
Sbjct: 428 GNAPKIFSYVTKYGVPYMGVICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFI 487

Query: 468 LITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKS 527
            +++IRF +A + +GI +  L +++ L P+GA+++ FF  +I  I+ F AF    FD  +
Sbjct: 488 SLSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAFT-PKFDVST 546

Query: 528 FXXXXXXXXXXXXXXXXXKLWYKTKII-PSEEVDLVSFKEAV 568
           F                 +L+Y+ + I   E++D+ S +  +
Sbjct: 547 FFTSYISLILLAVLFSGCQLYYRCRFIWKVEDIDIDSDRREI 588

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  288 bits (738), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 189/555 (34%), Positives = 287/555 (51%), Gaps = 29/555 (5%)

Query: 18  EDIEKQ-QLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDG 76
           +  EKQ QL  ++  V+E       +G+S S   G           V+   S+ D     
Sbjct: 4   QSFEKQPQLHKNEIKVME-------EGESSSLADG-----------VLEQQSQIDTASSQ 45

Query: 77  IR-LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCL 135
            R +++AL+ RHVSM                                F+G L FFV   L
Sbjct: 46  ERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSL 105

Query: 136 GEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDK 194
           GEMA +IP+   FT ++ R+  PALG A GY Y F + I    +L+    +IQYW     
Sbjct: 106 GEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTL--G 163

Query: 195 VNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEV 254
           V    WI I  V I   N + V+F+GE +++I+ +K+  +                   V
Sbjct: 164 VPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGPV 223

Query: 255 LGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAV 314
            GF+YW+NPG + +   + + ++GRF+ + S  V A F Y GTEL G+   E  NPRK V
Sbjct: 224 -GFRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTV 282

Query: 315 PKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVL 374
           PKAI+    RI++FY+ S+F +G+ VPFNDP L             PF++AI N+G   L
Sbjct: 283 PKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKL---DSTANYSASSPFIIAIQNSGTRAL 339

Query: 375 PHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFA 434
           P I NA IL  + SAANS++YV SR LYGLA +  AP+I  + N+ GVPY  + +  LF 
Sbjct: 340 PDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFG 399

Query: 435 LLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPL 494
            L Y++VSSGS++ F + +N  +I G  +W+ I + +IRF +A + QGI +  L +++ L
Sbjct: 400 FLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKL 459

Query: 495 QPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTKII 554
            P+GA+++ FF +LI +I+ F AF    F+  +F                 ++ +K+++I
Sbjct: 460 MPWGAYYAAFFILLIIIIQGFTAF-APKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLI 518

Query: 555 PS-EEVDLVSFKEAV 568
              E+VD+ S +  +
Sbjct: 519 HKVEDVDIDSDRREI 533

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  288 bits (736), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 169/506 (33%), Positives = 264/506 (52%), Gaps = 10/506 (1%)

Query: 59  DVKNVVTHTSEFDGKHDGIR-LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXX 117
           D  +  T  S  D   +  + +K+ L+ RH+SM                           
Sbjct: 14  DSNDTPTTISTLDDDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGA 73

Query: 118 XXXXXFVGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVP 176
                F+G +VF V   LGEM  +IP+   FT ++ R+  PA G A GY Y F + +   
Sbjct: 74  LIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFA 133

Query: 177 NQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXX 236
            +L+    +IQ+W     V    WI+I+ V +   N   VR +GEIE++I++VK+  +  
Sbjct: 134 LELSVVGQIIQFWTM--AVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILG 191

Query: 237 XXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLG 296
                            V GF+YWKNPG +     +    + RF  + S  + A F + G
Sbjct: 192 FIIYGICIICGAGVTGPV-GFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQG 250

Query: 297 TELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXX 356
           TEL GI   E + PRK VPKAIK  ++RI+VFY+ S+ ++G+ VP+NDP L         
Sbjct: 251 TELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL---QSNDSY 307

Query: 357 XXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAK 416
               PF++ I NAG  +LPHI NA ILI + SA NS++Y+ SR LYGLA +  AP+ F  
Sbjct: 308 VSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTN 367

Query: 417 TNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDK 476
           T+K GVPY ++L   +F  LAYM  ++G  + FT+ +N V + G  +W+ I  ++IRF K
Sbjct: 368 TSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMK 427

Query: 477 AFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXX 536
           A + +GI ++ L Y++ L P+ A++++FF ++I +I+ F +F    F   +F        
Sbjct: 428 ALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVF 486

Query: 537 XXXXXXXXXKLWYKTKII-PSEEVDL 561
                    ++W+K +++   ++VDL
Sbjct: 487 LFIIFWVAFQIWFKCRLVWKLQDVDL 512

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  289 bits (740), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 167/494 (33%), Positives = 260/494 (52%), Gaps = 12/494 (2%)

Query: 78  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGE 137
            +K+AL+ RH+ M                                F+G +++F+   LGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 138 MAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVN 196
           MA +IP+    T +S R+  PA G + GY Y F + I    +++    VIQYW D  KV 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTD--KVP 222

Query: 197 PGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHE-VL 255
              WI I  V I  +NF  V+ +GE E+++++VK  V+                +H+  +
Sbjct: 223 LAAWIAIFWVLITLMNFFPVKVYGEFEFWVASVK--VLAIVGYLIYALVIVCGGSHQGPI 280

Query: 256 GFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVP 315
           GF+YW+NPGA+     +   ++GRF+ + S  + A F Y GTEL GI   E  NPRK VP
Sbjct: 281 GFRYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 340

Query: 316 KAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLP 375
           +AI   ++RI++FY++S+F +G+ VP+N+P L             PFV++I NAG   LP
Sbjct: 341 RAINKVVFRIVIFYIMSLFFIGLLVPYNEPRL---SPSSAVIASSPFVISIQNAGTYALP 397

Query: 376 HIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFAL 435
            I NA +LI V SAANS++YV SR LY LA    AP+ F    KQGVPY  +L      L
Sbjct: 398 DIFNAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGL 457

Query: 436 LAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQ 495
           LA++ V++ ++  F + ++  ++ GL +W+ I + +IRF +A + +GI +  L +++ L 
Sbjct: 458 LAFLVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLM 517

Query: 496 PYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTKII- 554
           PYGA+++ FF  +I  I+ F AF    F    F                 +L+YK + I 
Sbjct: 518 PYGAYYASFFVTIIIFIQGFQAFC--PFSVSEFFTSYISLILLAVVFISCQLYYKCRFIW 575

Query: 555 PSEEVDLVSFKEAV 568
             E++D+ S +  +
Sbjct: 576 KLEDIDIDSDRREI 589

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  288 bits (737), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 178/571 (31%), Positives = 288/571 (50%), Gaps = 23/571 (4%)

Query: 1   MAEKVYLDAQLSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQ-SDSKVHGITSGHGSD 59
           M E V  D ++S+V   E I       ++ ++  R     YDGQ ++  V G +S +   
Sbjct: 1   MNESV--DMRMSKVSQYE-INSISTIKEEELICAR-----YDGQDTEEAVAGKSSINNDS 52

Query: 60  VKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 119
            K   T TS       G  +K+ L+ RH+ M                             
Sbjct: 53  AKE--TETS----PRKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALI 106

Query: 120 XXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQ 178
              F+G +++ V   LGEMA +IP+   F+ ++ R+  PALG   GY Y   +      +
Sbjct: 107 SYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALE 166

Query: 179 LTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXX 238
           L+    +IQYW D   V    WI I    +  +N   V+++GE E+ I+++K+  +    
Sbjct: 167 LSVLGQIIQYWTD--AVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFI 224

Query: 239 XXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTE 298
                       +   +GF+YW+NPGA+     +    +GRF+ + S  + A F Y GTE
Sbjct: 225 FFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTE 284

Query: 299 LCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXX 358
           L GI   E  NPR+AVP+AIK  + RI+VFY++S+F +G+ VP+NDP L           
Sbjct: 285 LVGITAGEAANPRRAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL---DSEGTFVS 341

Query: 359 XXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTN 418
             PF+++I N+G  VLP I NA +LI + SA NS++Y+ SR LY L+ ++ APR  +   
Sbjct: 342 SSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVT 401

Query: 419 KQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAF 478
           K GVPY+++L    F  LA++  S+GS +VF + +N   + G  +W+ I +++IRF +A 
Sbjct: 402 KGGVPYFAVLSTSAFGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAI 461

Query: 479 RVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXX 538
           + +GI +  L Y++ + P+ A+++ FF  LI LI+ F AF   TF    F          
Sbjct: 462 KKRGISRDDLPYRARMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFIAAYISVFLF 520

Query: 539 XXXXXXXKLWYKTKII-PSEEVDLVSFKEAV 568
                  ++W+K + +   ++VD+ S +  +
Sbjct: 521 IAIWLLFQVWFKCRFVWKLQDVDIDSDRRDI 551

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  288 bits (737), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 168/503 (33%), Positives = 265/503 (52%), Gaps = 18/503 (3%)

Query: 24  QLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGK-------HDG 76
           +   D+ IV ++  +L +  Q ++ ++ IT  H      + TH  +   +       HD 
Sbjct: 35  ETINDEKIVFDKK-KLAHTNQFNADINSIT--HSLTRSRIATHHEDDQEEEAEEAQYHD- 90

Query: 77  IRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLG 136
            ++K+AL+ RH+ M                                F+G +++F+   LG
Sbjct: 91  TQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQSLG 150

Query: 137 EMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKV 195
           EMA +IP+    T +S R+  PA G A GY Y F + I    +++    VI+YW D  KV
Sbjct: 151 EMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTD--KV 208

Query: 196 NPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVL 255
               WI I  V I  +NF  V+ +GEIE++I+ +K+  +                   + 
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQGPI- 267

Query: 256 GFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVP 315
           GF+YW+NPG +     +     GRF+ + S  + A F Y GTEL GI   E  NPRK VP
Sbjct: 268 GFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 327

Query: 316 KAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLP 375
           +AI   ++RI +FY++S+F +GM VP+ND  L             PFV++I NAG  VLP
Sbjct: 328 RAINKVVFRIALFYIMSLFFIGMLVPYNDERL---ASTSAVIASSPFVISIQNAGTKVLP 384

Query: 376 HIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFAL 435
            I NA ++I + SAANS++YV SR LY LA+   AP+ FA   + GVPY  ++V     L
Sbjct: 385 DIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGL 444

Query: 436 LAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQ 495
           LA++ V++ ++  F + +N  ++ GL +W+ I I++IRF +A + +GI +  L +++ L 
Sbjct: 445 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLM 504

Query: 496 PYGAWFSLFFCILIGLIKNFPAF 518
           P+GA+++ FF  +I  I+ F AF
Sbjct: 505 PFGAYYATFFVTVIIFIQGFQAF 527

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  287 bits (735), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 169/505 (33%), Positives = 262/505 (51%), Gaps = 15/505 (2%)

Query: 18  EDIEKQQLF---GDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKH 74
            D+E  Q     G   +  E++ +L+      ++V G  +    DV        E  G+ 
Sbjct: 25  HDVEASQTHRRRGSLPLKDEKNKELYPLHSFSTRVDGEDTFSMGDVIR-----DEDQGEV 79

Query: 75  DGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSC 134
               +K+ L+ RH+ M                                F+G L + V   
Sbjct: 80  RNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQS 139

Query: 135 LGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRD 193
           LGEMA +IP+   FT +S R+  PA G A GY Y F + I    +L+    VI++W +  
Sbjct: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTN-- 197

Query: 194 KVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHE 253
           KV    WI+I  V I  +N   V+++GE E++++++K+  +                   
Sbjct: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257

Query: 254 VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKA 313
           V GF+YW+NPGA+     +    +GRF+ + S  + A F + GTEL GI   E  NPRK 
Sbjct: 258 V-GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 316

Query: 314 VPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPV 373
           VP+AIK  ++RI+ FY+ S+  +G+ VP+NDP L             PF++AI N+G  V
Sbjct: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TTATSYVSVSPFIIAIENSGTKV 373

Query: 374 LPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLF 433
           LPHI NA IL  + SAANS++YV SR L+GL+ +  AP+  ++T K GVPY ++ +  +F
Sbjct: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVF 433

Query: 434 ALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSP 493
             LAYM  S+G  +VF + +N   + G  +W+ I I++IRF +A + +GI +  L +++ 
Sbjct: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAK 493

Query: 494 LQPYGAWFSLFFCILIGLIKNFPAF 518
           L P  A+F+  F I+I LI+ F AF
Sbjct: 494 LMPGLAYFAATFMIIIILIQGFTAF 518

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  288 bits (736), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 171/516 (33%), Positives = 269/516 (52%), Gaps = 17/516 (3%)

Query: 56  HGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXX 115
           H +D+ N     + ++ KH    +K+AL+ RH+ M                         
Sbjct: 88  HETDI-NEDEEEAHYEDKH----VKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPV 142

Query: 116 XXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWII 174
                  F+G +V+FV   LGEMA +IP+    T +S R+  PA G + GY Y F + I 
Sbjct: 143 GSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAIT 202

Query: 175 VPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVM 234
              +++    VI+YW D  KV    WI I  V I  +NF  V+ +GE E+++++VK  V+
Sbjct: 203 YAVEVSVIGQVIEYWTD--KVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVK--VL 258

Query: 235 XXXXXXXXXXXXXXXPNHE-VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFA 293
                           +H+  +GF+YW+NPGA+     +   ++GRF+ + S  + A F 
Sbjct: 259 AIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFT 318

Query: 294 YLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXX 353
           Y GTEL GI   E  NPRK VP+AI   ++RI++FY++S+F +G+ VP+ND  L      
Sbjct: 319 YQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAV 378

Query: 354 XXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRI 413
                  PFV++I NAG   LP I NA +LI V SAANS++YV SR LY LA    AP+ 
Sbjct: 379 IASS---PFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQ 435

Query: 414 FAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIR 473
           F    +QGVPY  ++      LLA++ V++ ++  F + +N  ++ GL +W+ I + +IR
Sbjct: 436 FGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIR 495

Query: 474 FDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXX 533
           F +A + +GI +  L +++ L PYGA+++ FF  +I  I+ F AF    F    F     
Sbjct: 496 FMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFC--PFKVSEFFTSYI 553

Query: 534 XXXXXXXXXXXXKLWYKTKII-PSEEVDLVSFKEAV 568
                       +++YK + I   E++D+ S +  +
Sbjct: 554 SLILLAVVFIGCQIYYKCRFIWKLEDIDIDSDRREI 589

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  286 bits (731), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 164/492 (33%), Positives = 252/492 (51%), Gaps = 9/492 (1%)

Query: 72  GKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFV 131
           G     ++K+AL+ RH+SM                                F+G L + V
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94

Query: 132 MSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190
              LGEMA +IP+   FT ++ R+  PALG A GY Y   + I    +L+    +IQ+W 
Sbjct: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154

Query: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXP 250
           D   +    WI I  V +   N   V+++GE+E++I+ +K+  +                
Sbjct: 155 DAVPLT--AWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212

Query: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310
              V GF+YW+NPG +     +    +GRF+ + S  + A F Y GTEL GI   E  NP
Sbjct: 213 TGPV-GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271

Query: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAG 370
           RK VP+AI    +RI+ FY++S+  +G+ VPFNDP L             PFV+AI N+G
Sbjct: 272 RKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENSG 328

Query: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430
             VLPHI NA IL  + SA NS++YV SR  Y +A++  AP+    T K G+PY ++L  
Sbjct: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388

Query: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490
            +   LAY+  SSG+S VF + +N  ++ G  +WI I I++IRF +A + QGI +  L +
Sbjct: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448

Query: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK 550
           ++   P+GA+++ FF  +I +I+ F AF    F    F                 ++W++
Sbjct: 449 KAKFMPWGAYYAAFFIGVIIIIQGFTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFR 507

Query: 551 TKI-IPSEEVDL 561
             + I +E++DL
Sbjct: 508 GPLFIKTEDIDL 519

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  285 bits (730), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 168/527 (31%), Positives = 281/527 (53%), Gaps = 19/527 (3%)

Query: 43  GQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXX 102
           G SD++ +G    +  D +  +  +S+         L++  + RHV M            
Sbjct: 20  GNSDTQQNGEV--YELDFQEAIGESSQ--------TLQRGFKQRHVDMLAIAGAIGTGLV 69

Query: 103 XXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPLD-GFTSYSTRYADPALGF 161
                               F G L+  V+  L EMA++ P+D  F+ Y+TRY DPALGF
Sbjct: 70  IGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGF 129

Query: 162 AVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGE 221
           A G+ Y  KY I + ++L+A  L++QYW  R+ ++  ++I + LV ++++NF+ ++F+GE
Sbjct: 130 ATGWNYFLKYAIALASELSAIGLLVQYW--REDLSIAIFIVVFLVVLLSLNFMNIKFYGE 187

Query: 222 IEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFV 281
           +E++ + +K  V+               P+ E +GF+YW+   AF  Y   + G  GRF+
Sbjct: 188 VEFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREY-AFVPY--LVKGTTGRFL 244

Query: 282 SFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVP 341
            + +  + + +AY+G+E  G+V  E  NP+K +P A +  ++RI  FY++ + +LG+ + 
Sbjct: 245 GWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIIS 304

Query: 342 FNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSL 401
            +D  L             PFV+A  NAGI  LP  +NA +++F+ SAAN+ LYV SR+ 
Sbjct: 305 PHDKTL--ANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTA 362

Query: 402 YGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGL 461
           YGLA D  AP+IF   N+ GVP+   L+  L +LL++MN+S+ SS +F Y  + V++FG 
Sbjct: 363 YGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGT 422

Query: 462 LSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGD 521
           L+W+S+LI+YI +++A     + +  + ++   QPY A+  LFF  LI     + AF+  
Sbjct: 423 LNWLSVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFIAG 482

Query: 522 TFDYKSFXXXXXXXXXXXXXXXXXKLWYKTKIIPSEEVDLVSFKEAV 568
            F YKSF                 K W K+     E++  +  +EA+
Sbjct: 483 -FKYKSFIVSYIGIAVFIGNTLFWKFWKKSAATRPEDLRSIMVEEAI 528

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  287 bits (734), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 165/497 (33%), Positives = 259/497 (52%), Gaps = 10/497 (2%)

Query: 74  HDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMS 133
           HD  R+K+AL+ RH+ M                                F+G +++FV  
Sbjct: 87  HD-TRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQ 145

Query: 134 CLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192
            LGEMA +IP+    T +S R+  PA G A GY Y F + I    +++    VIQYW   
Sbjct: 146 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTF- 204

Query: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNH 252
            KV    WI I  V I  +NF  V+ +GE E++++++K+ +                 + 
Sbjct: 205 -KVPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKV-IAIVGYLIYALIIVCGGSHQ 262

Query: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRK 312
             +GF+YW+NPGA      +    + RF+ + S  + A F Y GTEL GI   E  NPRK
Sbjct: 263 GPIGFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 322

Query: 313 AVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIP 372
           +VP+AI   ++RI++FY++S+F +G+ VP+NDP L             PFV++I NAG  
Sbjct: 323 SVPRAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASS---PFVISIQNAGTK 379

Query: 373 VLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVL 432
           VLP I NA +L+ V SAANS++YV SR LY LA    AP+ FA   + GVPY  ++   L
Sbjct: 380 VLPDIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTAL 439

Query: 433 FALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQS 492
             LLA++ V+  ++  F + +N  ++ GL +W+ I + +IRF +A + +GI +  L +++
Sbjct: 440 LGLLAFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKA 499

Query: 493 PLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTK 552
              P+GA+++ FF  +I  I+ F AF    FD   F                 +L+Y+ +
Sbjct: 500 KFMPWGAYYASFFVTVIIFIQGFQAF-APKFDVSEFFTAYISLILLVVLFAGCQLYYRCR 558

Query: 553 II-PSEEVDLVSFKEAV 568
            +   E++D+ S +  +
Sbjct: 559 FLWKLEDIDIDSDRREI 575

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  286 bits (732), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 161/504 (31%), Positives = 263/504 (52%), Gaps = 12/504 (2%)

Query: 18  EDIEKQQLFGDDNIVIERSSQLFYDGQSDS--KVHGITSGHGSDVKNVVTHTSEFDGKHD 75
            D++++ +  D + +I+ +    ++  +    +    TS   +  +++ T   E    HD
Sbjct: 6   SDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHD 65

Query: 76  GIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCL 135
              +K++L+ RH+ M                                F+G +VF V   L
Sbjct: 66  ---VKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSL 122

Query: 136 GEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDK 194
           GEMA +IP+   F+ ++ R+  PALG A GY Y   +      +L+    +IQ+W    K
Sbjct: 123 GEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF--K 180

Query: 195 VNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEV 254
           V    WI+I  V +   N   V+F+GE E++I+++K+  +                   +
Sbjct: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPI 240

Query: 255 LGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAV 314
            GF+YW+NPGA      +    + RF+ + S  + A F Y GTEL GI   E  NPRKAV
Sbjct: 241 -GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299

Query: 315 PKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVL 374
           P+AI+  + RI++FY+ S+F +G+ VP+NDP L             PF++ I NAG  VL
Sbjct: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKL---TSTDSYVSSSPFIITIQNAGTRVL 356

Query: 375 PHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFA 434
           PHI NA IL  + SA NS++YV SR L+ +A +  AP+  AKT  QGVPY S+L    F 
Sbjct: 357 PHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFG 416

Query: 435 LLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPL 494
            L+YM +S+G ++ F + +N   + G  +W+ I  +++RF +A + +GI +  L Y++  
Sbjct: 417 SLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALW 476

Query: 495 QPYGAWFSLFFCILIGLIKNFPAF 518
            P+ A++++FF ++I LI+ F +F
Sbjct: 477 MPWLAYYAIFFMVVIILIQGFTSF 500

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  285 bits (729), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 165/461 (35%), Positives = 248/461 (53%), Gaps = 8/461 (1%)

Query: 69  EFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLV 128
           E +G+     +K+ L+ RH+ M                                F+G L 
Sbjct: 74  EDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLA 133

Query: 129 FFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQ 187
           F V   LGEMA +IP+   FT +S R+  PA G A GY Y F + I    +L+    VIQ
Sbjct: 134 FSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQ 193

Query: 188 YWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXX 247
           +W    KV    WI+I  V I  +N   V+++GE E++++++K+  +             
Sbjct: 194 FWTH--KVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCG 251

Query: 248 XXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSEC 307
                 V GF+YW+NPGA+     +    +GRF+ + S  + A F + GTEL GI   E 
Sbjct: 252 AGVTGPV-GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEA 310

Query: 308 KNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIV 367
            NPRK VP+AIK  ++RI+ FY+ S+  +G+ VP+NDP L             PF+VAI 
Sbjct: 311 ANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TEATSYVSTSPFIVAIQ 367

Query: 368 NAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSL 427
           N+G  VLPHI NA IL  + SAANS++YV SR L+GL+ +  AP+  ++T+K GVPY ++
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427

Query: 428 LVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKST 487
               +F  LAYM  S+G  +VF + +N   + G  +W+ I I++IRF +A + +GI +  
Sbjct: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487

Query: 488 LAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
           L +++ L P  A++S FF I+I +I+ F AF    F+  SF
Sbjct: 488 LPFKAKLMPGLAYYSSFFMIIIIIIQGFTAF-APKFNGSSF 527

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  285 bits (729), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 167/506 (33%), Positives = 263/506 (51%), Gaps = 17/506 (3%)

Query: 18  EDIEKQQLF---GDDNIVIERSSQLFYDGQSDSKVHGI-TSGHGSDVKNVVTHTSEFDGK 73
            D+E  Q     G  ++  E+S +L+      + V+G  T     D+++      E +G+
Sbjct: 25  HDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQD------EDEGE 78

Query: 74  HDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMS 133
                +K+ L+ RH+ M                                F+G L + V  
Sbjct: 79  VQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQ 138

Query: 134 CLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192
            LGEMA +IP+   FT +S R+  PA G A GY Y F + +    +L+    VIQ+W   
Sbjct: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTY- 197

Query: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNH 252
             V    WI+I  V I  +N   V+++GE E++++++K+  +                  
Sbjct: 198 -AVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTG 256

Query: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRK 312
            V GF+YW+NPGA+     +    + RF+ + S  + A F + GTEL GI   E  NPRK
Sbjct: 257 PV-GFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315

Query: 313 AVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIP 372
            VP+AIK  ++RI+ FY+ S+  +G+ VP+NDP L             PF++AI N+G  
Sbjct: 316 TVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TSATSYVSTSPFIIAIENSGTK 372

Query: 373 VLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVL 432
           VLPHI NA IL  + SAANS++YV SR L+GL+    AP+ F+KT K GVPY ++    +
Sbjct: 373 VLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSI 432

Query: 433 FALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQS 492
           F  LAYM  S+G  +VF + +N   + G  +W+ I +++IRF +A + +GI +  L +++
Sbjct: 433 FGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKA 492

Query: 493 PLQPYGAWFSLFFCILIGLIKNFPAF 518
            L P  A+++ FF ++I LI+ F +F
Sbjct: 493 KLMPGLAYYATFFMVVIILIQGFTSF 518

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  284 bits (727), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 172/530 (32%), Positives = 270/530 (50%), Gaps = 34/530 (6%)

Query: 11  LSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKN-----VVT 65
           ++    D DIE++ ++       E  + LF+D ++    H   S    D K+     + +
Sbjct: 1   MTNSKEDADIEEKHMYN------EPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRS 54

Query: 66  HTSEFDGK-----HDGI-----------RLKKALEARHVSMXXXXXXXXXXXXXXXXXXX 109
             +  +G+      DGI            +K+ L+ RH+ M                   
Sbjct: 55  FPTRVNGEDTFSMEDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPL 114

Query: 110 XXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYL 168
                        F+G L + V   LGEMA +IP+   FT +S R+  PA G A GY Y 
Sbjct: 115 TNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYW 174

Query: 169 FKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISA 228
           F + I    +L+    VIQ+W    KV    WI+I  V I  +N   V+++GE E+++++
Sbjct: 175 FSWAITFALELSVVGQVIQFWTY--KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVAS 232

Query: 229 VKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFV 288
           +K+  +                   V GF+YW+NPGA+     +    +GRF+ + S  +
Sbjct: 233 IKVLAIIGFLIYCFCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLI 291

Query: 289 LALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLI 348
            A F + GTEL GI   E  NPRK+VP+AIK  ++RI+ FY+ S+  +G+ VP+NDP L 
Sbjct: 292 NAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL- 350

Query: 349 XXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDN 408
                       PF++AI N+G  VLPHI NA IL  + SAANS++YV SR L+GL+ + 
Sbjct: 351 --TQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNK 408

Query: 409 KAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISIL 468
            AP+  ++T K GVPY ++ V   F  LAYM  S+G  +VF + +N   + G  +W+ I 
Sbjct: 409 LAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFIS 468

Query: 469 ITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAF 518
           I++IRF +A + +GI +  L +++ L P  A+++  F  +I +I+ F AF
Sbjct: 469 ISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAF 518

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  285 bits (728), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 167/503 (33%), Positives = 260/503 (51%), Gaps = 14/503 (2%)

Query: 68  SEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLL 127
           + ++ KH    +++AL+ RH+ M                                F+G +
Sbjct: 99  AHYEDKH----VRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTV 154

Query: 128 VFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVI 186
           V+FV   LGEMA +IP+    T +S R+  PA G + GY Y F + I    +++    VI
Sbjct: 155 VYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVI 214

Query: 187 QYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXX 246
           +YW    KV  GVWI I  V I  +NF  V+ +GE E+++++VK+  +            
Sbjct: 215 EYWTT--KVPLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVC 272

Query: 247 XXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSE 306
                  + GF+YW+NPGA+     +    +GRF+ + S  + A F Y GTEL GI   E
Sbjct: 273 GGSKQGPI-GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 331

Query: 307 CKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAI 366
             NPRK VP+AI   ++RI++FY++S+F +G+ VP+ DP L             PFV++I
Sbjct: 332 AANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASS---PFVISI 388

Query: 367 VNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWS 426
            NAG   LP I NA +LI V SAANS++YV SR LY LA    AP+ F    KQGVPY  
Sbjct: 389 QNAGTYALPDIFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLG 448

Query: 427 LLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKS 486
           +L      LLA++ V++ ++  F + +N  ++ GL +W+ I +++IRF +A   +GI + 
Sbjct: 449 VLSTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRD 508

Query: 487 TLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXK 546
            L +++   PYGA+++ FF  +I  I+ F +F    F    F                 +
Sbjct: 509 DLPFKAKFMPYGAYYASFFVTVIIFIQGFQSFC--PFRVADFFTSYISLILLAVVFTGCQ 566

Query: 547 LWYKTKII-PSEEVDLVSFKEAV 568
           L+YK + I   E++D+ S +  +
Sbjct: 567 LYYKCRFIWKLEDIDIDSDRREI 589

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  283 bits (724), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 167/549 (30%), Positives = 274/549 (49%), Gaps = 18/549 (3%)

Query: 28  DDNIVIERSSQLFY------DGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKK 81
           ++ IV+E  ++  Y      +  S+  +  IT   G +         E +G +    +K+
Sbjct: 7   NETIVLETLTRERYSKKAKGNNGSEIALESITPDSGDEFP----EEHEQEGDYHETEVKR 62

Query: 82  ALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAY 141
           AL+ARH+SM                                F+G +V+ +   LGEMA +
Sbjct: 63  ALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYSITQSLGEMATF 122

Query: 142 IPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVW 200
           IP+    T +S R+  PA G A GY Y F + I    +L+    +I YW     V  G W
Sbjct: 123 IPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYWTS--VVPLGAW 180

Query: 201 ITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYW 260
           ITI  + +  +NF  VRF+GEIE++I++VK+ +                 +   +GF+ W
Sbjct: 181 ITIFWIIVTLLNFFPVRFYGEIEFWIASVKV-ITIVGYLIYAFIVVCGGSSQGPIGFRNW 239

Query: 261 KNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKL 320
           +NPG +     +    + RF+ + S  + A F Y GTEL GI   E KNPRK VPKAI  
Sbjct: 240 RNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINK 299

Query: 321 TMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNA 380
             +RI+ FY++S+F +G+ VP+NDP +             PFV++I NAG  +LP I NA
Sbjct: 300 VFFRILFFYILSLFFVGLLVPYNDPRM--DNTSDTDVNASPFVISIRNAGTKILPDIFNA 357

Query: 381 CILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMN 440
            +L+ V SAANS++Y+ SR +Y LA    AP+ F   N+ GVP   ++V  L  L+A++ 
Sbjct: 358 VVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALMGLMAFLV 417

Query: 441 VSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAW 500
           V++ +   F + VN  ++ GL +W+ I + +IRF +  + +GI +  L +++   P+ A+
Sbjct: 418 VNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAKFMPWAAY 477

Query: 501 FSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTKII-PSEEV 559
           ++  F  +I  I+ + AF    FD   F                 +++YK + +   E++
Sbjct: 478 YAASFVFVIIFIQGYTAF-SPKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRFLWKLEDI 536

Query: 560 DLVSFKEAV 568
           D+ + +  +
Sbjct: 537 DIDTNRREI 545

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  283 bits (724), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 166/508 (32%), Positives = 260/508 (51%), Gaps = 12/508 (2%)

Query: 66  HTSEFDGKHDGIR---LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 122
           H S F+     ++   +K+AL+ RHVSM                                
Sbjct: 38  HNSSFEDDEGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYI 97

Query: 123 FVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
           F+G +V+FV   +GEMA +IP+    T +S R+  PA G A GY Y F + I    +++ 
Sbjct: 98  FMGSIVYFVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISV 157

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
              VIQYW     V    WI I  VAI   NF  VRF+GE+E++++++K+  +       
Sbjct: 158 IGQVIQYWTK--AVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYA 215

Query: 242 XXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCG 301
                       + GF+YW+NPG + +   +    KGRF+ + +  + A F Y GTEL G
Sbjct: 216 LIIVCGGSKQGPI-GFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVG 274

Query: 302 IVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXP 361
           I   E  NPRK VPKAI    +RI+ FY++S+F +G+ VP+N P L             P
Sbjct: 275 ITAGEAANPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGL---DKHTSVIASSP 331

Query: 362 FVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQG 421
           FV++I +AG  +LP I NA +L+ + SAANS++YV SR L+ LA    AP+ F+    QG
Sbjct: 332 FVISIQSAGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQG 391

Query: 422 VPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ 481
           VPY  ++   L  LLA++ V   ++E F + +N  ++ GL +W+ I I++IRF +  + +
Sbjct: 392 VPYLGVICTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQR 451

Query: 482 GIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXX 541
           GI +  L ++S L PYGA+++ F+  +I  ++ F AF    F    F             
Sbjct: 452 GISRDDLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFC-PKFKVAEFFTGYISLILLAVV 510

Query: 542 XXXXKLWYKTKIIPS-EEVDLVSFKEAV 568
               +L+Y+ +     E++D+ S +  +
Sbjct: 511 FCLAQLYYRCRFFNRLEDIDIDSDRREI 538

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  284 bits (726), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 176/513 (34%), Positives = 262/513 (51%), Gaps = 19/513 (3%)

Query: 17  DEDIEKQQLFGDDNIVIERSSQLFY--DGQSDSKVHGITSGHGSDV--------KNVVTH 66
           +E      L  D NI    S   F      +       TS  GS++         N  T 
Sbjct: 23  EEAGSSDVLPNDTNITTATSVASFELKSTNASEAASQSTSPTGSELIPDCLQSATNTGTL 82

Query: 67  TSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGL 126
            +E   KH  +  K+AL+ RH++M                                FVG 
Sbjct: 83  CTEEHVKHRSV--KRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGT 140

Query: 127 LVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALV 185
           ++F V   LGEM  +IP+   FT +S R+  PA G A GY Y F + +    +L+    V
Sbjct: 141 IIFSVTQSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKV 200

Query: 186 IQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXX 245
           IQ+W     V    WI I    +   N   V+++GEIE++I+ +K+  +           
Sbjct: 201 IQFWTT--AVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCIT 258

Query: 246 XXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVS 305
               P H   GF+YW++PGA+     A   ++ RF+ + S  + A F Y GTEL GI   
Sbjct: 259 SGAGP-HGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAG 317

Query: 306 ECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVA 365
           E  NPRKAVPKAIK  + RI+ FY+ S+F +GM VPFNDP L             PF++A
Sbjct: 318 EAANPRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKL---TSATSFVSSSPFIIA 374

Query: 366 IVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYW 425
           I N+G+ +LP I N  ILI + SA NS++YV SR L+GLA  N AP+ F +T K GVP+ 
Sbjct: 375 IQNSGVSLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFV 434

Query: 426 SLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDK 485
           ++L   LF  LA++ +++   +VF + ++ V+I G  +W+ I +++IRF KA   +GI +
Sbjct: 435 AVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISR 494

Query: 486 STLAYQSPLQPYGAWFSLFFCILIGLIKNFPAF 518
           ++L +++   P+ A+++  F ILI LI+ F AF
Sbjct: 495 NSLPFKAIFMPWLAYYATAFIILIILIQGFTAF 527

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  282 bits (722), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 165/530 (31%), Positives = 271/530 (51%), Gaps = 11/530 (2%)

Query: 42  DGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXX 101
           D Q + +         S ++N     +E   +  G  +++ L+ RH+ M           
Sbjct: 30  DAQYEEQDTSAAIAANSSIENDGAKGTETSPRSRG-EVQRKLKERHIGMIALGGTIGTGL 88

Query: 102 XXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALG 160
                                F+G +++ V   LGEMA +IP+   F+ ++ R+  PALG
Sbjct: 89  IIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALG 148

Query: 161 FAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFG 220
              GY Y   +      +L+    +IQYW     V    WI I    +  +N   V+++G
Sbjct: 149 ATNGYMYWLSWCFTFALELSVLGQIIQYWTH--AVPLAAWIVIFWCLLTLMNMFPVKYYG 206

Query: 221 EIEYYISAVK-ITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGR 279
           E E+ I+++K IT++               P+  + GF+YW+NPGA+     +    +GR
Sbjct: 207 EFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPI-GFRYWRNPGAWGPGIISSNKNEGR 265

Query: 280 FVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMC 339
           F+ + S  + A F Y GTEL GI   E  NPRKAVP+AIK  + RI+VFY++S+F +G+ 
Sbjct: 266 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVIRILVFYILSLFFIGLL 325

Query: 340 VPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASR 399
           VP+NDP L             PF+++I N+G  VLP I NA +LI +FSA NS++Y+ SR
Sbjct: 326 VPYNDPKL---DSDGTFVSASPFMISIENSGTKVLPDIFNAVVLITIFSAGNSNVYIGSR 382

Query: 400 SLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIF 459
            LY L+ ++ AP+  +   + GVPY ++L+  LF  LA++  S+GS + F + +N   + 
Sbjct: 383 VLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLETSAGSGKAFNWLLNITGVA 442

Query: 460 GLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFL 519
           G  +W+ I  ++IRF +A + +GI +  L Y++ + P+ A+++ FF  LI LI+ F AF 
Sbjct: 443 GFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYYASFFIALIVLIQGFTAF- 501

Query: 520 GDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTKIIPS-EEVDLVSFKEAV 568
             TF    F                 +LW+K ++I   +++D+ S +  +
Sbjct: 502 APTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDIDIDSDRREI 551

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  283 bits (724), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 172/567 (30%), Positives = 289/567 (50%), Gaps = 26/567 (4%)

Query: 8   DAQLSRVDTDED---IEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGIT-SGHGSDVKNV 63
           D+  +R  T  D    E + +  D+ I +++   +     + + VH +T S   S + + 
Sbjct: 15  DSDDTRSQTSGDGSPYEMEDIVPDEKIRLQKLKHV----STQADVHSVTGSLTRSRLNSR 70

Query: 64  VTHTSEFDGKHD------GIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXX 117
           V   +E DG  +        ++K+AL+ RH+ M                           
Sbjct: 71  VDDGAESDGSDELEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGS 130

Query: 118 XXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVP 176
                F+G +++FV   LGEMA +IP+    T +S R+  PA G A GY Y F + I   
Sbjct: 131 LIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYA 190

Query: 177 NQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXX 236
            +++    VIQYW     V    WI I  V +  +NF  V+ +GE+E++I+ VK  V+  
Sbjct: 191 VEISVIGQVIQYWTK--AVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVK--VLAI 246

Query: 237 XXXXXXXXXXXXXPNHE-VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYL 295
                         +H+  +GF+YW++PGAF     +     G+F+ + +  + A F Y 
Sbjct: 247 VGYLIYALVIVCGGSHQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQ 306

Query: 296 GTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXX 355
           GTEL GI   E  NPRK VP+AI   ++RI++FY++S+F +GM +P+ND  L        
Sbjct: 307 GTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRL---SAQDA 363

Query: 356 XXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFA 415
                PFV++I NA   VLP I NA +++ V SAANS++YV SR LY LA+   AP+ F+
Sbjct: 364 VIASSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFS 423

Query: 416 KTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFD 475
              + GVPY  ++      LLA++ V++ ++  F + +N  ++ GL +W+ I + +IRF 
Sbjct: 424 YVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFM 483

Query: 476 KAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXX 535
           +A + +GI +  L +++ L P+GA+++ FF  +I  I+ + AF    +D  +F       
Sbjct: 484 QALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFC--PWDVSTFFTSYISL 541

Query: 536 XXXXXXXXXXKLWYKTK-IIPSEEVDL 561
                     +L+Y+ + ++  E++D+
Sbjct: 542 ILLAVLVVGCQLYYRGRFLLKLEDIDI 568

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  282 bits (721), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 182/562 (32%), Positives = 284/562 (50%), Gaps = 35/562 (6%)

Query: 14  VDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGK 73
           + T  D++     G  +IV +++ Q+F   + D++     +  GS+ +    HT      
Sbjct: 1   MSTARDLKDA---GQTSIVDKQTGQVF---ELDTESLSALNTGGSESQKREPHT------ 48

Query: 74  HDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMS 133
                LK+ L++RH+ +                                 + L+++ VM+
Sbjct: 49  -----LKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMN 103

Query: 134 CLGEMAAYIPLDGFTSYST------RYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQ 187
            LGEM  Y+P  G  S  +      RYADP+LGFA G+ Y + Y I++  + TA + V+ 
Sbjct: 104 ALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVT 163

Query: 188 YWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXX 247
           YW     V    WITI L  +  +NF  V+F+GE E++ + +KI  +             
Sbjct: 164 YWTT--VVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWG 221

Query: 248 XXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIVVSE 306
             P+H+ LGF+YW+ PGAF  + T  TG  GRF+   +  +   FA+ LG EL  +  SE
Sbjct: 222 GGPSHDRLGFRYWQKPGAFAYHIT--TGNTGRFLDVWTGVIKGGFAFILGPELVAVTSSE 279

Query: 307 CKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLI-XXXXXXXXXXXXPFVVA 365
             + R+ + KA +   YR+I FY+ S   +G+ V  NDP+L              PFV+A
Sbjct: 280 AMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIA 339

Query: 366 IVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYW 425
           I NA I +LPHI+NACIL   +S+ NS ++ ASRSL  +A D  AP++F K N+ GVPY 
Sbjct: 340 IQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYN 399

Query: 426 SLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGI-D 484
           ++ V   F+ LAY+NVSSGS++ FT+F N  +I G + WI I + Y+RF KA   +G+ D
Sbjct: 400 AVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGLYD 459

Query: 485 KSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXX 544
           +  + ++SP QPYG +F +    +I L   +  F+   +    F                
Sbjct: 460 R--VPFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVG 517

Query: 545 XKLWYKTK---IIPSEEVDLVS 563
            K++ +T    +IP  EVD+ +
Sbjct: 518 HKIYTRTLSTWVIPVAEVDVTT 539

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  283 bits (725), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 174/509 (34%), Positives = 265/509 (52%), Gaps = 27/509 (5%)

Query: 12  SRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFD 71
           SR +   D EK     DD I +E+ S+     QS S    I      DV   +  +   D
Sbjct: 50  SRNNHRSDNEK-----DDAIRMEKISK----NQSASSNGTIREDLIMDVD--LEKSPSVD 98

Query: 72  GKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFV 131
           G  +  +LK+ L++RHV +                                 +  +++ +
Sbjct: 99  GDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPI 158

Query: 132 MSCLGEMAAYIPLDGFTSYS------TRYADPALGFAVGYAYLFKYWIIVPNQLTAGALV 185
           M  LGEM  ++P DG  S        TRY DP+LGFA G+ Y + Y I+V  + TA + V
Sbjct: 159 MCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGV 218

Query: 186 IQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXX 245
           ++YW     V  GVWITI L  ++ +NF  V+ +GE E++ +++KI  +           
Sbjct: 219 VEYWTT--AVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILF 276

Query: 246 XXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIVV 304
               PNH+ LGF+YW++PGAF  + T   G+ G F    +  +   FA+ LG EL  +  
Sbjct: 277 WGGGPNHDRLGFRYWQHPGAFAHHLTG--GSLGNFTDIYTGIIKGAFAFILGPELVCMTS 334

Query: 305 SECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXX-XXXXXPFV 363
           +EC + R+ + KA +  ++R+I FY++    + + VP+NDP L+             PFV
Sbjct: 335 AECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFV 394

Query: 364 VAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVP 423
           + I NAGI VLPHI+N CIL   +SAAN+ ++ ++RSL  +A   +AP+   + NK GVP
Sbjct: 395 IGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVP 454

Query: 424 YWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGI 483
           Y ++ V  L + LAY+NVSS +++VF +F N  +I G L W+   I Y+RF KA    G+
Sbjct: 455 YVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL 514

Query: 484 DKSTLAYQSPLQPYGAWFSLFFCILIGLI 512
               L +++  QPY  WFSL   I+IG+I
Sbjct: 515 -YDRLPFKTWGQPYTVWFSL---IVIGII 539

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  281 bits (720), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 164/493 (33%), Positives = 252/493 (51%), Gaps = 9/493 (1%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           +G+     +K+AL+ RH+ M                                F+  LV+ 
Sbjct: 69  EGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYS 128

Query: 131 VMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
           V+  LGEMA +IP+   FT +S+R+  PA G A GY Y F + I    +L+    +I++W
Sbjct: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
                V    WITI  V +   N   V+++GE E++I+ +K+  +               
Sbjct: 189 TT--AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
               V GF+YW+NPGA+     +    +GRF+ + S  + A F Y GTEL GI   E  N
Sbjct: 247 ITGPV-GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           PRK+VP+AIK  ++RI+VFY      +G+ VP+NDP L             PF++AI N+
Sbjct: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIENS 362

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
           G  VLPHI NA +L  + SA NS++YV SR +YGLA    AP  F +TN  GVPY+++  
Sbjct: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
              F  LAYM +S+G +  F + +N   + G  +W+ I   +IRF +A + +GI +  L 
Sbjct: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482

Query: 490 YQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWY 549
           +++   P+ A+++LFF ++I LI+ F AF   TF    F                 ++W+
Sbjct: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWF 541

Query: 550 KTKIIPS-EEVDL 561
           + +I    +EVD+
Sbjct: 542 RCRIFHRLDEVDI 554

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  281 bits (720), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 169/553 (30%), Positives = 278/553 (50%), Gaps = 21/553 (3%)

Query: 13  RVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKN--VVTHTSEF 70
           + D+D D+E  Q           + +LF    SD   + ++    S   N  +    +E 
Sbjct: 35  KYDSDTDMEPSQ-----RKKAAMAGKLF----SDQLSYNVSVADNSSAANGDLDLSDTEE 85

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
            G     R+K+AL+ RH+ M                                F+G +++F
Sbjct: 86  AGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYF 145

Query: 131 VMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
           +   LGEMA +IP+    T +S R+  PA G   GY Y F + I    +++    VIQYW
Sbjct: 146 ITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYW 205

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
            D   V    WI I  V +  +NF  V+ +GE+E++++++K+  +               
Sbjct: 206 TD--AVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGS 263

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
               + GF+YW+NPG +     +    +GRF+ + S  + A F Y GTEL GI   E  N
Sbjct: 264 SQGPI-GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 322

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           PRK+VP+AI   ++RI +FY++S+F +G+ VP+ND  L             PFV++I NA
Sbjct: 323 PRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTL---SSGDSYIASSPFVISIQNA 379

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
           G   LP I NA +++ + SAANS++YV SR LY LA    AP+ FA   K GVP+  ++V
Sbjct: 380 GTYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIV 439

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
                LLA++ V++ ++  F + +N  ++ GL +W  I +++IRF +A + +GI +  L 
Sbjct: 440 TASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLP 499

Query: 490 YQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWY 549
           +++ L P+GA++S FF  +I  I+ F AF    +D  +F                 +L+Y
Sbjct: 500 FKAKLMPWGAYYSAFFVFVIIFIQGFEAF--TPWDTTTFFTSYISLILLVVVFIGCQLYY 557

Query: 550 KTK-IIPSEEVDL 561
           + + ++  E++D+
Sbjct: 558 RCRFLLKVEDIDI 570

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  281 bits (718), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 168/564 (29%), Positives = 287/564 (50%), Gaps = 19/564 (3%)

Query: 7   LDAQLSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTH 66
           ++ Q+S+ +   +I    +  ++  V E+     Y G++ +K   IT+     V++    
Sbjct: 5   VNIQMSK-EGQYEINSSSIIKEEEFVDEQ-----YSGENVTK--AITTER--KVEDDAAK 54

Query: 67  TSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGL 126
            +E     +   +K+ L+ RH+ M                                F+G 
Sbjct: 55  ETE-SSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGT 113

Query: 127 LVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALV 185
           +++ V   LGEM  +IP+   F+ ++ R+  PALG   GY Y   +      +L+    V
Sbjct: 114 VIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKV 173

Query: 186 IQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXX 245
           IQYW +   V    WI I    + ++N   V+++GE E+ I+++K+  +           
Sbjct: 174 IQYWTE--AVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVV 231

Query: 246 XXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVS 305
                +   +GF+YW+NPGA+     +    +GRF+ + S  + A F Y GTEL GI   
Sbjct: 232 CGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAG 291

Query: 306 ECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVA 365
           E  NPRKA+P+AIK  + RI+VFY++S+F +G+ VP+NDP L             PF+++
Sbjct: 292 EAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL---DSDGIFVSSSPFMIS 348

Query: 366 IVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYW 425
           I N+G  VLP I NA +LI + SA NS++Y+ SR LY L+ ++ APR  +   + GVPY+
Sbjct: 349 IENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYF 408

Query: 426 SLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDK 485
           S+L   +F  LA++ VS+GS + F + +N   + G  +W+ I  ++IRF +A R +GI +
Sbjct: 409 SVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISR 468

Query: 486 STLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXX 545
             L Y++ + P+ A+++ FF  LI LI+ F AF   TF    F                 
Sbjct: 469 DDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIWLSF 527

Query: 546 KLWYKTKII-PSEEVDLVSFKEAV 568
           ++W+K +++   +++D+ S +  +
Sbjct: 528 QVWFKCRLLWKLQDIDIDSDRRQI 551

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  281 bits (718), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 171/571 (29%), Positives = 286/571 (50%), Gaps = 26/571 (4%)

Query: 8   DAQLSRVDTDEDIEKQQLFGDDNIVIER--SSQLFYDGQSDSKVHGITSGHGSDVKNVVT 65
           D   +  D  E IE Q     DN + ++  +S+L     + S+   +   H  D +    
Sbjct: 21  DDSTTSYDNFEIIEIQHNDSKDNSIKKKIPNSELASLTHAYSRSR-VEPEHDEDAE---- 75

Query: 66  HTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVG 125
                +  ++  ++K+ L+ RH+ M                                F+G
Sbjct: 76  -----EADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFMG 130

Query: 126 LLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
            +V+FV   LGEMA +IP+    T +S R+  PA G A GY Y F + I    +++    
Sbjct: 131 SIVYFVTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQ 190

Query: 185 VIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXX 244
           VIQYW D   V    WI I  V +  +NF  V+ +GE+E++++ +K+  +          
Sbjct: 191 VIQYWTD--AVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALII 248

Query: 245 XXXXXPNHEVLGFKYWKNPGAFKEYSTA----ITGAK--GRFVSFASVFVLALFAYLGTE 298
                     +GF+YW+NPGA+    T+    I  +K  GRF+ + +  + A F Y GTE
Sbjct: 249 VCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTE 308

Query: 299 LCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXX 358
           L GI   E  NPRK VP+AI   ++RI++FY++S+F +G+ VPF D  L           
Sbjct: 309 LVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRL---SDDTTVIA 365

Query: 359 XXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTN 418
             PFV++I NAG  +LP I NA +++ V SAANS++YV SR LY LA    AP+IFA+  
Sbjct: 366 SSPFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVT 425

Query: 419 KQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAF 478
           +QGVP+  ++   L  LLA++ V + ++  F + V+  ++ GL +W+ I + ++RF +  
Sbjct: 426 RQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVL 485

Query: 479 RVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXX 538
           + +GI +  L +++   P+G++++ F+  +I  ++ F AF    FD  +F          
Sbjct: 486 KQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAF-SPHFDVTTFFTDYISLILL 544

Query: 539 XXXXXXXKLWYKTKII-PSEEVDLVSFKEAV 568
                  +L+Y+ + +   E+VD+ S +  +
Sbjct: 545 AVVFIGAQLYYRCRFLWKLEDVDIDSDRREI 575

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  280 bits (717), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 152/455 (33%), Positives = 244/455 (53%), Gaps = 7/455 (1%)

Query: 65  THTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFV 124
           + T   +G     ++K+AL+ RHVSM                                F+
Sbjct: 101 SDTESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFM 160

Query: 125 GLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGA 183
           G +V+FV   +GEMA +IP+    T +S+R+  PA G A GY Y F + I    +L+   
Sbjct: 161 GTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTG 220

Query: 184 LVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXX 243
            VI+YW +   V    WI I  V +   NF  V+F+GE+E++++++K+  +         
Sbjct: 221 QVIEYWTE--AVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALV 278

Query: 244 XXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIV 303
                     + GF+YW+NPG +     +    +GRF+ + +  + A F Y GTEL GI 
Sbjct: 279 IVCGGSKQGPI-GFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGIT 337

Query: 304 VSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFV 363
             E  NPR+ VP+AI    +RI+ FY++S+F +G+ VP+N   L             PFV
Sbjct: 338 AGEAANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSL---DKTTTVIASSPFV 394

Query: 364 VAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVP 423
           ++I NAG   LP I NA +L+ + SAANS++YV SR L+ LA    AP++F+    QGVP
Sbjct: 395 ISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVP 454

Query: 424 YWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGI 483
           +  ++V  L  LLA++ V+  ++E F + +N  ++ GL +W+ I I++IRF +  + +GI
Sbjct: 455 FMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGI 514

Query: 484 DKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAF 518
            +  L ++S L PYGA+++ F+  +I  ++ F AF
Sbjct: 515 SRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAF 549

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  278 bits (712), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 173/550 (31%), Positives = 275/550 (50%), Gaps = 35/550 (6%)

Query: 14  VDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHT------ 67
           ++T+E +E     G   IVI+ +  L        + H +    G++ KN  T T      
Sbjct: 6   INTEETLE-----GKSKIVIKSTESL--------EQHDL---QGNEDKNTPTTTPSKENV 49

Query: 68  --SEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVG 125
             +E D  H+   +K+ L  RH++M                                F+G
Sbjct: 50  SENEKDEYHE---VKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLG 106

Query: 126 LLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
            +V+ V   LGEMA +IP+   FT +S R+  PALG A GY Y F + +    +L+    
Sbjct: 107 TVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQ 166

Query: 185 VIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXX 244
           +IQ+W     V    WI+I  V +   N   VR +GEIE++I+ +K+  +          
Sbjct: 167 IIQFWTF--AVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCI 224

Query: 245 XXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVV 304
                    V GF+YW+NPG +     +   A+ RF+ +AS  + A F + GTEL GI  
Sbjct: 225 VCGAGKTGPV-GFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITA 283

Query: 305 SECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVV 364
            E  NPR+ VPKAI+  ++RI+VFY++S+F +G+ VP++D   +            PF++
Sbjct: 284 GEAANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDD---VKLKSENSYVSSSPFII 340

Query: 365 AIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPY 424
           AI N+G  +LPHI N  IL+ + SA NS++Y+ SR L+GLA +   P++FAKT K GVP 
Sbjct: 341 AIENSGTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPV 400

Query: 425 WSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGID 484
           ++++   LF  LA+M  S+G  E F + +N V + G  SW+ I   +IRF +  + +GI 
Sbjct: 401 FAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGIS 460

Query: 485 KSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXX 544
           ++ L +++   PY A+++    I+I   + F AF    FD  +F                
Sbjct: 461 RNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGS 519

Query: 545 XKLWYKTKII 554
            +LW+K + +
Sbjct: 520 FQLWFKCRYV 529

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  278 bits (712), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 166/505 (32%), Positives = 256/505 (50%), Gaps = 9/505 (1%)

Query: 66  HTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVG 125
            + E +G      +K+AL+ RHVSM                                F+G
Sbjct: 60  ESEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMG 119

Query: 126 LLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
            +V+FV   LGEMA +IP+    T +S R+  PA G A GY Y F + I    +L+    
Sbjct: 120 SVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQ 179

Query: 185 VIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXX 244
           +I YW D   V    WI I  V +   NF  V+++GE E+ ++++K+ +           
Sbjct: 180 IINYWTD--AVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKV-IAIVGYLLYALI 236

Query: 245 XXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVV 304
                 +   +GF+YW+NPG +   + A    K RF+ +    V A F Y GTEL GI  
Sbjct: 237 IVCGGSSQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITA 296

Query: 305 SECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVV 364
            E  NPRK VPKAI    +RI+VFY+ S+F +G+ VP+N P L             PFV+
Sbjct: 297 GEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQL---ESNSAVIASSPFVI 353

Query: 365 AIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPY 424
           +I NAG  VLP I NA +L+ + SA NS++YV SR LY LA+   AP+ F+   KQGVPY
Sbjct: 354 SIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPY 413

Query: 425 WSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGID 484
             ++   L  LLA++  +  ++  F + +N  ++ GL +W  I + +IRF +  +++GI 
Sbjct: 414 LGVICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGIS 473

Query: 485 KSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXX 544
           + +L +++ L P+GA+++ FF  LI  I+ F AF    FD   F                
Sbjct: 474 RDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAF-APRFDVSEFFTAYISLILLVVLFIL 532

Query: 545 XKLWYKTKIIPS-EEVDLVSFKEAV 568
            +L+Y+ + +   E++D+ S +  +
Sbjct: 533 CQLYYRCRFLTKIEDIDIDSDRREI 557

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  278 bits (712), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 176/549 (32%), Positives = 281/549 (51%), Gaps = 30/549 (5%)

Query: 27  GDDNIVIERSSQLF-YDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEA 85
           G+  +  +++ Q++  D +S S++ G            V+ +    G H    LKK L++
Sbjct: 11  GETTVTDKQTGQVYEIDIESYSQISGPK----------VSSSDAPQGDHT---LKKGLKS 57

Query: 86  RHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPLD 145
           RH+ +                                 + ++++ VM+ LGEM  Y+P D
Sbjct: 58  RHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALGEMVCYLPGD 117

Query: 146 GFTSYS------TRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGV 199
           G +S        TRY DP+LGFA G+ Y + Y I+V  + TA + V+QYW     V  G 
Sbjct: 118 GSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYWTT--AVPKGA 175

Query: 200 WITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKY 259
           WITI L  ++ +NF  V+F+GE E++ +++KI  +               P+H+ LGF+Y
Sbjct: 176 WITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLGFRY 235

Query: 260 WKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIVVSECKNPRKAVPKAI 318
           W+ PGAF  + T  +G  GRF+   +  +   FA+ LG EL  +  +E ++ R+ + KA 
Sbjct: 236 WQKPGAFAYHIT--SGNTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDARRNIQKAS 293

Query: 319 KLTMYRIIVFYLISIFLLGMCVPFNDPLL-IXXXXXXXXXXXXPFVVAIVNAGIPVLPHI 377
           +  +YR+I FY+ S   +G  V +ND  L              PFV+ I NAGI VLPHI
Sbjct: 294 RRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVLPHI 353

Query: 378 MNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLA 437
           +N CIL   +S+ NS ++ ASRSL  ++ +  AP+I  + N+ GVPY ++ +  L + +A
Sbjct: 354 INVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLSCIA 413

Query: 438 YMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPY 497
           Y+NVSS +++VFT+F N  +I G + WI I I Y+RF KA   Q + +  + +++P QPY
Sbjct: 414 YLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNLYER-VPFKTPFQPY 472

Query: 498 GAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLW---YKTKII 554
           G WF +    +I L   +  F+   ++   F                 KLW   +KT  I
Sbjct: 473 GTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWTRTWKTWAI 532

Query: 555 PSEEVDLVS 563
           P  E+D+ +
Sbjct: 533 PVPEIDVTT 541

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  279 bits (713), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 161/458 (35%), Positives = 243/458 (53%), Gaps = 9/458 (1%)

Query: 72  GKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFV 131
           GK    ++K+AL+ RH+ M                                F+G +V+FV
Sbjct: 95  GKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFV 154

Query: 132 MSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190
              LGEMA +IP+    T ++ R+  PALG + GY Y F + I    +L+    +IQYW 
Sbjct: 155 TQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWT 214

Query: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXP 250
              KV    WI I  V +  +NF  V+ +GEIE+++S+VK+  +                
Sbjct: 215 Y--KVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGSR 272

Query: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310
              + GF+YW++  AF +   +    + RF+ + S  + A F Y GTEL GI   E  NP
Sbjct: 273 QGPI-GFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANP 331

Query: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAG 370
           RK VP+AI   ++RI +FY++S+F +G+ VP+ND  L             PFV++++NAG
Sbjct: 332 RKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRL---SDGSAIIASSPFVISMLNAG 388

Query: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430
              LP I NA ILI V SAANSD+Y+ASR LY LA    AP+ F   N+ GVPY  + V 
Sbjct: 389 TSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVT 448

Query: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490
            L   LA++ VS+ ++  F + +N  ++ GL +W  I   +IRF +A + +GI +  L +
Sbjct: 449 CLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPF 508

Query: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
           ++   P+GA+++ FF  LI  I+ + AF    +D KSF
Sbjct: 509 KARFMPWGAYYAAFFVGLIIFIQGYDAF--TPWDTKSF 544

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  277 bits (709), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 172/521 (33%), Positives = 257/521 (49%), Gaps = 12/521 (2%)

Query: 53  TSGHGSDVKNVVTHTSEFDGKHDGIR---LKKALEARHVSMXXXXXXXXXXXXXXXXXXX 109
             G+G  V N        DG+   +R   +K+AL+ RH+ M                   
Sbjct: 45  NDGYGYRVDNEYDVDDSVDGEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPL 104

Query: 110 XXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYL 168
                        F+  + F VM  LGEMA YIP+   F+ +S R+  PA G A GY Y 
Sbjct: 105 QNAGPVGMLIAYLFMATIAFSVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYW 164

Query: 169 FKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISA 228
           F + I    +L+    ++QYW    KV    WI+I  V I  +NF  V+F+GE E++I+ 
Sbjct: 165 FSWSITFALELSVIGQIVQYWTF--KVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAF 222

Query: 229 VKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFV 288
           +K+  +                   V GF+YW++  AF +   +    + RF+ + S  +
Sbjct: 223 IKVVAIVGFIIYCFIMVCGAGKTGPV-GFRYWRHGYAFGDGIISKNKNEARFLGWVSSLI 281

Query: 289 LALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLI 348
            A F Y GTEL GI   E  NPRK VPK+IK T++RI++FY+ S+  +G+ VPFND  L 
Sbjct: 282 NAAFTYQGTELVGITAGEAANPRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGL- 340

Query: 349 XXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDN 408
                       PF++AI N+G   LP I NA IL  V SAANSD+YV SR +Y +A + 
Sbjct: 341 --QDSRSYAASSPFILAIKNSGTKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNR 398

Query: 409 KAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISIL 468
            AP I AK +K GVPY ++L       LAY+  SS  + VF + +N   + G  SW  I 
Sbjct: 399 LAPPILAKASKGGVPYAAVLFTSAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLIS 458

Query: 469 ITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
            +++RF KA + +GI ++ L +++   P+ A +S FF  LI L++ F  F    F    F
Sbjct: 459 WSHLRFMKALKQRGISRNDLPFKASFMPWIAIYSFFFMTLIILVQGFTCFT-PHFQASDF 517

Query: 529 XXXXXXXXXXXXXXXXXKLWYKTK-IIPSEEVDLVSFKEAV 568
                            ++W++   ++P  E+D+ + +  V
Sbjct: 518 VASYISVGLFFVIWAVFQIWFRCPLLVPIAEIDIDTDRRDV 558

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  275 bits (702), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 155/448 (34%), Positives = 245/448 (54%), Gaps = 8/448 (1%)

Query: 123 FVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
           F+G +++ V   LGEMA +IP+   F+ ++ R+  PALG   GY Y   +      +L+ 
Sbjct: 34  FMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSV 93

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
              +IQYW D   V    WI I    +  +N   V+++GE E+ I+++K+  +       
Sbjct: 94  LGQIIQYWTD--AVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIIYS 151

Query: 242 XXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCG 301
                        +GF+YW+NPGA+     +    +GRF+ + S  + A F Y GTEL G
Sbjct: 152 FCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVG 211

Query: 302 IVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXP 361
           I   E  NPRKAVP+AIK  + RI+VFY++S+F +G+ VP+NDP L             P
Sbjct: 212 ITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKL---DSDGSFVSASP 268

Query: 362 FVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQG 421
           F+++I N+G  VLP I NA +LI + SA NS++Y+ SR LY L+ ++ APR  +   K G
Sbjct: 269 FMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAPRFLSIVTKGG 328

Query: 422 VPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ 481
           VPY+++L   +F  LA++  S+GS + F + +N   + G  +W+ I  ++IRF +A   +
Sbjct: 329 VPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAISKR 388

Query: 482 GIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXX 541
           GI ++ L Y++ + PY A+++ FF  LI LI+ F AF   +F    F             
Sbjct: 389 GISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAF-APSFQPVDFVAAYISVFLFVAI 447

Query: 542 XXXXKLWYKTKIIPS-EEVDLVSFKEAV 568
               +LW+K  II   ++VD+ S +  +
Sbjct: 448 WFSFQLWFKCPIILKLQDVDIDSDRREI 475

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  278 bits (710), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 160/452 (35%), Positives = 240/452 (53%), Gaps = 9/452 (1%)

Query: 78  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGE 137
           ++K+ L+ RH+ M                                F+G LVF V   LGE
Sbjct: 101 QVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160

Query: 138 MAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVN 196
           MA +IP+   FT +++R+     G A GY Y F + I    +L+    VI++W    KV 
Sbjct: 161 MATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTF--KVP 218

Query: 197 PGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLG 256
              WI+I  V I+ +NF  V+ +GE E++++++K+  +                   V G
Sbjct: 219 LAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPV-G 277

Query: 257 FKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPK 316
           F+YW++PG +     +    + RF+ + S  + A F Y GTEL GI   E  NPRK+VP+
Sbjct: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337

Query: 317 AIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPH 376
           AIK    RI++FY++S+F +G+ VP+NDP L             PF++AI N+G  VLPH
Sbjct: 338 AIKKVSVRILLFYILSLFFIGLLVPYNDPKL---SSTDSYVSASPFIIAIQNSGTKVLPH 394

Query: 377 IMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALL 436
           I NA IL  + SAANS++YV SR LYGL+    AP+ F KT + GVP+ ++L    F  L
Sbjct: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGAL 453

Query: 437 AYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQP 496
           AYM  S+G    F + +N   + G  +W+SI I++IRF +  + +G+ +  L Y++ L P
Sbjct: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513

Query: 497 YGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
             A++  FF  LI LI+ F AF    FD  +F
Sbjct: 514 GLAYYGAFFVTLIILIQGFTAF-APKFDSTAF 544

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  276 bits (706), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 174/533 (32%), Positives = 275/533 (51%), Gaps = 10/533 (1%)

Query: 36  SSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDG-KHDGIRLKKALEARHVSMXXXX 94
           +S L  + + D+  + + S   +    +    S+ +G K D   L+K L +RH+ +    
Sbjct: 2   TSDLKANLEKDTSFYDVKSQGETYSGTLNQLESQLEGTKCDENNLEKGLSSRHIQLIALG 61

Query: 95  XXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPLDG-FTSYSTR 153
                                        +  +V+ VM+ L EM  Y+P  G     ++R
Sbjct: 62  GCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEMICYLPQQGTVPELTSR 121

Query: 154 YADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINF 213
           Y DP+LGFA G+ Y + Y I+V  +L+A A V+QYW D  KV+  VWITI LV ++ +NF
Sbjct: 122 YVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTD--KVHVAVWITIFLVIVVGLNF 179

Query: 214 LGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAI 273
             V+F+GE E++ +++KI  +               P+H+ LGF+YW NPG F  + T  
Sbjct: 180 APVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYHITG- 238

Query: 274 TGAKGRFVSFASVFVLALFAY-LGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLIS 332
            G  GRF+   +  + + FA+ L  EL G+   E K+ R+ + KA +  ++RII FY+ S
Sbjct: 239 -GNTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITS 297

Query: 333 IFLLGMCVPFNDPLLIXXXXX-XXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAAN 391
              +G  +  +DP LI             PFV  I NAGIPVL HI+NA IL   +S+AN
Sbjct: 298 TLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSAN 357

Query: 392 SDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTY 451
           S +Y +SRS+  LA    AP++F + N+ GVPY ++ +    + L Y+N SS S++VFT+
Sbjct: 358 SFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTW 417

Query: 452 FVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGL 511
             N  +I G + W  I ITY+RF KA     + +  + ++S LQPY  +F + F +L+ L
Sbjct: 418 LSNICTISGFIGWALIGITYLRFRKAIFYNNLYER-VPFKSALQPYFTYFFVVFVVLLCL 476

Query: 512 IKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTK-IIPSEEVDLVS 563
              +  F+   ++   F                 K+W+KT+  IP  E+D+++
Sbjct: 477 TNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTRWYIPFREIDVIT 529

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  276 bits (705), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 179/547 (32%), Positives = 278/547 (50%), Gaps = 20/547 (3%)

Query: 34  ERSS--QLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGK--HDGIRLKKALEARHVS 89
           +R S  Q F     D  +  I     +D  +        +    HD   +K+ L+ RH+ 
Sbjct: 14  QRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDA-EVKRELKQRHIG 72

Query: 90  MXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFT 148
           M                                FVG L + V   LGEMA +IP+   FT
Sbjct: 73  MIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFT 132

Query: 149 SYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAI 208
            +++R+  P++G AVGY Y F + +    +L+    ++ YW     V    WI+I  V +
Sbjct: 133 VFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTF--AVPIAAWISIFWVIL 190

Query: 209 ITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKE 268
             +N   V+F+GEIE++++AVK+  +                   V GF+YW+NPG + +
Sbjct: 191 TALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPV-GFRYWRNPGPWGD 249

Query: 269 YSTA----ITGAK--GRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTM 322
             T+    I+  K  GRF+ + +  + A F Y GTEL GI   E  NPRK VP+AIK  +
Sbjct: 250 GLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVV 309

Query: 323 YRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACI 382
           +RI++FY+ S+F +G+ VPF+DP L             PF++AI N+G  +LP I NA I
Sbjct: 310 FRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVSSS---PFIIAIENSGTKILPDIFNAII 366

Query: 383 LIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVS 442
           LI + SA NS++YV SR L+ LA    AP+I ++T K+GVP+ S+L   +F +LAYM  +
Sbjct: 367 LITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETT 426

Query: 443 SGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFS 502
            G   VF + VN  +I G  +W+ ILI++IRF +  + +GI +  L +++ L P  A+++
Sbjct: 427 QGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYA 486

Query: 503 LFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTK-IIPSEEVDL 561
           +F  ++I + + F AF   TFD   F                 +LW+K + I   E+VD+
Sbjct: 487 VFCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDI 545

Query: 562 VSFKEAV 568
            S +  V
Sbjct: 546 DSNRRDV 552

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  275 bits (704), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 169/524 (32%), Positives = 263/524 (50%), Gaps = 14/524 (2%)

Query: 8   DAQLSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQS--DSKVHGITSGHGSDVKNVVT 65
           D Q S  D   +I K ++   D   I  ++Q   D  S  DS         G D      
Sbjct: 32  DEQTSPDDHSIEIIKNEILEKDKKKIAHTNQFSSDIHSITDSLARSRLPHLGDDDDEEDA 91

Query: 66  HTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVG 125
             +++   HD   +K+AL+ RH+ M                                F+G
Sbjct: 92  EEAQY---HD-TEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMG 147

Query: 126 LLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
            +++ +   LGEMA +IP+    T +S R+  PA G A GY Y F + I    +++    
Sbjct: 148 SIIYSITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQ 207

Query: 185 VIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXX 244
           VI+YW    KV    WI I  V +  +NF  V+ +GEIE++I+ +K+  +          
Sbjct: 208 VIEYWTK--KVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALII 265

Query: 245 XXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVV 304
                    + GF+YW+NPG +     +      RF+ + S  + A F Y GTEL GI  
Sbjct: 266 VCGGSSQGPI-GFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITA 324

Query: 305 SECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVV 364
            E  NPRK+VP+AI   ++RI +FY++S+F +G+ VP++DP L             PFV+
Sbjct: 325 GEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASS---PFVI 381

Query: 365 AIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPY 424
           +I NAG  +LP I NA ++I V SAANS++YV SR LY LA    AP+ FA   + GVPY
Sbjct: 382 SIQNAGTKILPDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPY 441

Query: 425 WSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGID 484
             +L      LLA++ V++ ++  F + +N  ++ GL +W+ I I++IRF +A + +GI 
Sbjct: 442 LGVLCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGIS 501

Query: 485 KSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
           +  L +++   P+ A+++ FF  +I  I+ F AF    FD  +F
Sbjct: 502 RDDLPFKAKFMPWAAYYATFFVTVIIFIQGFQAF-SPHFDVTAF 544

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  275 bits (703), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 160/486 (32%), Positives = 258/486 (53%), Gaps = 9/486 (1%)

Query: 78  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGE 137
            +K+ L+ RH+ M                                F+  +VF V   LGE
Sbjct: 96  EVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQSLGE 155

Query: 138 MAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVN 196
           MA +IP+   FT +S+R+  PA+G A GY Y F + +    +L+    +IQ+W     V 
Sbjct: 156 MATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTH--AVP 213

Query: 197 PGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLG 256
              WI I  V +  +N   V+F+GE E++++++K+  +                   V G
Sbjct: 214 LSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTGPV-G 272

Query: 257 FKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPK 316
           F+YW+NPG +     +    +GRF+ + S  + A F Y GTEL GI   E  NPRK VP+
Sbjct: 273 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 332

Query: 317 AIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPH 376
           AIK   +RI++FY++S+F +G+ VP++D  L             PF++AI N+G  +LPH
Sbjct: 333 AIKKVTFRILIFYILSLFFIGLLVPYDDEKL---TSTDSYISASPFIIAIENSGTKILPH 389

Query: 377 IMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALL 436
           I NA IL  + SA NS++YV SR L+GLA    AP+ F  T++ GVPY+S+     F  L
Sbjct: 390 IFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGAL 449

Query: 437 AYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQP 496
           A++ VSSG ++ F + +N +S+ G  +W+ I I ++RF +A + +GI +  L +++   P
Sbjct: 450 AFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMP 509

Query: 497 YGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTKIIPS 556
           + A++S+FF  +I +I+ F AF   TF+   F                 +L++++K++ +
Sbjct: 510 HLAYYSIFFMTIIIIIQGFTAF-APTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWT 568

Query: 557 -EEVDL 561
            EEVD+
Sbjct: 569 VEEVDI 574

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  275 bits (703), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 161/449 (35%), Positives = 245/449 (54%), Gaps = 13/449 (2%)

Query: 79  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEM 138
           LKK L++RH+ +                                 + L+++ VM+ LGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 139 AAYIP-LDGFTSYS-----TRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192
             ++P  +G +  S     TRYADP+LGFA G+ Y + Y I++  + TA + V+ YW   
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTT- 223

Query: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNH 252
             V  G WI I L  +  +NF  V+ +GE E++ + +KI  +               P H
Sbjct: 224 -AVPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTH 282

Query: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIVVSECKNPR 311
           + LGF+YW++PGAF  + T  TG  GRF+   +  +   FA+ LG EL  I  SE  + R
Sbjct: 283 DRLGFRYWQHPGAFAYHIT--TGNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDAR 340

Query: 312 KAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXX-XXPFVVAIVNAG 370
           + + KA +   YR++ FY+ S   +G+ V   DP+L              PFV+AI NA 
Sbjct: 341 RNIEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAH 400

Query: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430
           I VLPHI+NACIL   +S+ NS ++ ASRSL  +A D  APRI  + N+QGVPY+++ + 
Sbjct: 401 IKVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALS 460

Query: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490
             F+ LA++NVSSGS++ FT+F N  +I G + WI I + Y++F KA   +G+ +  + +
Sbjct: 461 AAFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGLYER-VPF 519

Query: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFL 519
           +SPLQPYG +F +    LI L   + +F+
Sbjct: 520 KSPLQPYGTYFFIVVVSLICLTNGYASFV 548

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  273 bits (697), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 164/532 (30%), Positives = 260/532 (48%), Gaps = 15/532 (2%)

Query: 42  DGQSDSKVHGITSG---HGSDVKNVVTHTSEFDGKHDGIR---LKKALEARHVSMXXXXX 95
           D  S + +    +G   H     +  T   E + +  G     L K L++RH+ +     
Sbjct: 3   DRASSASIEKADNGGYMHKVKTPHSRTSLEELETQSAGSEYNTLHKGLQSRHIQLIALGG 62

Query: 96  XXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRY 154
                                       +  +V+ +M  L EM  Y+P  G      +RY
Sbjct: 63  CIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEMICYLPQQGSVPELVSRY 122

Query: 155 ADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFL 214
            DP+LGFA G+ Y + Y I+V  +L+A A V+ YW   + V    WITI LV ++ +NF 
Sbjct: 123 VDPSLGFATGWNYAYAYAILVAAELSAAASVVSYW--DNPVPMAAWITIFLVVVVGLNFT 180

Query: 215 GVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAIT 274
            V+++GE E++ +++K+  +               PNH+  GF+YWKNPG F    +   
Sbjct: 181 AVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFA--MSLAP 238

Query: 275 GAKGRFVSFASVFVLALFAY-LGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISI 333
           G+ GRF+      + + FA+ L  EL GI   E ++ R+   KA +  +YRII FY+   
Sbjct: 239 GSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCA 298

Query: 334 FLLGMCVPFNDPLLIXXXXXXXX-XXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANS 392
            ++G+ +   DP LI             PFV  I NAGIPVL H++N  IL   +SA NS
Sbjct: 299 LMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNS 358

Query: 393 DLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYF 452
            +Y ++R +  LA +  AP+   K N+ GVPY +++V  L A LAY+NV + S+ VF + 
Sbjct: 359 FMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWL 418

Query: 453 VNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLI 512
            N  +I G + W ++ I +IRF +      + +S + YQ PLQPY A++  F  +++ L 
Sbjct: 419 SNICTISGFIGWFAMGIAFIRFRRGIVFNNL-QSRIPYQGPLQPYIAYYFTFMTVVVCLT 477

Query: 513 KNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTK-IIPSEEVDLVS 563
             F  FL   ++   F                 KLW++T+  IP E++D+++
Sbjct: 478 NGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWYIPVEQIDVIT 529

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  273 bits (699), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 170/503 (33%), Positives = 261/503 (51%), Gaps = 19/503 (3%)

Query: 27  GDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEAR 86
           G  +IV++ SS+  +        HG  S  G + +  V       G      +K+ L+ R
Sbjct: 48  GSSSIVVDGSSRHLHGS------HGSHSVSGDEDEPYVDQ-----GVVQDAEVKRELKQR 96

Query: 87  HVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-D 145
           H+ M                                F+  +VF V   LGEMA +IP+  
Sbjct: 97  HIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTS 156

Query: 146 GFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILL 205
            FT +S+R+  P++G A GY Y F + I    +L+    +IQ+W D   V    WI I  
Sbjct: 157 SFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTD--AVPLSAWIVIWW 214

Query: 206 VAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGA 265
             +  +N   V+F+GE E++++++K+  +                   V GF+YW+NPG 
Sbjct: 215 FILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV-GFRYWRNPGP 273

Query: 266 FKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRI 325
           +     +   A+GRF+ + S  + A F Y GTEL GI   E  NPRK VP+AIK   +RI
Sbjct: 274 WGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRI 333

Query: 326 IVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIF 385
           ++FY++S+F +G+ VPF+DP L             PF++AI N+G  VLPHI NA IL  
Sbjct: 334 LIFYILSLFFIGLLVPFDDPKLSSDDSYVSSS---PFIIAIQNSGTKVLPHIFNAVILST 390

Query: 386 VFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGS 445
           + SA NS++YV SR ++GLA    APR F  T K GVPY ++L    F  LA++ VSSG 
Sbjct: 391 IISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGG 450

Query: 446 SEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFF 505
           ++ F + +N V + G  +W+ I I ++RF +    +GI +  L +++ L P+ A++++FF
Sbjct: 451 AKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFF 510

Query: 506 CILIGLIKNFPAFLGDTFDYKSF 528
            I+I +I+ F AF   TF+   F
Sbjct: 511 MIIIIIIQGFTAF-APTFNGSDF 532

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  271 bits (693), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 153/446 (34%), Positives = 237/446 (53%), Gaps = 8/446 (1%)

Query: 74  HDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMS 133
           HD   +K+ L+ RH+ M                                F+G LV+ V  
Sbjct: 69  HDA-EVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQ 127

Query: 134 CLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192
            LGEMA +IP+   FT ++ R+  P++G A GY Y F + +    +L+    VIQYW   
Sbjct: 128 SLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTY- 186

Query: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNH 252
             V    WI+I  V I   N   V+++GE+E++I+ +K+  +                  
Sbjct: 187 -AVPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTG 245

Query: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRK 312
            V GF+YW+NPG +     +    + RF+ + S  +   F Y GTEL GI   E  NPRK
Sbjct: 246 PV-GFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRK 304

Query: 313 AVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIP 372
           AVP+AIK  ++RI+ FY+ S+F +G+ VP+ND  L             PF++AI N+G P
Sbjct: 305 AVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDAL---NNTDSYVASSPFIIAIKNSGTP 361

Query: 373 VLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVL 432
           VLPHI NA I   + SA NS++YV SR L+GL+ +  AP+I ++T K GVP+ ++LV  +
Sbjct: 362 VLPHIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSV 421

Query: 433 FALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQS 492
              LAYM  S+G    F + +N  ++ G  +W+ I +++IRF +A + +GI +  L +++
Sbjct: 422 VGALAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKA 481

Query: 493 PLQPYGAWFSLFFCILIGLIKNFPAF 518
            L P  A+++ F   +I +I+ F AF
Sbjct: 482 ALMPGLAYYASFLMFVIIIIQGFTAF 507

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  270 bits (689), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 162/516 (31%), Positives = 260/516 (50%), Gaps = 11/516 (2%)

Query: 55  GHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXX 114
           GH  D K +     E   + +   +++ L+ RH+ M                        
Sbjct: 4   GHNQDSK-MKEEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGP 62

Query: 115 XXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWI 173
                   F+  L + V   LGEMA +IP+   FT +S R+  PA G A GY Y F + I
Sbjct: 63  VGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCI 122

Query: 174 IVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITV 233
               +L+    VIQ+W     V    WI+I  V +  +N   V+++GE E++++ VK+  
Sbjct: 123 TFALELSVVGQVIQFWTF--AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVA 180

Query: 234 MXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFA 293
           +                   V GF+YW++PGAF     A    + RF+ + S  + A F 
Sbjct: 181 IMGFLIYCFCMVCGAGVTGPV-GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFT 239

Query: 294 YLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXX 353
           + GTEL GI   E  NPRK VP+AIK  ++RI+ FY++S+F +G+ VP++D  L      
Sbjct: 240 FQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKL---TST 296

Query: 354 XXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRI 413
                  PF++AI N+G  VLPHI NA I+  + SA NS++YV SR +YGL+    AP I
Sbjct: 297 DSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGI 356

Query: 414 FAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIR 473
            ++T + GVP+ ++LV  LF  LAYM  S+G  + F + +N   + G  +W+ I +++IR
Sbjct: 357 LSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIR 416

Query: 474 FDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXX 533
           F +A  ++GI +  L +++   P  A++ +FF  LI +I+ F +F    ++   F     
Sbjct: 417 FMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYI 474

Query: 534 XXXXXXXXXXXXKLWYKTKII-PSEEVDLVSFKEAV 568
                       + W++ ++I   E+VD+ + + AV
Sbjct: 475 SVFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAV 510

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  270 bits (689), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 164/527 (31%), Positives = 262/527 (49%), Gaps = 12/527 (2%)

Query: 44  QSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXX 103
           ++D ++  +T   G   ++   HT E  G +    +K+AL+ARH+SM             
Sbjct: 25  ENDIELQSVTPATGEFPED---HTEE--GDYQETEVKRALKARHISMIALGGTIGTGLFI 79

Query: 104 XXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFA 162
                              F+G +V+ +   LGEMA +IP+    T +S R+  PA G A
Sbjct: 80  VIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVA 139

Query: 163 VGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEI 222
            GY Y F + I    +L+    +IQYW DR  V    WI I  V +  +NF  VRF+GEI
Sbjct: 140 NGYMYWFNWAITFAVELSVVGQIIQYWTDR--VPIAAWIVIFWVLVTLVNFFPVRFYGEI 197

Query: 223 EYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVS 282
           E++I++VK+  +                   +        P      S+  T  +  F+ 
Sbjct: 198 EFWIASVKVLTIVGYLIYAFIIVCGGSKQGPIGLPATGGIPARGARASSRTTRKRHGFLG 257

Query: 283 FASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPF 342
           + S  + A F Y GTEL GI   E  NPRK VPKAI    +RI+ FY+ S+  +G+ VP+
Sbjct: 258 WVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPY 317

Query: 343 NDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLY 402
           +DP L             PFV++I NAG  +LP I NA +LI V SAANS++Y+ SR  Y
Sbjct: 318 DDPRL--NSESSTDVNASPFVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAY 375

Query: 403 GLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLL 462
            LA+   AP+  A   KQGVPY+ +L+  L  L++++ ++  +S  F + VN  ++ GL 
Sbjct: 376 SLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLC 435

Query: 463 SWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDT 522
           +W+ I + +IRF +  + +GI +  L +++   P+ A+++ FF  +I  I+ + AF    
Sbjct: 436 AWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFT-PK 494

Query: 523 FDYKSFXXXXXXXXXXXXXXXXXKLWYKTKII-PSEEVDLVSFKEAV 568
           FD  +F                 +++YK + +   E++D+ S +  +
Sbjct: 495 FDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAVEDIDIDSDRREI 541

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  269 bits (688), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 160/482 (33%), Positives = 252/482 (52%), Gaps = 12/482 (2%)

Query: 42  DGQSDSKVHGITSGHGSDVKNVVTH-TSEFDG---KHDGIRLKKALEARHVSMXXXXXXX 97
           DG S S    IT+  G+    V+ H TSE +    K +   +K+ L+ RHV+M       
Sbjct: 11  DGSSSST---ITAKPGAIKAEVLNHNTSEVESLCEKPNQSDVKRELKPRHVTMISLGGTI 67

Query: 98  XXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYAD 156
                                    FV  + + V   LGEMA +IP+   FT +++R+  
Sbjct: 68  GTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRFVS 127

Query: 157 PALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGV 216
           PALG A GY Y   + I    +++    +I YW D   +    W+ I  V +  IN + V
Sbjct: 128 PALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPIT--AWMAIFWVLLTAINLIPV 185

Query: 217 RFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGA 276
           +F+GE E++I+++K+  +                   + GF+YWK+PG +     +    
Sbjct: 186 KFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRI-GFRYWKDPGPWGVGIVSQEIH 244

Query: 277 KGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLL 336
             +F+ + S  + A F + GTEL G+   E KNPR+ VPKAI    +RI++FY+ S+ ++
Sbjct: 245 TAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVI 304

Query: 337 GMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYV 396
           G+ V ++DP LI            PFVVAI  AG  VLP IMN  I++ + SA NS++YV
Sbjct: 305 GLLVRYDDPQLIQDGSTTNANAS-PFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYV 363

Query: 397 ASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCV 456
            SR LYGL     AP   ++T  +GVPY ++L   +F  L Y+NVSS S  VF + ++  
Sbjct: 364 GSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSIT 423

Query: 457 SIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFP 516
           ++ G  +W+ I +++IRF +  + +GI +  L +++   PYGA+++ FF I+I L++ F 
Sbjct: 424 AVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFT 483

Query: 517 AF 518
           AF
Sbjct: 484 AF 485

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  270 bits (689), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 158/504 (31%), Positives = 255/504 (50%), Gaps = 17/504 (3%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           D K +G +L++ L ARH+ +                                 +  +++ 
Sbjct: 49  DAKLEG-KLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYP 107

Query: 131 VMSCLGEMAAYIPLDGFTSYST------RYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
           +M+  GEM  Y+P +G  S  +      RY DP+L FA G+ Y + Y I+V  + TA + 
Sbjct: 108 IMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASG 167

Query: 185 VIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXX 244
           V++YW D   V    WITI L  ++ +N   V+++GE E++ +++K+  +          
Sbjct: 168 VVKYWTD--AVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFIL 225

Query: 245 XXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIV 303
                PNH+ LGF+YWKNPG F  + T   G  G F+   S  +   FA+ LG EL  + 
Sbjct: 226 FWGGGPNHDRLGFRYWKNPGGFAHHITG--GNLGNFLDVYSGIIKGAFAFILGPELIALA 283

Query: 304 VSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXX-XXXXXPF 362
            SECK+ R+ + KA K  ++R++ FY++    + + V  NDP L              PF
Sbjct: 284 SSECKDQRRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPF 343

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+ I NAGI +LPHI+NACIL   +SA N+ ++ +SRSL  +A + +AP+IF K N+ GV
Sbjct: 344 VIGIQNAGIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGV 403

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           P+ ++    L + LAY+NVSS +++VF +F N  +I G + W   L+ Y+RF KA +  G
Sbjct: 404 PWVAVTFSALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNG 463

Query: 483 IDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXX 542
           ++ + L Y    Q Y  W+S+    L+     +  F+   ++   F              
Sbjct: 464 LE-NRLPYAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLW 522

Query: 543 XXXKLW---YKTKIIPSEEVDLVS 563
              K++   +K    P EE+D+V+
Sbjct: 523 IGHKIYTRDFKKWWYPVEEIDVVT 546

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  268 bits (686), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 165/491 (33%), Positives = 251/491 (51%), Gaps = 11/491 (2%)

Query: 74  HDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMS 133
           +D  +LK+ L+ RH+ M                                FVG++V     
Sbjct: 39  NDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQI 98

Query: 134 CLGEMAAYIPLDGFT-SYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192
            + E+A+++P  G T  ++ ++ D ++GF  G+  +  Y  ++P +L+A A++++YW D 
Sbjct: 99  AIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD- 155

Query: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNH 252
             ++P V+ITI  V  +  N   +RF+GE+EY    +K+ ++                  
Sbjct: 156 --ISPAVFITIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLGGVKGQ 213

Query: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRK 312
           E LGF YW++PG F EY   + G+ G+FV F S     +++Y G +   I+  E KN R 
Sbjct: 214 ERLGFHYWRDPGPFAEY--IVGGSIGKFVGFWSALSSVVYSYSGIQNIAILAGETKNSRH 271

Query: 313 AVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIP 372
           A+    K    RIIV YL+++F+L + VP+ND L+             PFV+A+  AGI 
Sbjct: 272 AIYHGAKNVFLRIIVLYLVTVFVLTLIVPYNDALI---ASGTGTAKSSPFVIAMNRAGIK 328

Query: 373 VLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVL 432
           VLPHI+NA +L   +SA N  +   SR+L+ LA  N+AP+IF KT+K+G+PY  ++    
Sbjct: 329 VLPHIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISC 388

Query: 433 FALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQS 492
           F  LAYM+ S  SS VF +F   VS   LL WI I   +I  D+A + QG  +S L Y +
Sbjct: 389 FLPLAYMSCSESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYST 448

Query: 493 PLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTK 552
           P+ PY AWFS     +  L   F  F+   FD +SF                 KL+ KT+
Sbjct: 449 PIAPYAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTR 508

Query: 553 IIPSEEVDLVS 563
            +  EEVDL S
Sbjct: 509 YLRPEEVDLAS 519

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  270 bits (690), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 164/500 (32%), Positives = 260/500 (52%), Gaps = 19/500 (3%)

Query: 28  DDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARH 87
           DD+I +E+ S+     QS S    I      DV   +  +   DG ++  +LK+ L++RH
Sbjct: 60  DDDIRMEKISK----DQSASSNGTIHEELVMDVD--LEKSPSADGDNEPRKLKQGLQSRH 113

Query: 88  VSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPLDGF 147
           V +                                 +  +++ +M  LGEM  ++P DG 
Sbjct: 114 VQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGEMVCFLPGDGS 173

Query: 148 TSYS------TRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWI 201
            S        TRY D +LGFA G+ Y + Y I+V  + TA + V++YW     V  GVWI
Sbjct: 174 DSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTT--AVPKGVWI 231

Query: 202 TILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWK 261
           T+ L+ ++ +NF  V+ +GE E++ +++KI  +               P H+ LGF+YW+
Sbjct: 232 TVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQ 291

Query: 262 NPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIVVSECKNPRKAVPKAIKL 320
           +PGAF  + T   G+ G F    +  +   FA+ LG EL  +  +EC + R+ + KA + 
Sbjct: 292 HPGAFAHHLTG--GSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRR 349

Query: 321 TMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXX-XXXXXPFVVAIVNAGIPVLPHIMN 379
            ++R+I FY++    + + VP+NDP+L+             PFV+ I NAGI VLPHI+N
Sbjct: 350 FVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIIN 409

Query: 380 ACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYM 439
            CIL   +SAAN+ ++ ++RSL  +A   +AP+   K N+ GVPY ++    L + LAY+
Sbjct: 410 GCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAASFLCSCLAYL 469

Query: 440 NVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGA 499
           NVSS +++VF +F N  +I G L WI   I Y+RF KA    G+    L +++  QPY  
Sbjct: 470 NVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYNGL-YDRLPFKTWGQPYTV 528

Query: 500 WFSLFFCILIGLIKNFPAFL 519
           WFSL    +I +   +  F+
Sbjct: 529 WFSLIVVSIITITNGYAIFI 548

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  268 bits (684), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 168/496 (33%), Positives = 250/496 (50%), Gaps = 12/496 (2%)

Query: 74  HDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMS 133
           +D  +LK+ L+ARH+ M                                 VG++V     
Sbjct: 41  NDRTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQI 100

Query: 134 CLGEMAAYIPLDGFT-SYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192
            + E+A+++P  G T  +S ++ D A+GF  G+  +  Y  ++P +L+A A+V+ YW D 
Sbjct: 101 AIAEVASFMPATGATIRHSEQFIDEAVGFTFGW--ISTYSSLMPGELSATAVVMTYWTD- 157

Query: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNH 252
             ++P ++ITI  V  I  N   +RF+GEIEY+   +K+ ++                  
Sbjct: 158 --LSPAIFITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALIAILIITGLVIDLGGT-KQ 214

Query: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRK 312
           E LGF YW+NPG F EY   + G  G+FV F +     +++Y G +   I+  E KN R 
Sbjct: 215 ERLGFHYWRNPGPFAEY--LVGGDTGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRH 272

Query: 313 AVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIP 372
           A+    K    RII+ YLI++F+L + VP+ND L+             PFV+A+  AGI 
Sbjct: 273 AIFHGAKNVFVRIILLYLITVFVLTLIVPYNDKLI---ATGSGNARSSPFVIAMERAGIK 329

Query: 373 VLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVL 432
           VLPHI+NA IL   +SA N  +   SR+L+ LA  N+AP+IF KT+K+G+P+  +L    
Sbjct: 330 VLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISS 389

Query: 433 FALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQS 492
           F  LAYM+ S  S+ VF++F   VS   LL WI I   +I  D+A R QG  +  L Y +
Sbjct: 390 FLPLAYMSCSESSATVFSWFQELVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYST 449

Query: 493 PLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTK 552
            + PY AWFS     +  L   F  F+   FD +SF                 KL+ KT+
Sbjct: 450 TIAPYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRYFIIPLAIALFTFWKLFKKTR 509

Query: 553 IIPSEEVDLVSFKEAV 568
            +   EVDL S  E +
Sbjct: 510 YLRPHEVDLQSIFEDI 525

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  270 bits (689), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 166/547 (30%), Positives = 269/547 (49%), Gaps = 30/547 (5%)

Query: 41  YDGQSDS--KVHGITSGHGSDVKNV----------VTHTSEFDGKHDGIRLKKALEARHV 88
           YD + D   ++  I+  H +               V  +   +G ++  +LK+ L++RHV
Sbjct: 60  YDNEKDDAIRMEKISKNHSASSNGTIREDLIMDVDVEKSPSVEGDNEPHKLKQGLQSRHV 119

Query: 89  SMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPLDGFT 148
            +                                 +  +++ +M  LGEM  ++P DG  
Sbjct: 120 QLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSD 179

Query: 149 SYS------TRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWIT 202
           S        TRY D +LGFA G+ Y + Y I+V  + TA + V++YW     V  GVWIT
Sbjct: 180 SAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTT--AVPKGVWIT 237

Query: 203 ILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKN 262
           I L  ++ +N   V+ +GE E++ +++KI  +               PNH+ LGF+YW++
Sbjct: 238 IFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQH 297

Query: 263 PGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIVVSECKNPRKAVPKAIKLT 321
           PGAF  + T   G+ G F    +  +   FA+ LG EL  +  +EC + R+ + KA +  
Sbjct: 298 PGAFAHHLTG--GSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNISKASRRF 355

Query: 322 MYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXX-XXXXXPFVVAIVNAGIPVLPHIMNA 380
           ++R+I FY++    + + VP+NDP L+             PFV+ I NAGI VLPHI+N 
Sbjct: 356 VWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIING 415

Query: 381 CILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMN 440
           CIL   +SAAN+ ++ ++RSL  +A   +AP+   + N+ GVPY ++ V  L + LAY+N
Sbjct: 416 CILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLN 475

Query: 441 VSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGI-DKSTLAYQSPLQPYGA 499
           VSS +++VF +F N  +I G L W+   I Y+RF KA    G+ D+  L +++  QPY  
Sbjct: 476 VSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGLFDR--LPFKTWGQPYTV 533

Query: 500 WFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTKI---IPS 556
           W SL    +I L   +  F+   +    F                 KL+ +T     +P 
Sbjct: 534 WASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYTRTWSQWWLPV 593

Query: 557 EEVDLVS 563
            E+D+ +
Sbjct: 594 SEIDVTT 600

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  268 bits (686), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 167/519 (32%), Positives = 263/519 (50%), Gaps = 29/519 (5%)

Query: 19  DIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIR 78
           D+E QQ+  DD++          D + + K  G+     + V  V + TS    + D   
Sbjct: 29  DMEAQQMNLDDSL----------DDRFNKKDSGL-----NKVLTVSSDTSTNSLEEDYTN 73

Query: 79  -LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGE 137
            LK+ L++RHV +                                 +  +++ +M+ +GE
Sbjct: 74  TLKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGE 133

Query: 138 MAAYIPLDGFTSYST------RYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVD 191
           M  Y+P DG  S  +      RY D +L FA G+ Y + Y I+V  + TA A V++YW  
Sbjct: 134 MVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTL 193

Query: 192 RDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPN 251
              V    WITI L  I  +N   V++FGE E++ +++KI  +               P+
Sbjct: 194 --AVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPS 251

Query: 252 HEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIVVSECKNP 310
           H+ LGF+YWKNPGAF  + T   G+ G F+   S  +   FA+ LG EL  +  SEC + 
Sbjct: 252 HDRLGFRYWKNPGAFAHHVT--DGSLGNFLDIYSGIIKGAFAFILGPELVALTSSECSDQ 309

Query: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXX-XXXXXPFVVAIVNA 369
           R+ + KA K  +YR++ FY++    +G+ V +NDP+L              PFV+ I NA
Sbjct: 310 RRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNA 369

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
           GI VLPHI+NACIL   +S+ N+ ++ +SRSL+ +A +  AP+IF + NK GVPY ++++
Sbjct: 370 GIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVIL 429

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
             L + LAY+N SS ++ VFT+  N  +I G L WI   I Y+RF KA     +    + 
Sbjct: 430 STLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNL-YDRMP 488

Query: 490 YQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
           +++  QPY   +SL    +I +   +  F+   ++   F
Sbjct: 489 FKTWGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDF 527

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  268 bits (684), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 155/430 (36%), Positives = 233/430 (54%), Gaps = 6/430 (1%)

Query: 134 CLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192
           C+  M  Y+P+ G F  ++ R+ D + GFAVG+ Y       V  ++TA  LV++YW D 
Sbjct: 172 CMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTD- 230

Query: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNH 252
            K+     I++L++   ++N   V FFGE E+Y+S  K+ +                P H
Sbjct: 231 -KIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQH 289

Query: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRK 312
            VLGFK W NPGAF EY +   G+ GRF  F S  V AL+ + G +  G   SE  NPRK
Sbjct: 290 TVLGFKNWSNPGAFAEYIS--DGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRK 347

Query: 313 AVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXX-XXPFVVAIVNAGI 371
            +P + +    R+I+FY+     +G+ +P+NDP +I             P+V A+   GI
Sbjct: 348 VIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGI 407

Query: 372 PVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGV 431
            VLPHI+N  IL  + SA NS LY ASR L+ LA+DN+APRIF  T K+GVP +  +  +
Sbjct: 408 RVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVL 467

Query: 432 LFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQ 491
           +   LAY++VS+ ++ V T+F+N  +    + +I I ++Y++F K    Q +D  +L Y 
Sbjct: 468 VICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYY 527

Query: 492 SPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKT 551
           S   PY AW SLF+ +L+ L+  +  FL  ++D +SF                 KL+  T
Sbjct: 528 SSSLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGT 587

Query: 552 KIIPSEEVDL 561
           K +   E+DL
Sbjct: 588 KSVRPLEMDL 597

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  266 bits (679), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 174/565 (30%), Positives = 278/565 (49%), Gaps = 39/565 (6%)

Query: 16  TDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHD 75
           + E+ EK+ +F +  I+I        D +S ++     S   S+V+      +E +GK  
Sbjct: 11  SKEEEEKKTVFDNRQILINE-----LDLESLTREKITRSDSSSEVE------AEGNGK-- 57

Query: 76  GIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCL 135
              LK+ L +RHV                                   +  +++ +M+ L
Sbjct: 58  ---LKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNAL 114

Query: 136 GEMAAYIPLDGFTSYST------RYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
           GEM  Y+P +G  S  +      RY D +L FA G+ Y + + I+V  + TA + V+ YW
Sbjct: 115 GEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYW 174

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
                V   VWITI L  +  +NF  V++FGE E++ +++KI  +               
Sbjct: 175 TT--SVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGG 232

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIVVSECK 308
           P+H  LGF YWK+PG F  + T   G+ G F+   +  +   FA+ LG EL  +  SEC 
Sbjct: 233 PSHVRLGFHYWKDPGTFAHHITG--GSWGSFLDIYTGIIKGAFAFILGPELVALTSSECN 290

Query: 309 NPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXX-XXXXPFVVAIV 367
           + R+ + KA K  ++R++ FY++    + + V +NDP+L+             PFV+ I 
Sbjct: 291 DQRRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQ 350

Query: 368 NAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSL 427
           NAGI VLPHI+NACIL   +SA NS ++ +SRSL  +A +  AP+IF K N+ GVPY+S+
Sbjct: 351 NAGIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSV 410

Query: 428 LVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKA-FRVQGIDKS 486
            +  + + LA++NVSS +++VF +F N  +I G L WI  +I Y+RF KA F     D+ 
Sbjct: 411 GLSAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNMYDR- 469

Query: 487 TLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXK 546
            L +++  QPY  W+SL    +I L   +  F+   +    F                 K
Sbjct: 470 -LPFKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHK 528

Query: 547 LWYKTK--------IIPSEEVDLVS 563
            W + K          P +E+D+++
Sbjct: 529 FWARYKHAVPLLKLYYPVDEIDVIT 553

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  267 bits (683), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 155/467 (33%), Positives = 244/467 (52%), Gaps = 15/467 (3%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DG     RLK+ L++RHV +                                 +  +++ 
Sbjct: 154 DGDAGPHRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYP 213

Query: 131 VMSCLGEMAAYIPLDGFTSYS------TRYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
           +M  LGEM  ++P DG  S        TRY D +LGFA G+ Y + Y I+V  + TA + 
Sbjct: 214 IMCALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASG 273

Query: 185 VIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXX 244
           V++YW     V  GVWITI L  ++ +NF  V+ +GE E++ +++KI  +          
Sbjct: 274 VVEYWTT--AVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFIL 331

Query: 245 XXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIV 303
                P H+ LGF+YW++PG+F  +     G+ G F    +  +   FA+ LG EL  + 
Sbjct: 332 FWGGGPKHDRLGFRYWQHPGSFAHHLAG--GSLGNFTDIYTGIIKGAFAFILGPELVCMT 389

Query: 304 VSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXX-XXXXXPF 362
            +EC + R+ + KA +  ++R+I FY++    + + VP+NDP L+             P+
Sbjct: 390 SAECADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPY 449

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+ I NAGI VLPHI+N CIL   +SAAN+ ++ ++RSL  +A   +AP+   K N+ GV
Sbjct: 450 VIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGV 509

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           PY ++ V  L + LAY+NVSS +++VF +F N  +I G L WI   I Y+RF KA    G
Sbjct: 510 PYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNG 569

Query: 483 I-DKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
           + D+  L +++  QPY  WFSL    +I +   +  F+   ++   F
Sbjct: 570 LYDR--LPFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKYWNVADF 614

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  266 bits (679), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 162/527 (30%), Positives = 270/527 (51%), Gaps = 20/527 (3%)

Query: 14  VDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGK 73
           VD D DIE      D+N   +++ Q+ Y+ +S S+   + +   + + ++     +  GK
Sbjct: 33  VDVDIDIEATAS-NDNN---KKNPQIIYNEKSYSQDE-LQTTSPTIIDSIDDEAEKEQGK 87

Query: 74  H---DGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
                   LK+ L++RH+ +                                 +   V+ 
Sbjct: 88  ERSSSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYP 147

Query: 131 VMSCLGEMAAYIPLDGFTSYST------RYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
           +M+ LGEM  ++P +G  S  +      +Y DP+LGFA  + Y + + I+V  +++A + 
Sbjct: 148 IMNALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASG 207

Query: 185 VIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXX 244
           VI+YW   + V  G WITI L  I+ +NFL V  +GE E++ +++KI  +          
Sbjct: 208 VIEYWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFIL 267

Query: 245 XXXXXPNHE-VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGI 302
                P  + +LGF+YWKNPG+F  + T   G  G F+   +  +   F+  LG EL  +
Sbjct: 268 FWGGGPKSDGILGFRYWKNPGSFAHHITG--GGGGNFLDIYTGIIKGGFSVILGPELVCL 325

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXX-XXP 361
             SEC + R+ + KA K  ++R++ FY++    +G+ V +NDP+L              P
Sbjct: 326 TSSECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSP 385

Query: 362 FVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQG 421
           FV+ I NAGI  +PHI+N CIL   +SA N+ ++ +SRSL  +A +  AP+IF + N+ G
Sbjct: 386 FVIGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLG 445

Query: 422 VPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ 481
           VPY ++   +L + LAY+NVSS +++VF +F N  +I G + WI   + YIRF KA    
Sbjct: 446 VPYTAVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITYN 505

Query: 482 GIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
            +    + +++  Q Y  W+SLF+  LI L   +  F+   ++ K F
Sbjct: 506 KLTHR-IPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDF 551

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  263 bits (673), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 160/491 (32%), Positives = 247/491 (50%), Gaps = 11/491 (2%)

Query: 74  HDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMS 133
           +D  +LK+ L+ RH+ M                                FVG++V     
Sbjct: 44  NDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQI 103

Query: 134 CLGEMAAYIPLDGFT-SYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192
            + E+A+++P  G T  ++ ++ D ++GF  G+  +  Y  ++P +L+A A++++YW D 
Sbjct: 104 AIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD- 160

Query: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNH 252
             V+P V+IT+  +  +  N   +RF+GE+EY    +K+ ++                  
Sbjct: 161 --VSPAVFITVFGILFVVTNIYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQ 218

Query: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRK 312
           E LGF YW+ PG F  Y   + G  G+FV F +     +++Y G +   I+  E KN R 
Sbjct: 219 ERLGFHYWREPGPFANY--LVGGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRH 276

Query: 313 AVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIP 372
           A+    K    RIIV YL+++F+L + VP+ND L+             PFV+A+  AGI 
Sbjct: 277 AIFHGAKNVFLRIIVLYLVTVFILTLIVPYNDKLI---ATGTGTARSSPFVIAMNRAGIK 333

Query: 373 VLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVL 432
           VLPHI+NA IL   +SA N  +   SR+L+ LA  N+AP+IF +T+K+G+PY  ++    
Sbjct: 334 VLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISS 393

Query: 433 FALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQS 492
           F  LAYM+ S  S+ VF +F   VS   LL WI I   +I  D+A + QG  +S L Y +
Sbjct: 394 FLPLAYMSCSKSSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYST 453

Query: 493 PLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTK 552
           P+ P+ AWFS     +  L   F  F+   FD +SF                 KL+ KTK
Sbjct: 454 PMGPFAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTK 513

Query: 553 IIPSEEVDLVS 563
            +   EVDL S
Sbjct: 514 YLRPHEVDLES 524

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  260 bits (665), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 152/433 (35%), Positives = 232/433 (53%), Gaps = 7/433 (1%)

Query: 133 SCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVD 191
            C+  M  Y+P+ G F  ++ R+ D + GF+VG+ Y       V  ++TA  LV+++W D
Sbjct: 99  QCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTD 158

Query: 192 RDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPN 251
             K+     I+IL+    ++N   V  FGE E+Y+S  K+ +                P 
Sbjct: 159 --KIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQ 216

Query: 252 HEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPR 311
           H+VLGFK W NPGAF EY +   G+ G+F  F S  + AL+ + G +  G   SE  NPR
Sbjct: 217 HKVLGFKNWSNPGAFAEYIS--KGSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPR 274

Query: 312 KAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXX-XXPFVVAIVNAG 370
           K +P + +    R+I+FY+     +G+ VPFND  +I             P+V A+   G
Sbjct: 275 KVIPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLG 334

Query: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430
           I VLPHI+N  IL  + SA NS LY ASR L+ LA++ +AP++F K  K+GVP +  +  
Sbjct: 335 IGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLF-KITKRGVPIYCCVAV 393

Query: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490
           +L   LAY++VS+ ++ V T+F+N  +    + +I I I+Y++F K  + Q ID  TL Y
Sbjct: 394 LLVCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPY 453

Query: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK 550
            S   PY  W SLF+ +L+  +  +  FL D++D +SF                 KL+ K
Sbjct: 454 SSSFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKK 513

Query: 551 TKIIPSEEVDLVS 563
           T+ +   E+DL S
Sbjct: 514 TRFVKPVEMDLFS 526

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  260 bits (665), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 152/461 (32%), Positives = 243/461 (52%), Gaps = 13/461 (2%)

Query: 76  GIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCL 135
           G  LK+ L++RHV +                                 +  +++ +M  +
Sbjct: 72  GHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGI 131

Query: 136 GEMAAYIP-----LDGFTSYST-RYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
           GEM  Y+P      +GF +Y   +Y D +LGFA  + Y + Y I+V  + TA + V++YW
Sbjct: 132 GEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYW 191

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
                V    WITI L A++ +NF  V+F+GE E++ +++KI  +               
Sbjct: 192 TT--SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGG 249

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIVVSECK 308
           PNH+ LGF+YW+NPG F  +     G+ G F+   +  +   FA+ LG E+  +  SE +
Sbjct: 250 PNHDRLGFRYWQNPGGFAHHIRG--GSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVE 307

Query: 309 NPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXX-XXXXXPFVVAIV 367
           + R+ + KA +  ++R++ FY++    + + V +NDP L              PFV+ I 
Sbjct: 308 DQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQ 367

Query: 368 NAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSL 427
           NAGI VLPHI+NACIL   +SA N+ ++ +SRSL  +A + +APRIFAK N+ GVPY+++
Sbjct: 368 NAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAV 427

Query: 428 LVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKST 487
            +    + LAY+N SS +++VF +F N   I G + WI + I YIRF KA    G+ +S 
Sbjct: 428 GLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSR 486

Query: 488 LAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
           L Y +   PY  ++ L    +I L   +  F+   +D K+F
Sbjct: 487 LPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNF 527

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  260 bits (664), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 166/532 (31%), Positives = 259/532 (48%), Gaps = 40/532 (7%)

Query: 8   DAQLSRVDTDEDIEKQQLFGD---DNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVV 64
           D  +S VD + +   +QL  D   + I    +S L  + Q   + +G             
Sbjct: 22  DPIISEVDIEANTITEQLTKDKHKETIDYSETSSLDEEKQQQPEENG------------- 68

Query: 65  THTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFV 124
                        +LK+ L++RHV +                                 +
Sbjct: 69  -------------KLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLII 115

Query: 125 GLLVFFVMSCLGEMAAYIPLDGFTSYST------RYADPALGFAVGYAYLFKYWIIVPNQ 178
              ++ +M+  GEM  Y+P +G  S  +      +Y D +LGFA  + Y + + I+V  +
Sbjct: 116 CTFIYPIMNAFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATE 175

Query: 179 LTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXX 238
            TA A V++YW    KV  G WITI L  ++ +N L V F+GE E++ +++KI  +    
Sbjct: 176 CTAAAGVVEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLI 235

Query: 239 XXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGT 297
                      P+H+ LGF+YW+ PGAF ++ T  TG  G F+   +  +   FA+ LG 
Sbjct: 236 ILSFILFWGGGPSHDRLGFRYWQRPGAFADHITDGTG--GNFLDVYTGVIKGGFAFVLGP 293

Query: 298 ELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDP-LLIXXXXXXXX 356
           EL  +  SEC + R+ + KA +  ++R+++FY++    + + V +NDP L          
Sbjct: 294 ELVSLTSSECHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPG 353

Query: 357 XXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAK 416
               PFV+ I NAGI VLPHI+N CI+   +SA N+ ++ +SRSL  +A    AP+ F+K
Sbjct: 354 AGSSPFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSK 413

Query: 417 TNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDK 476
            N+ GVPY ++    LF  LAY+NVSS ++ VF +F N  +I G + WI   + YIRF K
Sbjct: 414 INRFGVPYVAVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRK 473

Query: 477 AFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
           A     +    L Y+   Q Y  W+SLF   LI L   +  F+   +DYK F
Sbjct: 474 AIIFNDL-YDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDF 524

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  259 bits (662), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 157/512 (30%), Positives = 254/512 (49%), Gaps = 17/512 (3%)

Query: 52  ITSGHGSDVKNVVTHTSEFDGKHDGI----RLKKALEARHVSMXXXXXXXXXXXXXXXXX 107
           + S   +    +     + DG  D       L++ L++RH+ M                 
Sbjct: 46  VESQQSTSSATISEKLGDGDGDADPFANEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSS 105

Query: 108 XXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPLDGFTSYST------RYADPALGF 161
                           +  +V+ +M   GEM  Y+P +G  +  +      RY D +LGF
Sbjct: 106 TLALCGPAGLFISYIIISSVVYPIMCGFGEMVCYLPGNGNDASGSAAHLVARYVDKSLGF 165

Query: 162 AVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGE 221
           A  + Y + Y I+V  + TA + V++YW     V  GVWI I L  ++ +NF  V+++GE
Sbjct: 166 ATAWNYYYCYIILVAAECTAASGVVEYWTV--AVPKGVWILIFLGIVVILNFGPVKYYGE 223

Query: 222 IEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFV 281
            E++ +++KI  +               PNH+ LGF+YW+ PGAF E+   + G  GRF+
Sbjct: 224 AEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQRPGAFTEH--IMKGGFGRFL 281

Query: 282 SFASVFVLALFAY-LGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCV 340
              S  +   FA+ LG EL  +  +EC++ R+ + KA +  ++R++ FY++    + + V
Sbjct: 282 DIYSGVIKGGFAFILGPELVCLTSAECEDQRRNIAKAARRFIWRLMFFYVLGTLAISVIV 341

Query: 341 PFNDPLLIXXXXXXX-XXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASR 399
            +NDP L+             PFV+ I NAGI VLPHI+NACIL   +SA N+ ++ ++R
Sbjct: 342 AYNDPSLVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINACILSSAWSAGNAFMFASTR 401

Query: 400 SLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIF 459
           SL  +A +  APR+F K N+ GVPY ++ +    + LA++NVSS +++VF +F N  +I 
Sbjct: 402 SLLTMARNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLNVSSSTADVFNWFSNISTIS 461

Query: 460 GLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFL 519
           G + WI   + YIRF KA    G+    L +++  QPY  ++SLF   LI L   +  F+
Sbjct: 462 GFIGWICGCVAYIRFRKAIFFNGM-YDRLPFKTWGQPYAVYYSLFVISLITLTNGYATFI 520

Query: 520 GDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKT 551
              +    F                 KLW +T
Sbjct: 521 PKNWKGSDFVAAYITLPIFVVLWVGHKLWTRT 552

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  256 bits (654), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 153/467 (32%), Positives = 243/467 (52%), Gaps = 17/467 (3%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DG+ +  +LK+ L ARH+ +                                 +  +V+ 
Sbjct: 96  DGRKN--KLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYP 153

Query: 131 VMSCLGEMAAYIPLDGFTSYST------RYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
           +M+ LGEM  Y+P DG  S  +      RY D +L FA G+ Y + + ++V  + TA + 
Sbjct: 154 IMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASG 213

Query: 185 VIQYWVDRDKVNPG-VWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXX 243
           V++YW    KV P   WI +  + I  +N   VR +GE E++ +  KI  +         
Sbjct: 214 VVEYWT---KVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFI 270

Query: 244 XXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGI 302
                 PNH+ LGF+YW  PG+F   +T   G+ G F+      +L  F++ LG EL  +
Sbjct: 271 LFWGGGPNHDRLGFRYWITPGSFA--NTITNGSFGNFLDVYKGIILGAFSFILGPELVVL 328

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLL-IXXXXXXXXXXXXP 361
             SEC +PR+ + KA K  ++R++ FY++    + + V +NDP+L              P
Sbjct: 329 PSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSP 388

Query: 362 FVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQG 421
           FV+ I NAGI VLPHI+N CILI  +S+ N+ L+ +SRSL  +AI+++AP+   K N+ G
Sbjct: 389 FVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFG 448

Query: 422 VPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ 481
           VPY +++V ++ + +AY+N S  +S+VF +F N  +I G L WI + +TY+RF KA    
Sbjct: 449 VPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEYH 508

Query: 482 GIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
           G+ K  L Y +  QPY   +SL   I+I +   F   +   ++   F
Sbjct: 509 GM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDF 554

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  251 bits (641), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 152/456 (33%), Positives = 234/456 (51%), Gaps = 11/456 (2%)

Query: 74  HDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMS 133
           +D  RLK+ L+ RH+ M                                FVG++V     
Sbjct: 43  NDRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQI 102

Query: 134 CLGEMAAYIPLDGFT-SYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192
            + E+A+++P  G T  ++ ++ D ++GF  G+  +  Y  ++P +L+A A++++YW D 
Sbjct: 103 AIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMKYWTD- 159

Query: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNH 252
             V+P V+IT+  V  +  N   +RF+GEIEY    +K+ ++                  
Sbjct: 160 --VSPAVFITVFGVLFVATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQ 217

Query: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRK 312
           E LGF YW++PG F  Y  A  G  G+FV F +     +++Y G +   I+  E KN R 
Sbjct: 218 ERLGFHYWRDPGPFANYLVA--GHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRY 275

Query: 313 AVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIP 372
           A+    K    RIIV YL+++F+L + VP+ND L+             PFV+A+  AGI 
Sbjct: 276 AIFHGAKNVFLRIIVLYLVTVFVLTLIVPYNDKLI---ATGTGTAKSSPFVIAMNRAGIK 332

Query: 373 VLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVL 432
           VLPHI+NA IL   +SA N  +   SR+L+ LA  N+AP+IF KT+K+G+PY  ++    
Sbjct: 333 VLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISS 392

Query: 433 FALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQS 492
           F  LAYM+ S  S+ VF +F   VS   LL WI I   +I  D+A + QG  +S L   +
Sbjct: 393 FLPLAYMSCSESSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCST 452

Query: 493 PLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
            + P+ AWFS    ++      F  F+   FD +SF
Sbjct: 453 RIAPFAAWFSGIMSVIFLFTGGFYNFMHGHFDIESF 488

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  248 bits (632), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 164/496 (33%), Positives = 249/496 (50%), Gaps = 12/496 (2%)

Query: 74  HDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMS 133
           +D  RLK+ L+ RH+ M                                 VG++V     
Sbjct: 45  NDRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQI 104

Query: 134 CLGEMAAYIPLDGFT-SYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192
            + E+A+++P  G T  ++ ++ D ++GF  G+  +  Y  ++P +L+A A+V++YW D 
Sbjct: 105 AIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVVMRYWTD- 161

Query: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNH 252
             +NP VWITI  +  +  N   +RF+GE+EY+   +KI ++                  
Sbjct: 162 --INPAVWITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGA-KQ 218

Query: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRK 312
           E LGF YW+ PG F EY   + G  G+FV F +     +++Y G +   I+  E KN R 
Sbjct: 219 ERLGFHYWREPGPFAEY--IVKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRH 276

Query: 313 AVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIP 372
           A+    +    RIIV YLI++ +L + VP+ND L+             P+V+AI  A I 
Sbjct: 277 AIFHGARNVFLRIIVLYLIAVLVLTLIVPYNDKLI---ATGTGTAKSSPYVIAIQRANIK 333

Query: 373 VLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVL 432
           +LPHI+NA IL   +SA N  +   SR+L+ LA  N+AP+IF  TNK+G+PY  +     
Sbjct: 334 ILPHIINAIILTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISA 393

Query: 433 FALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQS 492
           F  L+YM+VSS S+ VF++F   VS   LL WI I   +I  D+A + QG  +S L + +
Sbjct: 394 FLPLSYMSVSSSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHST 453

Query: 493 PLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKTK 552
            L P+ AWFS    ++  L   F  F+   FD +SF                 KL+ KTK
Sbjct: 454 CLGPFAAWFSGIMSLIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTK 513

Query: 553 IIPSEEVDLVSFKEAV 568
            +   EVDL S  E +
Sbjct: 514 YLRPAEVDLESIFEDI 529

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  243 bits (620), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 140/383 (36%), Positives = 211/383 (55%), Gaps = 9/383 (2%)

Query: 128 VFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVI 186
           +F V++ LGE+AA  P+  GF  Y TR+ DP++GFAV   YL ++ +++P +L A +L I
Sbjct: 92  LFTVINSLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTI 151

Query: 187 QYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXX 246
           +YW   DK+N   W+ I  V I+  N L V+ FGE E+ +S VKI  +            
Sbjct: 152 KYW--NDKINSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLAS 209

Query: 247 XXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSE 306
              P+   LGFKYW NPGAF   + A      +F    SVFV A F++ G E+  +  +E
Sbjct: 210 GGGPSGGYLGFKYWNNPGAFVGGTNA-----SKFKGLCSVFVTAAFSFSGIEMIAVSAAE 264

Query: 307 CKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAI 366
            KNPRK +PKA K T + +   Y++ + L+G  VP+ND  L+            P V+AI
Sbjct: 265 SKNPRKVIPKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAAS-PLVIAI 323

Query: 367 VNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWS 426
            N GI  LP +MNA ILI + S ANS +Y  SR +  +A     P++ +K +K+G P  +
Sbjct: 324 ENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNA 383

Query: 427 LLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKS 486
           L+V ++F LL+++  S   +EVFT+      +  +  W++I  + IRF +A +VQ     
Sbjct: 384 LIVTLIFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLD 443

Query: 487 TLAYQSPLQPYGAWFSLFFCILI 509
            L Y S    +GAW+ +    L+
Sbjct: 444 ELPYLSQTGIWGAWYGVLVLFLV 466

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  241 bits (614), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 139/464 (29%), Positives = 238/464 (51%), Gaps = 18/464 (3%)

Query: 78  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGE 137
            LK  L++RH+ +                                 +  +V+ +M+  GE
Sbjct: 55  NLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGE 114

Query: 138 MAAYIPLD-------GFTSY-STRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
           M  Y+P +       G+ +Y  ++Y D +LGFA  + Y + + ++V  + TA + +++YW
Sbjct: 115 MVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYW 174

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
               K+   V I + L  I  +NFL V+F+GE E++ + +KI  +               
Sbjct: 175 TS--KIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGA 232

Query: 250 PNHE---VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIVVS 305
           PN+E    +GF YWKNP +F++Y T   G+ G F+   +  +   FA+ LG EL  +  S
Sbjct: 233 PNNEDNSFVGFHYWKNPSSFRDYVT--NGSLGNFLDVYNALIKGAFAFILGPELVSLTSS 290

Query: 306 ECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXX-XXXXXPFVV 364
           EC + R+ + KA +  +YR++ FY+     + + VP+NDP L+             PFV+
Sbjct: 291 ECVDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVI 350

Query: 365 AIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPY 424
            I NAGI +LPHI+N CIL    SA N+ L+ ++R+L  +  +  APRIF++ N+ GVPY
Sbjct: 351 GIQNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPY 410

Query: 425 WSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGID 484
            +L + ++ A LA++N S+ S++VF +F N  +I G + W +  I Y+RF +     G+ 
Sbjct: 411 VALSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL- 469

Query: 485 KSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
              L +++  Q Y  W+S  F  ++ L   +   +   ++Y+ F
Sbjct: 470 YDRLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDF 513

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  241 bits (614), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 164/522 (31%), Positives = 261/522 (50%), Gaps = 30/522 (5%)

Query: 18  EDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGI 77
            +++  +  G+ ++V +++ Q++   + D     +TS      KN         G H+  
Sbjct: 2   SNLQDLKDAGETSVVDKQTGQVY---ELD-----LTSYSNDSEKNGSLPNKPQSGDHN-- 51

Query: 78  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGE 137
            LKK L++ H+ +                                 +  +++ VM+ L E
Sbjct: 52  -LKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAE 110

Query: 138 MAAYIPL--------DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
           M  ++P            ++  TRY D +LGFAVG+ Y++ Y I+V  + TA + V+ YW
Sbjct: 111 MVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVTYW 170

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
                V    WITI L  I+ +N   V F+G  E    ++KI  +               
Sbjct: 171 TT--AVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGG 228

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIVVSECK 308
           PNH+ LGF++WK+PGA+  Y  A  GA GR     +  + A FA+ LG EL  +  +E +
Sbjct: 229 PNHDRLGFRFWKDPGAWA-YHLADGGA-GRLSDIITGVIRAGFAFILGPELVVLTSTEAQ 286

Query: 309 NPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXX-XXXXXPFVVAIV 367
           + R+ + KA +  ++R+I FY +S    G+ V  NDP+L+             PFV+ I 
Sbjct: 287 DSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQ 346

Query: 368 NAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSL 427
           NAGI VLPHI+N CIL   +S+ NS +Y  +RSL  L+ +  AP+IF + N+ GVPY  +
Sbjct: 347 NAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGV 406

Query: 428 LVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGI-DKS 486
                F+ LAY+NVSS +++VF +F N  +I G L WI   + Y+RF KA     + D+ 
Sbjct: 407 AFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNLYDR- 465

Query: 487 TLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
            L +++P QPY  WF +    +I LI  + +F+   ++YK F
Sbjct: 466 -LPFKTPFQPYFTWFYIILIAIICLINGYESFV--HWNYKDF 504

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  239 bits (611), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 141/389 (36%), Positives = 211/389 (54%), Gaps = 10/389 (2%)

Query: 128 VFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVI 186
           +F V++ LGE+AA  P+  GF  Y TR+ DP+  FAV   YL  + + +P +L A ++ I
Sbjct: 127 LFTVINALGELAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITI 186

Query: 187 QYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXX 246
           +YW    ++N   W+TI  V I  +N + V+FF E E+ +S +KI  +            
Sbjct: 187 RYW--NREINSDAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAV 244

Query: 247 XXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSE 306
              P    +G KYW +PGAF   S     A  RF    SVFV+A F+Y G E+  +  +E
Sbjct: 245 GGGPTGGYIGGKYWNDPGAFHGDS-----AGSRFKGLCSVFVIAAFSYSGVEMTAVSAAE 299

Query: 307 CKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAI 366
            KNPRK +PKA K T + I   Y+  + L+G+ VP+ND  L+            P V+AI
Sbjct: 300 SKNPRKTIPKATKRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASAS-PLVIAI 358

Query: 367 VNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWS 426
            NAGI  LP +MNA ILI + S ANS +YV SR +  +A+ N  P++F+K +K+G P +S
Sbjct: 359 ENAGIKGLPSLMNAIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYS 418

Query: 427 LLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKS 486
           +   +   LL+++  S    EVFT+      +  +  WI I + +IRF  A + Q     
Sbjct: 419 IFATLFVGLLSFIAASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLD 478

Query: 487 TLAYQSPLQPYGAWFSLFFCILIGLIKNF 515
            LAY S    +G+W+ +   +L+ LI +F
Sbjct: 479 ELAYISQSGIWGSWYGVIILVLV-LIASF 506

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  238 bits (607), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 139/390 (35%), Positives = 213/390 (54%), Gaps = 12/390 (3%)

Query: 124 VGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
           +   +F +++ LGE++A  P+  GF  Y TR+ +P+ GFAV + YL ++ I++P +L A 
Sbjct: 109 ISTCLFTIVNSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAA 168

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           ++ I+YW     +NP  W++I  VAI   N L V+ FGE E+ +S VKI  +        
Sbjct: 169 SITIRYW--NKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGI 226

Query: 243 XXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGI 302
                  P+   +G KYW +PGAF   + A      RF   ++VF+ A F+Y G EL G+
Sbjct: 227 VLICGGGPSGGFIGGKYWNDPGAFVGDTPA-----QRFKGLSAVFITAAFSYSGLELVGV 281

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPF 362
             +E +NPR  +PKA K T + I + YL+ + L+G  VP NDPLL+            P 
Sbjct: 282 SAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAAS-PL 340

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+AI N GI  LP +MNA ILI + S ANS +Y  SR +  +A     PR  A  +K+G 
Sbjct: 341 VIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGR 400

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           P +++ + +L  LL+++  S+   EVFT+      +  L  W +I + ++RF  A + Q 
Sbjct: 401 PLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQN 460

Query: 483 IDKSTLAYQSPLQPYGAWFSLFFCILIGLI 512
                L Y S    +G+W+    CI+IGL+
Sbjct: 461 RSLEELPYVSMTGEWGSWYG---CIVIGLV 487

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  238 bits (606), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 153/512 (29%), Positives = 250/512 (48%), Gaps = 24/512 (4%)

Query: 13  RVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQ---SDSKVHGIT------SGHGSDVKNV 63
           + +T  D    + F   N     SS+  Y  Q   SD  +H          G  +  K +
Sbjct: 12  KKETSPDSISIRSFSAGNNFQSSSSEKTYSKQKSGSDKLIHRFADSFKRAEGSTTRTKQI 71

Query: 64  VTHTSEFDGKHDGI----RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 119
             +TS+ +   + I    +LKK++++RHV M                             
Sbjct: 72  NENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALII 131

Query: 120 XXXFVGLLVFFVMSCLGEMAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPN 177
               V  + +F++   GEMA   P     F +YS+ +   + GFA  + Y F++  ++P 
Sbjct: 132 GYILVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPL 191

Query: 178 QLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXX 237
           +L   ++ IQ+W   DK+NP ++I I  V ++ I+F GV+ +GE E+  +  KI ++   
Sbjct: 192 ELITASMTIQFW--NDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGF 249

Query: 238 XXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGT 297
                        N   +G  YW NPGAF    T+I    GRF +   + V A F++ G 
Sbjct: 250 IILSIVINCGGAGNDGYIGATYWHNPGAFAG-DTSI----GRFKNVCYILVTAYFSFGGM 304

Query: 298 ELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXX 357
           EL  + V E  NPRK+ P A K ++YRI+V YL+++ L+G  VP+ND  L+         
Sbjct: 305 ELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHA 364

Query: 358 XXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKT 417
              P+V+A    G+ ++PHI+NA ILI V S ANS LY   R +  LA    AP+     
Sbjct: 365 S--PYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYV 422

Query: 418 NKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKA 477
           +++G P  +L+V  +F ++A++  SS    VFT+      +  L +W SI+++++RF +A
Sbjct: 423 DREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQA 482

Query: 478 FRVQGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
            +VQG     L Y++    +G+ + +FF IL+
Sbjct: 483 MKVQGRSLDELGYKATTGIWGSIYGVFFNILV 514

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  236 bits (603), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 154/471 (32%), Positives = 236/471 (50%), Gaps = 12/471 (2%)

Query: 64  VTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXF 123
           V+  S  D +     + + L++RHV +                                 
Sbjct: 36  VSQGSVLDIESQKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAV 95

Query: 124 VGLLVFFVMSCLGEMAAYIPLDGFTS-YS--TRYADPALGFAVGYAYLFKYWIIVPNQLT 180
           + L V+ VM+ + EM   IPL G ++ YS    Y +  L F  G+   +   +I P ++T
Sbjct: 96  MSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVT 155

Query: 181 AGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXX 240
           A AL++QYW D    NP ++I+I LV  + I  L V+ FGE E+++S++KI  +      
Sbjct: 156 ACALLVQYWTD---ANPAIFISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIVGLIIV 212

Query: 241 XXXXXXXXXPNHE-VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTE 298
                    P  E VLGF YWK PGAFK Y   + G  G+F++F +  + + F++ L  E
Sbjct: 213 GVVIFFGGGPAQEHVLGFHYWKKPGAFKPY--LVEGGTGKFLAFWTAIIKSGFSFVLVPE 270

Query: 299 LCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPF-NDPLLIXXXXXXXXX 357
           +     +E   PR+ +P+A K  +YR+ +FY+  I ++G+ V + ND LL          
Sbjct: 271 IVSSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIASGQSSA 330

Query: 358 XXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKT 417
              PFV+ I  AGI VLPHI+NA IL   +S     LY ASR+L+ +A    APRI    
Sbjct: 331 AASPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAPRILTTV 390

Query: 418 NKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKA 477
           NK GVPY+   +  LF LLAY+N S+ SS VF +  N  +I G +SW+ + I YIRF   
Sbjct: 391 NKYGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYIRFRNV 450

Query: 478 FRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
             V  ++   + ++ P Q   A+ ++ F  ++ L   F  F+   +D  +F
Sbjct: 451 IDVLKLNDR-IPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNF 500

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  237 bits (604), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 143/442 (32%), Positives = 232/442 (52%), Gaps = 13/442 (2%)

Query: 125 GLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGA 183
           G ++F ++  LGE+A   P+ G FT+Y+TR+ D + GFA  + Y+ ++ +++P ++ A +
Sbjct: 134 GTMIFTMVMALGELAVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAAS 193

Query: 184 LVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXX 243
           + + YW    +   G ++ +  + ++ IN  GVR +GE E+  S +K+T +         
Sbjct: 194 ITVAYWETPVRYTDG-FVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIV 252

Query: 244 XXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIV 303
                 P    +G +YW NPGAF   ++       +F  F SVFV A F++ G+EL G+ 
Sbjct: 253 LVCGGGPVGGYVGARYWHNPGAFVGSTSG-----QKFHGFCSVFVTAAFSFAGSELIGLA 307

Query: 304 VSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFV 363
            SE KNPRKAVP A K   +RI++FY+I + L+G  VP+NDP LI            PFV
Sbjct: 308 GSEAKNPRKAVPSAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASAS--PFV 365

Query: 364 VAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVP 423
           +AIV  GI  LP ++N  ILI V S  NS +Y  SR+L  L+     P+I +  +++G P
Sbjct: 366 IAIVTHGISGLPSVINVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRP 425

Query: 424 YWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGI 483
              + +   F L+A++  S+  +E+F + +    +    +W +I I +IRF  A + QG 
Sbjct: 426 LVGIAISSTFGLIAFVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGR 485

Query: 484 DKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAF--LGDTFDYKSFXXXXXXXXXXXXX 541
               L + SP    G+++ LF  IL+ + + + A   +G +     F             
Sbjct: 486 GTDELPFVSPAGVIGSYWGLFLNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAF 545

Query: 542 XXXXKLWYKTK--IIPSEEVDL 561
               KLW K    +IP E+VD+
Sbjct: 546 YIAHKLWKKNWKFLIPLEDVDI 567

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  236 bits (601), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 144/496 (29%), Positives = 233/496 (46%), Gaps = 21/496 (4%)

Query: 27  GDDNIVIERSSQ--LFYDGQSDSKVHG----------ITSGHGSDVKNVVTHTSEFDGKH 74
           G DN+V+E  SQ  + YD    S                     ++   +T       K 
Sbjct: 15  GGDNVVVENISQEPVSYDQSQGSSTEAHSRWGRFKESFKRAEEMELDPNLTEAERIAIKT 74

Query: 75  DGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSC 134
               LK  L+ RH+ M                                  G +++ ++  
Sbjct: 75  AQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMA 134

Query: 135 LGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRD 193
           +GE+A   P+  GFT+Y+TR+ D + GFA  + Y+ ++ +++P ++ A ++ + YW    
Sbjct: 135 VGELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDP 194

Query: 194 KVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHE 253
           K   G ++ +  V I+ IN  GV+ +GE E+  S +K+  +                +H+
Sbjct: 195 KYRDG-FVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHK 253

Query: 254 VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKA 313
            +G +YW NPGAF   +     A  +F  F +VFV A F++ G+EL G+  SE + PRK+
Sbjct: 254 YIGAQYWYNPGAFVGDT-----AGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKS 308

Query: 314 VPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPV 373
           VP A K   +RI +FY++ + L+GM VP + P LI            PFV+AIVN GI  
Sbjct: 309 VPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAAS--PFVIAIVNHGIKG 366

Query: 374 LPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLF 433
           LP ++N  ILI V S  NS +Y  SR+L  LA     P I    ++ G P   + +   F
Sbjct: 367 LPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFF 426

Query: 434 ALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSP 493
            L+A++  S    +VF + +    +  L +W  I + +IR+  A   QG     L +Q+P
Sbjct: 427 GLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAP 486

Query: 494 LQPYGAWFSLFFCILI 509
              +G+++  F CIL+
Sbjct: 487 AGVWGSYWGFFMCILM 502

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  235 bits (600), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 153/527 (29%), Positives = 253/527 (48%), Gaps = 37/527 (7%)

Query: 19  DIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGI- 77
           DIE Q + G  +       Q    G SD KV           +N VT + + D    G  
Sbjct: 2   DIEMQSVVGYSSSTATPIGQ----GASDMKVK----------ENFVTESIQEDDLERGSI 47

Query: 78  ----------RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLL 127
                     ++++ L++RH+ +                                 +   
Sbjct: 48  DVLIDEKPSHQMQRGLKSRHMQLIALGCAIGTGLFIGTGGALSTCGPAPLLISYIIMSFF 107

Query: 128 VFFVMSCLGEMAAYIPLDGFTSY---STRYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
           V+ +M  L EM    P+ G  S    +  Y +  L F  G+   +   +I P+++TA  L
Sbjct: 108 VWTIMHQLTEMVVLTPIPGEASMYALARAYLNRPLSFMCGWNLFYAQAMIAPSEITASTL 167

Query: 185 VIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXX 244
           +IQYW D    N  ++++I +V  I +  L V+ FGE E+++S +K+  +          
Sbjct: 168 LIQYWTD---ANSAIFVSIFIVITIAVTALPVKVFGESEFWVSMIKLITITGLIILGVVI 224

Query: 245 XXXXXPN-HEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGI 302
                PN H VLGF YWK+PGAFK + +  TG  G+F++  +  + + FA+ L  E    
Sbjct: 225 FFGGGPNQHHVLGFHYWKHPGAFKPHIS--TGNTGKFLAVWTAIIKSGFAFILSPETLTS 282

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPF-NDPLLIXXXXXXXXXXXXP 361
             +E   PR+ +P+A    ++R+++FY+    ++G+ V + N  LL             P
Sbjct: 283 CSAEADRPRRNMPRAANRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAIASGQSNAAASP 342

Query: 362 FVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQG 421
           FV+ I   GI VLPHI+NA IL   +SA  +++Y ASR L+ +A+   AP+IFA+ N+ G
Sbjct: 343 FVIGIKEVGIKVLPHIINAAILTGAYSAGTAEMYGASRMLHSMALKGNAPKIFARVNRYG 402

Query: 422 VPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ 481
           VPY+S++V   F  LAY+N S+ +S+VFT+  N  +I G +SW+ + ITY+RF +     
Sbjct: 403 VPYYSIIVPSCFCFLAYLNCSNSASQVFTWLTNISTISGFISWVFVSITYVRFRRVIDYL 462

Query: 482 GIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
            ++   + ++ P Q   A+FS  F +++ L   +  F    +    F
Sbjct: 463 DLNDR-IKFRKPFQRIFAYFSGCFFVILSLTNGYAVFTKGNWSVSDF 508

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  234 bits (598), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 136/394 (34%), Positives = 213/394 (54%), Gaps = 10/394 (2%)

Query: 123 FVGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
            +GL+++ V+  +GE+A   P+ G FT+Y+TR+ D + GFA+ Y Y+ ++ +++P ++ A
Sbjct: 121 LIGLMIYCVVMSMGELAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVA 180

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
            ++ + +W    K   G ++ +  + I+ INF GVR +GE E+  S +K+  +       
Sbjct: 181 ASITVNFWGTPPKYRDG-FVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILG 239

Query: 242 XXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCG 301
                   P    +G KYW NPGAF         A  RF    SVFV A F++ GTEL G
Sbjct: 240 IVLVCGGGPVGGYIGGKYWHNPGAFSG-----DDAGSRFKGVCSVFVTAAFSFAGTELVG 294

Query: 302 IVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXP 361
           +  +E  NPRKA+P+A K   +RI++FY+IS+ L+G+ VP     LI            P
Sbjct: 295 LASAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAAS--P 352

Query: 362 FVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQG 421
           FV+AI   GI  LP ++N  ILI V S  NS +Y  SRS+  LA     P IFA  +++G
Sbjct: 353 FVLAIQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKG 412

Query: 422 VPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ 481
            P  +++   +F LL+++  S    +VF + +    +  L SW +I I +IRF +A   Q
Sbjct: 413 RPLVAIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQ 472

Query: 482 GIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF 515
           G     LA+ S     G++F +   +L+ LI  F
Sbjct: 473 GRSTDELAFVSYAGIAGSYFGVILVLLV-LIAQF 505

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  233 bits (595), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 138/411 (33%), Positives = 220/411 (53%), Gaps = 12/411 (2%)

Query: 124 VGLLVFFVMSCLGEMAAYIPLDG---FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLT 180
           +   V+ +M+ + EM   IPL G     S +  Y +  + F  G+   +   +IVP ++T
Sbjct: 100 ISFFVWSIMNQMTEMVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEIT 159

Query: 181 AGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXX 240
           A AL++QYW D    N  ++I+I +V  I +  L V+ FGE E+++S++KI  +      
Sbjct: 160 ACALLVQYWTD---ANSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIV 216

Query: 241 XXXXXXXXXPNHE-VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTE 298
                    P  + VLGF YWKNPGAF  +     G  GRF++  +  + + F++ L  E
Sbjct: 217 GIVIFFGGGPAQDHVLGFHYWKNPGAFNPHLA--EGNTGRFLAVWTAIIKSGFSFVLVPE 274

Query: 299 LCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXX-X 357
                 +EC  PR+ +PKA +  +YR+ +FY++   ++G+ V FN+  LI          
Sbjct: 275 TVTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDA 334

Query: 358 XXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKT 417
              PFV+ I  AGI +LPHI+NACIL   +S     LY +SR+LY +A+   AP+IFAK 
Sbjct: 335 AASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKV 394

Query: 418 NKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKA 477
           N+ G PY+S  +  LF+ LAY+N S  +S VF +  N  +I G +SWI + +TYIRF K 
Sbjct: 395 NRFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKV 454

Query: 478 FRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
                ++   + ++ P Q   A+ +  F  ++ L   +  F+   ++   F
Sbjct: 455 INALDLNDR-VPFRRPFQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDF 504

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  235 bits (600), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 165/585 (28%), Positives = 262/585 (44%), Gaps = 34/585 (5%)

Query: 6   YLDAQ-LSRVDTDEDIEKQQLFGDDNIV---IERSSQLFYDG-QSDSKVHGITSGHGSDV 60
           Y D + +  V+ DE ++    FG D +    I R    F    Q  ++ H +     +D+
Sbjct: 54  YFDKENVDGVNIDEKLQSTTEFGGDEMPRGNIRRFIDSFKRAEQQPNQQHNLAEDLENDL 113

Query: 61  KNVVTH----------TSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXX 110
              ++           T     K +   LKK+++ RHV M                    
Sbjct: 114 TTAISMNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALH 173

Query: 111 XXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIP--LDGFTSYSTRYADPALGFAVGYAYL 168
                        +G  ++ ++   GEMA      L GF +Y +   DP  GFAV + Y 
Sbjct: 174 NAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYC 233

Query: 169 FKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISA 228
            ++  + P +L   +L I+YW     VNP  ++ I  V II I   G R + E E++ + 
Sbjct: 234 LQWLCVCPLELVTTSLTIKYWTT--TVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNC 291

Query: 229 VKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFV 288
            KI ++                N   LG KYW +PGAF+      T    RF    + FV
Sbjct: 292 CKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAFRG-----TNGIQRFKGIMATFV 346

Query: 289 LALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLI 348
            A FA+  TE   +  +E  NPRKA+P A K  +YR+I  ++ +I LLG  VP++   L+
Sbjct: 347 SAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLM 406

Query: 349 XXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDN 408
                       P+V+AI   G+ V+PH +NA ILI VFS ANS  Y +SR L GLA   
Sbjct: 407 GAGGSATKAS--PYVLAISIHGVRVVPHFINAVILISVFSVANSAFYSSSRLLLGLAQQG 464

Query: 409 KAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISIL 468
            AP+ F   ++QG P+ ++    LF ++A+   S    +VFT+ +    +  L +WI+I 
Sbjct: 465 YAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAIC 524

Query: 469 ITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF-----PAFLGDTF 523
           +++IRF +A  VQG     + +++ L  YG++++    +L  LI  F     P       
Sbjct: 525 VSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVL-ALIAQFWVAIAPIGNNGDL 583

Query: 524 DYKSFXXXXXXXXXXXXXXXXXKLWYK--TKIIPSEEVDLVSFKE 566
           D + F                 KLW +     I ++++DL S+++
Sbjct: 584 DAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQ 628

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  234 bits (596), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 149/450 (33%), Positives = 229/450 (50%), Gaps = 16/450 (3%)

Query: 124 VGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
           V   +F V++ LGE+AA  P+  GF  Y TR+ +P+  FA+   YL ++ +++P +L A 
Sbjct: 133 VSTCLFTVINSLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAA 192

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           ++ I+YW   DK+N   W+ I   AI   N L V+ FGE E+ +S VKI  +        
Sbjct: 193 SITIRYW--NDKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGI 250

Query: 243 XXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGI 302
                  P+   +G KYW NPGAF  +S     A  +F    SVFV A F+Y G E+  +
Sbjct: 251 VLTCGGGPHGGYIGGKYWHNPGAFVGHS-----AGSQFKGLCSVFVTAAFSYSGIEMTAV 305

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPF 362
             +E +NP++ +PKA K T + I V Y+  + L+G  VP+NDP L+            P 
Sbjct: 306 SAAESRNPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAAS-PL 364

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+AI N GI  LP +MNA ILI + S ANS +Y  SR +  +A     P+  +K +K+G 
Sbjct: 365 VIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGR 424

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           P  ++L+ + F LL+++  S    EVFT+      +  +  W++I ++ IRF  A + QG
Sbjct: 425 PLNAILLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQG 484

Query: 483 IDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFL----GDTFDYKSFXXXXXXXXXX 538
                + + S    +GAW+ +    L+ L+ +F   L      T   KSF          
Sbjct: 485 RSLDEMPFLSQSGTWGAWYGVIVLFLV-LVASFWTSLFPVGSSTASAKSFFEGYLSLPIL 543

Query: 539 XXXXXXXKLWYK--TKIIPSEEVDLVSFKE 566
                  KLW +    ++P  E+DL S + 
Sbjct: 544 IACYVGHKLWKRDWRLLVPLMEMDLDSGRR 573

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  233 bits (594), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 140/470 (29%), Positives = 230/470 (48%), Gaps = 11/470 (2%)

Query: 42  DGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXX 101
           +G++    H         V++  +   E   +     LKKA+++RHV M           
Sbjct: 29  EGRASGVFHRFIDSFKPPVEDEKSDLEEMSMESTDRHLKKAMKSRHVIMMTLGTGVGTGL 88

Query: 102 XXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL--DGFTSYSTRYADPAL 159
                                 V  + +F++   GEMA   P     F +Y++ +    +
Sbjct: 89  LVANAKGLSYGGPGALVIGYILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPV 148

Query: 160 GFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFF 219
           GFA  + +L ++  ++P +L  G + IQYW   D +N  VWI I  V ++ ++  GV+ +
Sbjct: 149 GFATVWLFLIQWLTVLPLELITGTMTIQYW--NDSINADVWIVIFYVFLLCVHVFGVKAY 206

Query: 220 GEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGR 279
           GE+E+  +  KI  +                    +G KYWKNPG+F   ++A     GR
Sbjct: 207 GELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYIGAKYWKNPGSFASSTSA-----GR 261

Query: 280 FVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMC 339
           F     V V A F+Y GTEL  + V+E  NPR++ PKA K ++YRI++ YL+++ L+G  
Sbjct: 262 FKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFN 321

Query: 340 VPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASR 399
           VP ++  L+            P+V+A    G+ V+PHI+NA ILI V S  NS LY A R
Sbjct: 322 VPHDNDQLMGAGGSSTHAS--PYVLAASIHGVKVVPHIINAVILICVTSMGNSSLYAAQR 379

Query: 400 SLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIF 459
               LA    AP+  A  +++G P  +L    +  ++A+   SS   +VFT+     ++ 
Sbjct: 380 LFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGVIAFAAASSQEEQVFTWLAAIAALS 439

Query: 460 GLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
            L +W +IL+++IRF  A +VQG D + L Y++    +G+ +   FC+L+
Sbjct: 440 ELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTGVWGSMWGFGFCVLV 489

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  234 bits (596), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 147/499 (29%), Positives = 242/499 (48%), Gaps = 24/499 (4%)

Query: 26  FGDDNIVIERSSQLFYDGQSDSK---VHGI------TSGHGSDVKNVVTHTSEFDGKHDG 76
           F   N +   SS+  Y GQ+      +H          G  +  K +  +TS+ +G  + 
Sbjct: 25  FSAVNNLQSSSSEKNYSGQTTRNNKLIHRFVDSFKRAEGSTTHTKQINENTSDLEGDVNS 84

Query: 77  I----RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVM 132
                +LKK++++RHV M                                 V  + +F++
Sbjct: 85  FTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMI 144

Query: 133 SCLGEMAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190
              GEMA   P     F +YS+ +     GFA  + Y F++  ++P +L   A+ I++W 
Sbjct: 145 QAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFW- 203

Query: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXP 250
             D +NP ++I I  V ++ I+F GV+ +GE E+  +  KI ++                
Sbjct: 204 -NDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAG 262

Query: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310
           N   +G KYW+NPGAF   ++A     GRF +   + V A F++ G EL  + V E  NP
Sbjct: 263 NDGYIGGKYWRNPGAFAGDTSA-----GRFKNVCYILVTAYFSFGGMELFALSVQEQANP 317

Query: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAG 370
           RK  P A K ++YRI+V YL+++ L+G  VP+ND  L+            P+V+A    G
Sbjct: 318 RKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHG 375

Query: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430
           + V+PHI+NA ILI V S ANS LY   R +  LA     P+     +++G P  +L+V 
Sbjct: 376 VKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVC 435

Query: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490
            +F ++ ++  SS    VF +      +  L +W SI+++++RF +A +VQG     L Y
Sbjct: 436 SVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGY 495

Query: 491 QSPLQPYGAWFSLFFCILI 509
           ++    +G+ + +FF IL+
Sbjct: 496 KATTGIWGSAYGVFFNILV 514

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  231 bits (588), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 143/460 (31%), Positives = 225/460 (48%), Gaps = 18/460 (3%)

Query: 59  DVKNVVTHTSEFDGK----HDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXX 114
           ++K+ V H S+F+       +  +L K L  RH+                          
Sbjct: 64  NIKSDVPHVSDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGP 123

Query: 115 XXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWI 173
                    V   +F +++ LGE+AA  P+  GF  Y TR+ +P+ GFAV   YL ++ +
Sbjct: 124 ASLIVAWVIVSTCLFTIVNALGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAV 183

Query: 174 IVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITV 233
           ++P +L A ++ I+YW   + +N   W+ I   AI   N L V+ FGE E+ +S +KI  
Sbjct: 184 LLPLELVAASITIRYW--NNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILA 241

Query: 234 MXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGR-FVSFASVFVLALF 292
           +               P+ E +G +YW +PGAF      +    GR F    +VFV A F
Sbjct: 242 IIGFTILGIVLACGGGPSGEYIGGRYWNDPGAF------VGDTPGRRFKGVCAVFVTAAF 295

Query: 293 AYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXX 352
           +Y GTEL  +  +E  NPR  +PKA K T + I + Y+  + ++G  VP+ND  L+    
Sbjct: 296 SYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNS 355

Query: 353 XXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPR 412
                   P V+AI N GI  LP +MNA ILI + S ANS +Y  SR +  +A     P+
Sbjct: 356 SVDAAAS-PLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPK 414

Query: 413 IFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYI 472
                +K+G P +++   ++F LL+++  S    EVFT+      +  L  W SI +++I
Sbjct: 415 RLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHI 474

Query: 473 RFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLI 512
           RF +A + Q    + L + S    YG+W+    CI+I L+
Sbjct: 475 RFRQAMKAQDRSLNELPFVSITGVYGSWYG---CIVIFLV 511

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  230 bits (587), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 143/447 (31%), Positives = 227/447 (50%), Gaps = 14/447 (3%)

Query: 128 VFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVI 186
           +F V++ LGEMAA  P+  GF  Y TR+ DP++GFAV   YL ++ +++P +L A ++ I
Sbjct: 119 LFTVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTI 178

Query: 187 QYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXX 246
           +YW   D +N   W+ I    I   N L V+ FGE E+ +S VKI  +            
Sbjct: 179 KYW--NDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSC 236

Query: 247 XXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSE 306
              P    LG KYW NPG+F  +++       +F    SVFV A F+Y G E+  +  +E
Sbjct: 237 GGGPQGGYLGGKYWHNPGSFVGHTSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAE 291

Query: 307 CKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAI 366
            K+PR+ +PKA K T + I   Y+  + L+G  VP+++P L+            P V+AI
Sbjct: 292 SKDPRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASS-PLVIAI 350

Query: 367 VNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWS 426
            N GI  LP +MNA ILI + S ANS +Y  SR +  +A     P++    +K+G P  +
Sbjct: 351 ENGGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNA 410

Query: 427 LLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKS 486
           +L  + F LL+++  S   +EVFT+      +  +  W++I I++IRF +A + Q     
Sbjct: 411 ILFTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLD 470

Query: 487 TLAYQSPLQPYGAWFS---LFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXX 543
            L Y S    +G+W+    LF  +++    +     G   D +SF               
Sbjct: 471 ELPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYV 530

Query: 544 XXKLWYKTK--IIPSEEVDLVSFKEAV 568
             KL Y+ K  ++  E++D+ + +  V
Sbjct: 531 GHKLVYRKKQIVVALEDMDIDTGRRQV 557

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  230 bits (586), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 154/503 (30%), Positives = 244/503 (48%), Gaps = 24/503 (4%)

Query: 21  EKQQLFGDDNIVIERSSQLFYDGQSDS----KVHGITSGHGSDVKNVVTHTSEFDGKH-- 74
           +   L G +N  IE +S    + +S+S     V   T+  G+  KN+   ++  D     
Sbjct: 23  QGSSLSGGNN-SIEMNSSFITEKRSNSLKEDNVMIQTTSSGA-TKNINGTSNPNDSNMLS 80

Query: 75  ----DGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
               DG  L K L  RH+                                   V   +F 
Sbjct: 81  KEDIDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFT 140

Query: 131 VMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
           V++ LGE+AA  P+  GF+ Y TR+ DP++ F++   YL ++ +++P +L A ++ I+YW
Sbjct: 141 VINSLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYW 200

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
              DK+N   W++I    I  +N L V+ FGE E+ +S +KI  +               
Sbjct: 201 --NDKINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGG 258

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
           P    +G KYW +PGAF  ++     A  +F    SVFV A F+Y G E+  +  +E  +
Sbjct: 259 PVGGYIGGKYWHDPGAFVGHT-----AGSQFKGLCSVFVTAAFSYSGIEMIAVSAAESID 313

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           PRK +P A K T + I   Y+  + L+G  VP++DP L+            P V+AI N 
Sbjct: 314 PRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASS-PLVIAIENG 372

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
           GI  LP +MNA ILI V S ANS +Y  SR +  +AI    P+   + +K+G P  + LV
Sbjct: 373 GIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLV 432

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
            + F L++++  S   +EVFT+      +  +  W+ I I++IRF +A  +QG     + 
Sbjct: 433 TLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMP 492

Query: 490 YQSPLQPYGAWFSLFFCILIGLI 512
           Y S +  YG+W+    CI++ L+
Sbjct: 493 YLSQVGVYGSWYG---CIILFLV 512

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  229 bits (585), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 136/389 (34%), Positives = 206/389 (52%), Gaps = 10/389 (2%)

Query: 128 VFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVI 186
           +F +++ LGE+AA  P+  GF  Y TR  DP+LGFAV   YL ++ +++P +L A ++ I
Sbjct: 120 LFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITI 179

Query: 187 QYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXX 246
           +YW   + VN   W+ +  V I   + L V+ FGE E+ +S VKI  +            
Sbjct: 180 RYW--NNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLIC 237

Query: 247 XXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSE 306
              P +  +G KYW +PG+F   S        +F    SVFV A F+Y GTEL G+  +E
Sbjct: 238 GGGPKNGYIGAKYWNDPGSFVGASPG-----SQFKGLCSVFVTAAFSYSGTELVGVSAAE 292

Query: 307 CKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAI 366
             NPR  +PKA K T + I + YL+ + ++G  V  +DP L+            P V+AI
Sbjct: 293 SANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAAS-PLVIAI 351

Query: 367 VNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWS 426
            N GI  LP +MNA ILI + S ANS +Y  SR +  +A     PRIF   + +G P  +
Sbjct: 352 ENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVA 411

Query: 427 LLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKS 486
           ++  ++F LL+++  S+   E+F +      +  L  W++I I++IRF +A   QG    
Sbjct: 412 IIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLD 471

Query: 487 TLAYQSPLQPYGAWFSLFFCILIGLIKNF 515
            L Y S     G+W+     IL+ LI +F
Sbjct: 472 ELPYLSMTGVIGSWYGCVVIILV-LIASF 499

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  229 bits (583), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 162/547 (29%), Positives = 257/547 (46%), Gaps = 26/547 (4%)

Query: 35  RSSQLFYDG---QSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMX 91
           RS++  YD    ++DSK   + SG  +     +  TS+     D  R  K L  RH+   
Sbjct: 26  RSARSRYDSADDRADSKQKDLMSGSETKALENLDSTSQEVEDQDA-RYNKDLSVRHLLTL 84

Query: 92  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSY 150
                                           +   +F +++ LGE+++  P+  GF  Y
Sbjct: 85  AVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVY 144

Query: 151 STRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIIT 210
            +R+ +P+ GFAV   YL ++ +++P +L A +L I+YW     +N   W+ I    I+ 
Sbjct: 145 ISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYW--NHTINSDAWVAIFYTIILL 202

Query: 211 INFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYS 270
            N L V+ FGE E+ +S VKI  +               P    +G KYW NPGAF  ++
Sbjct: 203 ANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAFVGHT 262

Query: 271 TAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYL 330
                A  RF    SVFV A F+Y GTEL  +  +E  NPR  +PKA K T + I V Y+
Sbjct: 263 -----AGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYI 317

Query: 331 ISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAA 390
           + + L+G  V  +DP L+            P V+AI N GI  LP +MNA ILI V S A
Sbjct: 318 VVLTLVGCLVSSDDPRLLNGSSSVDVAAS-PLVIAIENGGIKGLPSLMNAIILIAVLSVA 376

Query: 391 NSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFT 450
           NS +Y  SR +  +A     P++F   +++G P ++++  ++F LL+++  S    EVFT
Sbjct: 377 NSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEVFT 436

Query: 451 YFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIG 510
           +      +  L  W +I +++IRF +  + +G     L + S     G W S + CI+I 
Sbjct: 437 WLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMT---GVWGSYYGCIVIF 493

Query: 511 LI-------KNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKT--KIIPSEEVDL 561
           ++         FP   G+  + +SF                 KL+ ++   + P++E+DL
Sbjct: 494 IVLVVCFWTSLFPGG-GEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDL 552

Query: 562 VSFKEAV 568
            S + AV
Sbjct: 553 DSGRRAV 559

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  229 bits (584), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 150/519 (28%), Positives = 249/519 (47%), Gaps = 30/519 (5%)

Query: 9   AQLSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSK---VHGIT------SGHGSD 59
               + D   D    + F D+N     S++  Y  Q   +   +H  T       G  + 
Sbjct: 8   GSFGKKDPSPDFISTRSFSDENNFQLSSNEKIYSEQKPKRNRLIHRFTDSFKRAEGSTTK 67

Query: 60  VKNVVTHTSEFDGKHDGI-------RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXX 112
           +K +  +TS+ +   DGI       +LKK++++RHV M                      
Sbjct: 68  IKPINENTSDLE---DGIQSFTSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYG 124

Query: 113 XXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFK 170
                      V  + +F++   GEMA   P     F +YS+ +     GFA  + Y F+
Sbjct: 125 GPAALVIGYVLVSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQ 184

Query: 171 YWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVK 230
           +  ++P +L   ++ IQ+W   DK+NP ++I I  V ++ ++F GV+ +GE E+  +  K
Sbjct: 185 WTTVLPLELITASMTIQFW--NDKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCK 242

Query: 231 ITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLA 290
           I ++                N   +G  YW  PGAF    T+I     RF +   + V A
Sbjct: 243 ILMIAGFIVLSVVINCGGAGNDGYIGGAYWHKPGAFAG-DTSI----ARFKNVCYILVTA 297

Query: 291 LFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXX 350
            F++ G EL  + V E  NPRK+ P A K ++YRI+V YL+++ L+G  VP+ND  L+  
Sbjct: 298 YFSFGGMELFVLSVQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGA 357

Query: 351 XXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKA 410
                     P+V+A    G+ ++PHI+NA ILI V S ANS LY   R +  LA    A
Sbjct: 358 GGSATHAS--PYVLAASIHGVRIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYA 415

Query: 411 PRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILIT 470
           P+     +++G P  +L+V  +  ++A++  SS    VFT+      +  L +W SI+++
Sbjct: 416 PKFLDYVDREGRPLRALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLS 475

Query: 471 YIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
           ++RF +A +VQG   + L Y++    +G+ +  FF IL+
Sbjct: 476 HLRFRQAMKVQGRSLNELGYKATTGIWGSIYGSFFNILV 514

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  230 bits (586), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 153/516 (29%), Positives = 240/516 (46%), Gaps = 36/516 (6%)

Query: 2   AEKVYLDAQLSRVDTDEDIEKQ-QLFGDDNIVIERSSQLFYDGQSDSKVHGIT--SGHGS 58
           A + +LD+   R D D++ E +     D    I  SS+  ++ + D     I   +GH S
Sbjct: 55  AVRRFLDS-FKRADQDQEQEAEVAQMNDLTSAISPSSRQAHELEKDETTDKIAPHTGHKS 113

Query: 59  DVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXX 118
           D                   LKK ++ RHV M                            
Sbjct: 114 D------------------SLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLL 155

Query: 119 XXXXFVGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVP 176
                +G +++ ++   GEMA  Y  L G + +Y +   D   GFAV + Y  ++  + P
Sbjct: 156 IGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCP 215

Query: 177 NQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXX 236
            +L   ++ I+YW     VNP V++ I  V +ITIN  G R + E E++ +  KI +M  
Sbjct: 216 LELVTASMTIKYWTT--SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTG 273

Query: 237 XXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLG 296
                         N   +G KYW  PGAF         A  RF    +  V A FA+ G
Sbjct: 274 FFILGIIIDVGGAGNDGYIGGKYWHEPGAFNGVH-----AIDRFKGVVATLVTAAFAFGG 328

Query: 297 TELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXX 356
           +E   I  +E  NPRKA+P A K  +YRI+  +L +I ++G  VP+N   L+        
Sbjct: 329 SEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTK 388

Query: 357 XXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAK 416
               P+V+AI + G+ V PH +NA IL+ V S ANS  Y ++R    L+    AP+IF+ 
Sbjct: 389 AS--PYVIAIASHGVRVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSY 446

Query: 417 TNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDK 476
            ++ G P  ++ V  LFA++A+   S    +VFT+ +    +  L +W +I +++IRF +
Sbjct: 447 IDRAGRPLIAMCVSALFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRR 506

Query: 477 AFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLI 512
           A +VQG     L ++S     G W S++ CI++ LI
Sbjct: 507 AMKVQGRSLGELGFKSQT---GVWGSIYSCIMMILI 539

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  229 bits (583), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 136/391 (34%), Positives = 209/391 (53%), Gaps = 12/391 (3%)

Query: 123 FVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
            +GL+++ V+  +GE+A   P+  GFT+Y  R+ D + GFA+ Y Y+ ++ +++P ++ A
Sbjct: 124 LIGLMIYSVVMAMGELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVA 183

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
            ++ + YW    K   G ++ +  V I+ IN  GV+ +GE E+  S +K+T +       
Sbjct: 184 ASITVNYWGTPAKYRDG-FVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILG 242

Query: 242 XXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCG 301
                   P    +G KYW NPGAF         A  RF +  SVFV A F++ GTEL G
Sbjct: 243 IVLICGGGPVGGYVGGKYWHNPGAFNG-----DNAGQRFKAVCSVFVTAAFSFAGTELVG 297

Query: 302 IVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXP 361
           +  +E +NPRKA+P+A K   +RI +FY+IS+ L+G+ VP+    LI            P
Sbjct: 298 LAAAETENPRKALPRAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAAS--P 355

Query: 362 FVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQG 421
           FV+AI   GI  LP ++N  ILI V S  NS +Y  SR+L  LA     P+IF+  +++G
Sbjct: 356 FVLAIKTHGISGLPSVINVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKG 415

Query: 422 VPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ 481
            P   +L    F LL ++  S    +VF + +    +  L +W  I I ++RF +A   Q
Sbjct: 416 RPLVGILATCTFGLLCFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQ 475

Query: 482 GIDKSTLAYQSPLQPYGAWFSLFFCILIGLI 512
           G     LA+ S +   G W S F  ILI L+
Sbjct: 476 GRSTDELAFTSYV---GVWGSYFGVILICLV 503

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  227 bits (579), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 147/498 (29%), Positives = 234/498 (46%), Gaps = 26/498 (5%)

Query: 78  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGE 137
           ++KK +++RH+ M                                    +++ ++   GE
Sbjct: 63  KMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAAGE 122

Query: 138 MA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKV 195
           +   Y  + G +T+YS+   DPALGF+V + Y  ++  + P QL   A+ I+YW D    
Sbjct: 123 LGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYWTD---T 179

Query: 196 NPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVL 255
           NP +++ IL   I+ IN  G + + E E+  +  K+ +M                N   +
Sbjct: 180 NPDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYI 239

Query: 256 GFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVP 315
           G +YW  PGAF       TG KG       VF  A FAY G E+  +  SE +NPRK++P
Sbjct: 240 GARYWHTPGAFS------TGFKG----VCYVFCYAAFAYGGIEVMVLTASEQENPRKSIP 289

Query: 316 KAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLP 375
            A K  +YRI++ Y+++  ++   VP++ P L             PFV+AI + GI V+P
Sbjct: 290 SACKKVIYRILLIYMLTTLIVCFLVPYDAPEL---TSTGSASRASPFVIAIASHGISVVP 346

Query: 376 HIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFAL 435
           HI+NA IL+ V S  NS LY A R L  L+    AP++F   ++QG P    LV +   L
Sbjct: 347 HIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGL 406

Query: 436 LAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQ 495
           LA++  S    +VF++ +    +  L  WISI ++++RF  A + QG     + Y+S   
Sbjct: 407 LAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTG 466

Query: 496 PYGAWFSLFFCILIGLIKNF-----PAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK 550
            +G+WF++   + + L+  F     P   G     K F                 K++YK
Sbjct: 467 YWGSWFAIIVSLFV-LVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIYYK 525

Query: 551 --TKIIPSEEVDLVSFKE 566
                IP+ EVDL S ++
Sbjct: 526 DWRLCIPATEVDLNSHRK 543

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  227 bits (579), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 131/386 (33%), Positives = 207/386 (53%), Gaps = 9/386 (2%)

Query: 125 GLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGA 183
           G +++ ++  + E+A   P+  GFT+Y+TR+ D + GFA  + Y+ ++ + +P ++ A +
Sbjct: 130 GSMIYCMVMSVAELAIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAAS 189

Query: 184 LVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXX 243
           + + YW    K   G ++ +  V I+ IN  GVR +GE E+  S  KI ++         
Sbjct: 190 ITVNYWHTDKKYRDG-FVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAII 248

Query: 244 XXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIV 303
                 P    +G +YW +PGAF   ++       +F  F SVFV A F++ G+EL G+ 
Sbjct: 249 LICGGGPGTGYIGARYWYHPGAFAGDTSG-----RKFKGFCSVFVTAAFSFAGSELVGLA 303

Query: 304 VSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFV 363
            +E  NPRK VP A K   +RI +FY++ + L+GM VP+ DP LI            PFV
Sbjct: 304 AAEASNPRKDVPGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAAS--PFV 361

Query: 364 VAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVP 423
           +AI N GI  LP ++N  ILI V S  NS +Y  SR+L  LA     P+ F+  ++ G P
Sbjct: 362 IAIKNQGISGLPTLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRP 421

Query: 424 YWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGI 483
              + V   F L+A++  S    EVF + +    +  L +W +I + +IRF +A   QG 
Sbjct: 422 MVGIAVTSAFGLIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGR 481

Query: 484 DKSTLAYQSPLQPYGAWFSLFFCILI 509
             + LA+ SP   +GA + LF CI++
Sbjct: 482 STNELAFASPAGVWGAAWGLFLCIIM 507

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  227 bits (579), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/390 (34%), Positives = 208/390 (53%), Gaps = 11/390 (2%)

Query: 124 VGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
           +G  +F V++ LGE++A  P+  GF  Y  R+ +P+  FAV   YL ++ +++P +L A 
Sbjct: 131 IGTCLFTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAA 190

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           ++ I+YW   DK+N   W+ I    I   N L V+ FGE E+ +S +KI  +        
Sbjct: 191 SITIKYW--NDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGI 248

Query: 243 XXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGI 302
                  P+   +G KYW+NPGAF  +++       +F    SVFV A F+Y G E+  +
Sbjct: 249 VLSCGGGPHGGYIGGKYWRNPGAFVGHNSGT-----KFKGLCSVFVTAAFSYSGIEMTAV 303

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPF 362
             +E KNPR+ +PKA K T + I   Y+  + L+G  VP NDP L+            P 
Sbjct: 304 SAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PL 362

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+AI N  I  LP +MNA ILI V S ANS +Y  SR +  +A     P+   + +K+G 
Sbjct: 363 VIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGR 422

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           P  ++L+ + F LL+++  S+  +EVFT+      +  +  W++I +++IRF KA +VQ 
Sbjct: 423 PMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQE 482

Query: 483 IDKSTLAYQSPLQPYGAW--FSLFFCILIG 510
                L + S     G+W  F + F +LI 
Sbjct: 483 RSLDELPFISQTGVLGSWYGFVVLFLVLIA 512

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  226 bits (577), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 136/430 (31%), Positives = 220/430 (51%), Gaps = 12/430 (2%)

Query: 128 VFFVMSCLGEMAAYIPLDGFTSY---STRYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
           V+ +M+ L EM   +P+ G TS    +  Y +  L F  G    +   +I P+++TA A+
Sbjct: 116 VWCIMNFLTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAI 175

Query: 185 VIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXX 244
           +IQYW D    N  ++I+I +V  +++  L V FFGE E+++S +K+  +          
Sbjct: 176 LIQYWTD---ANSAIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVI 232

Query: 245 XXXXXPNHE-VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGI 302
                PN + VLGF YWK+PGAF  +   + G  G+F++  +  + + F+Y L  E+   
Sbjct: 233 FFGGAPNQDKVLGFHYWKHPGAFNPH--LVPGNTGKFLACWTAIIKSGFSYVLVPEVVVS 290

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPF-NDPLLIXXXXXXXXXXXXP 361
             +E K+PR+ +P+  +  +YR+ +FY+     +G+ V + N  LL             P
Sbjct: 291 CAAEAKDPRRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASP 350

Query: 362 FVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQG 421
           FV+ I   GI VLPHI+NACIL   +S   S LY ASR L+ +A++   P+IFA TN+ G
Sbjct: 351 FVIGIQEVGIRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFG 410

Query: 422 VPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ 481
            PY+S     +F LLAY+N S  SS VFT+  N  +I G + W+ + + Y+RF K     
Sbjct: 411 TPYYSTAAASVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHA 470

Query: 482 GIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXX 541
            +       +  ++P  A+ S  F  ++ L   +  F+ D ++   F             
Sbjct: 471 NLTDKMPFRKRFMKPL-AYLSCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVL 529

Query: 542 XXXXKLWYKT 551
                ++YKT
Sbjct: 530 YIGAAIYYKT 539

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  227 bits (579), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 148/501 (29%), Positives = 236/501 (47%), Gaps = 17/501 (3%)

Query: 74  HDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMS 133
             G  LK+ ++ RHV M                                 +G  ++ ++ 
Sbjct: 97  EKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQ 156

Query: 134 CLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVD 191
             GE+A AY  L G F +Y +   DPA+ FA    Y  ++  + P ++ + A+ I+YW  
Sbjct: 157 AAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYW-- 214

Query: 192 RDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPN 251
              +NP VW  I  V II IN  G   + E +++ +  KI +                 +
Sbjct: 215 NTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGD 274

Query: 252 HEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPR 311
              +G KYW +PGAF    T I+    RF +  S  V A FA+  +E   +  SE  NPR
Sbjct: 275 SVYIGGKYWNDPGAFNG-DTGIS----RFKAIVSTLVTAAFAFGASEAVALTASEQANPR 329

Query: 312 KAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGI 371
           KA+P A K  +YRII  YL SI L+G  VP+N P L+            P+V+A+ + G+
Sbjct: 330 KAIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSS--PYVIAVASHGV 387

Query: 372 PVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGV 431
            V+P  +NA ILI V S  N   Y +SR L  L+    AP+ F   ++QG P ++++VG 
Sbjct: 388 KVVPSFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGA 447

Query: 432 LFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQ 491
           L   + +++ SS    VFT+ +    +  L +W +I I+++RF KA +VQ      L ++
Sbjct: 448 LVGCICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFR 507

Query: 492 SPLQPYGAWFSLFFCILIGL----IKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKL 547
           S +  +G+++ +F  IL+ +    +  FP    D  D ++F                 K+
Sbjct: 508 SQVGVWGSYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKI 567

Query: 548 WYK--TKIIPSEEVDLVSFKE 566
           W K     IP+ E+DL+S ++
Sbjct: 568 WKKDWRLYIPASEIDLISHRK 588

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  226 bits (577), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/389 (33%), Positives = 209/389 (53%), Gaps = 10/389 (2%)

Query: 123 FVGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
             G +++ ++  LGE+A   P+ G FT+Y+TR+ D + GFA    Y+ ++ +++P ++ A
Sbjct: 125 LTGTMIYSMVMALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVA 184

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
            ++ + YW    +   G ++ +  +AI  IN  GV+ +GE E+  S +K+  +       
Sbjct: 185 ASITVNYWGTNPRYRDG-FVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILG 243

Query: 242 XXXXXXXXPNHEVLGFKYWKNP-GAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELC 300
                   P    +G +YW +P GAF   S     A  RF    SVFV A F++ G+EL 
Sbjct: 244 IILNCGGGPVKGYIGGRYWHHPYGAFVGDS-----AGARFKGVCSVFVTAAFSFAGSELV 298

Query: 301 GIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXX 360
           G+  +E  NPRK+VPKA K   +RI +FYL+++ ++G+ VP+ +  LI            
Sbjct: 299 GLASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAAS-- 356

Query: 361 PFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQ 420
           PFV+AI   GI  LP ++N  ILI V S  NS +Y  SR+L  LA  N  P+ F   ++ 
Sbjct: 357 PFVIAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRS 416

Query: 421 GVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRV 480
           G P +S+LV   F L+A++  S    EVF + +    +  L +W  I + +IRF KA   
Sbjct: 417 GRPLYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSA 476

Query: 481 QGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
           QG     L++ SP   YG+++ LF  IL+
Sbjct: 477 QGRGTDELSFVSPAGVYGSYWGLFMIILM 505

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  226 bits (577), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 151/495 (30%), Positives = 234/495 (47%), Gaps = 22/495 (4%)

Query: 34  ERSSQLFYDGQ-SDSKVHGITSGHGS----DVKNVVTHTSEFDGKH-------DGIRLKK 81
           E+ S +F   Q S +    + S  GS       N VT +  F G         +   L K
Sbjct: 29  EKDSTIFVTEQKSKTDSTFLLSSKGSPGINQTTNDVTSSDHFRGSEGIEQEDINNTNLSK 88

Query: 82  ALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAY 141
            L  RH+                                   +   +F V++ LGE++A 
Sbjct: 89  DLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAA 148

Query: 142 IPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVW 200
            P+  GF  YS R+ +P+  FAV   YL ++ +++P +L A ++ I+YW   DK+N   W
Sbjct: 149 FPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--NDKINSDAW 206

Query: 201 ITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYW 260
           + I    I   N L V+ FGE E+ +S +KI  +               P+   +G KYW
Sbjct: 207 VAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYW 266

Query: 261 KNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKL 320
            +PGAF  +S+       +F    SVFV A F+Y G E+  +  +E KNPR+ +PKA K 
Sbjct: 267 HDPGAFVGHSSGT-----QFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKR 321

Query: 321 TMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNA 380
           T + I   Y+  + L+G  VP NDP L+            P V+AI N GI  LP +MNA
Sbjct: 322 TFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGGIKGLPSLMNA 380

Query: 381 CILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMN 440
            ILI V S ANS +Y  SR +  +A     P+   + +K+G P  ++L+ + F LL+++ 
Sbjct: 381 IILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVA 440

Query: 441 VSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAW 500
            S   +EVFT+      +  +  W++I +++IRF +A +VQ      L + S     G+W
Sbjct: 441 ASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSW 500

Query: 501 FSLFFCILIGLIKNF 515
           +  F  + + LI +F
Sbjct: 501 YG-FIVLFLVLIASF 514

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  226 bits (577), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 144/480 (30%), Positives = 226/480 (47%), Gaps = 33/480 (6%)

Query: 35  RSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXX 94
           R +Q     +S   + G  +GH SD                   LKK ++ RHV M    
Sbjct: 91  RQAQELEKNESSDNI-GANTGHKSD------------------SLKKTIQPRHVLMIALG 131

Query: 95  XXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMA-AYIPLDG-FTSYST 152
                                        +G +++ ++   GEMA  Y  L G + +Y +
Sbjct: 132 TGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPS 191

Query: 153 RYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITIN 212
              D   GFAV + Y  ++  + P +L   ++ I+YW     VNP V++ I  V +ITIN
Sbjct: 192 FLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT--SVNPDVFVIIFYVLVITIN 249

Query: 213 FLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTA 272
             G R + E E++ +  KI +M                N   +G KYW +PGAF      
Sbjct: 250 IFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFNGKH-- 307

Query: 273 ITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLIS 332
              A  RF   A+  V A FA+ G+E   I  +E  NPRKA+P A K  +YRI+  +L +
Sbjct: 308 ---AIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLAT 364

Query: 333 IFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANS 392
           I LLG  VP+N   L+            P+V+A+ + G+ V+PH +NA IL+ V S ANS
Sbjct: 365 IILLGFLVPYNSDQLLGSTGGGTKAS--PYVIAVASHGVRVVPHFINAVILLSVLSMANS 422

Query: 393 DLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYF 452
             Y ++R    L+    AP++F+  ++ G P  ++ V  LFA++A+   S    +VFT+ 
Sbjct: 423 SFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWL 482

Query: 453 VNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLI 512
           +    +  L +W +I ++++RF +A +VQG     L ++S     G W S + CI++ LI
Sbjct: 483 LAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQT---GVWGSAYACIMMILI 539

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  226 bits (575), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 146/509 (28%), Positives = 248/509 (48%), Gaps = 25/509 (4%)

Query: 16  TDEDIEKQQLFGDDNIVIERSSQLFYDGQ---SDSKVHGITS------GHGSDVKNVVTH 66
           + E I  +   G ++  I  S +  Y GQ   S+  +H + +      G  +  + +  +
Sbjct: 16  SPESISIRSFSGGNDFQIS-SREKAYSGQPSKSEKLIHRLANSFKRAEGSITKTRQINEN 74

Query: 67  TSEFDGKHDGI----RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 122
           TS+ +   + I    +LKK++++RHV M                                
Sbjct: 75  TSDLEDGIESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYV 134

Query: 123 FVGLLVFFVMSCLGEMAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLT 180
            V  + +F++   GEMA   P     F +YS+ +     GFA  + Y F++  ++P +L 
Sbjct: 135 LVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELI 194

Query: 181 AGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXX 240
             ++ IQYW   DK+NP V+I I  + ++ I+  GV+ +GE E+  +  KI ++      
Sbjct: 195 TASMTIQYW--NDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIIL 252

Query: 241 XXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELC 300
                     +   +G  YW NPGAF    T+I     RF +   + V   F++ G EL 
Sbjct: 253 SVVINCGGAGDDGYIGGAYWHNPGAFAG-DTSI----ARFKNVCYILVTGYFSFGGMELF 307

Query: 301 GIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXX 360
            + V E  NPRK+ P A K ++YRI++ YL+++ L+G  VP+ND  L+            
Sbjct: 308 ALSVQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHAS-- 365

Query: 361 PFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQ 420
           P+V+A    G+ ++PHI+NA ILI V S ANS LY   R +  L+    AP+     +++
Sbjct: 366 PYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDRE 425

Query: 421 GVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRV 480
           G P  +L+V  +F ++A++  SS    VFT+      +  L +W SI+++++RF +A +V
Sbjct: 426 GRPLRALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKV 485

Query: 481 QGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
           QG     L Y++    +G+ +  FF IL+
Sbjct: 486 QGRSLDELGYKATTGIWGSVYGFFFNILV 514

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  225 bits (573), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 122/380 (32%), Positives = 209/380 (55%), Gaps = 9/380 (2%)

Query: 135 LGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRD 193
           LGEMA   P+ G +T+Y+TR+ D + GFA    Y+ +  +++P ++ A ++ + YW  + 
Sbjct: 140 LGEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKS 199

Query: 194 KVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHE 253
           +     ++ +  + I++IN  GV+ +GE E+  S +K+  +               P HE
Sbjct: 200 QYR-AAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHE 258

Query: 254 VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKA 313
            +G K+W NPGAF   +     A  +F    SVFV A F++  TEL G+  +E ++PRK+
Sbjct: 259 YIGSKFWSNPGAFVGDT-----AGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKS 313

Query: 314 VPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPV 373
           VPKA K   +RI +FY++S+ ++G+ VP+ DP L+            PFV+A+ N GI  
Sbjct: 314 VPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAAS--PFVLALKNHGIKG 371

Query: 374 LPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLF 433
           LP ++N  IL  V S  NS ++  SR L  L+     P +F   +++G P  S++    F
Sbjct: 372 LPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAF 431

Query: 434 ALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSP 493
            LL ++ VS    E+F + ++   +  L  W++I + +IRF KA   Q      LA+ SP
Sbjct: 432 GLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASP 491

Query: 494 LQPYGAWFSLFFCILIGLIK 513
           +  +G+++S+F  I++ +++
Sbjct: 492 IGIWGSYYSVFLIIVVLILQ 511

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  225 bits (574), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 152/520 (29%), Positives = 248/520 (47%), Gaps = 39/520 (7%)

Query: 18  EDIEKQQL-FGDDNIVIERSSQLFYDGQSDSKVHGI------------TSGH-GSDVKNV 63
            DI K    F D +++   S++  Y+  + S  H              T+ H  +D+  +
Sbjct: 15  NDITKSSAKFNDVDVIDIDSAERNYELPTSSTTHSRFRNFIDSFKPPETTHHIETDMNPI 74

Query: 64  VTHTSEFDGKHDGI---------RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXX 114
           ++H S FD     I         +LKK ++ RHV M                        
Sbjct: 75  LSHQSVFDDAKVEISQVDDELNEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGP 134

Query: 115 XXXXXXXXFVGLLVFFVMSCLGEMAA-YIPL-DGFTSYSTRYADPALGFAVGYAYLFKYW 172
                    +   ++ ++  +GEMA  Y+ L  GF +Y     DPAL F++ + Y  +++
Sbjct: 135 AGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWF 194

Query: 173 IIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITIN-FLGVRFFGEIEYYISAVKI 231
            + P +L   ++ IQYW    KVN  +++ I  + ++ IN F G R + E E+  ++ KI
Sbjct: 195 CVCPLELVTASMTIQYWTT--KVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKI 252

Query: 232 TVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKG--RFVSFASVFVL 289
            +M                N   +G KYW++PGAF+       G+ G  RF    S  V 
Sbjct: 253 LMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFR-------GSDGPNRFKGVVSTLVT 305

Query: 290 ALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIX 349
           A F++  TE   I  SE  NPRKA+P A K  +YR ++ YL SI ++G+ VP++   L+ 
Sbjct: 306 AAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLG 365

Query: 350 XXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNK 409
                      P+V+A+   G+ V+PH +NA ILI VFS A+S  Y +SR L  LA    
Sbjct: 366 SSSAATKAS--PYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGY 423

Query: 410 APRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILI 469
           AP++F   ++ G P    LVG + A++A+   SS  +EVF + +    +  + +W  I +
Sbjct: 424 APKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICL 483

Query: 470 TYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
           ++IRF +A +VQG     + Y+S +  +G+ ++    ILI
Sbjct: 484 SHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILI 523

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  225 bits (574), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 133/393 (33%), Positives = 209/393 (53%), Gaps = 10/393 (2%)

Query: 124 VGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
           +   +F V++ LGE++A  P+  GF  YS R+ +P+  FAV   YL ++ +++P +L A 
Sbjct: 131 ISTCLFTVINSLGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAA 190

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           ++ I+YW   DK+N   W+ I    I   N L V+ FGE E+ +S +KI  +        
Sbjct: 191 SITIKYW--NDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGI 248

Query: 243 XXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGI 302
                  P+   +G KYW +PGAF  +S+       +F    SVFV A F+Y G E+  +
Sbjct: 249 VLSCGGGPHGGYIGGKYWHDPGAFVGHSSGT-----QFKGLCSVFVTAAFSYSGIEMTAV 303

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPF 362
             +E KNPR+ +PKA K T + I   Y+  + L+G  VP NDP L+            P 
Sbjct: 304 SAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PL 362

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+AI N GI  LP +MNA ILI V S ANS +Y  SR +  +A     P+   + +K+G 
Sbjct: 363 VIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGR 422

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           P  ++L+ + F LL+++  S   +EVFT+      +  +  W++I +++IRF +A +VQ 
Sbjct: 423 PMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQE 482

Query: 483 IDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF 515
                L + S     G+W+  F  + + LI +F
Sbjct: 483 RSLDELPFISQTGVKGSWYG-FIVLFLVLIASF 514

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  225 bits (573), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 126/387 (32%), Positives = 213/387 (55%), Gaps = 9/387 (2%)

Query: 124 VGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
           +G +++ ++  LGE+A   P+ G FT+Y+TR+ D + GFA  + Y+ ++ + +P ++ + 
Sbjct: 130 MGTMIYAMVMALGELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSA 189

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           ++ + YW    K   G ++ +  + I+ IN  GV+ +GE E+  S +K+  +        
Sbjct: 190 SITVNYWGTDPKYRDG-FVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGI 248

Query: 243 XXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGI 302
                  P    +G KY+ +PGAF   +    GAK  F    SVFV A F++ G+EL G+
Sbjct: 249 ILNCGGGPEKGYIGGKYFHDPGAF---AGDTPGAK--FKGVCSVFVTAAFSFAGSELVGL 303

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPF 362
             SE  +PRK+VPKA K   +RI +FY++S+ ++G+ VP+ND  LI            PF
Sbjct: 304 AASESVDPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAAS--PF 361

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+AIV  GI  LP ++N  ILI V S  NS ++  SR+   LA     P+IFA  +++G 
Sbjct: 362 VIAIVTHGIKGLPSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGR 421

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           P   +++     L+A++  S+   +VF + +    +  L +W  I I +IRF KA   QG
Sbjct: 422 PLVGIIITSAVGLIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQG 481

Query: 483 IDKSTLAYQSPLQPYGAWFSLFFCILI 509
                L+++SP   +G+++ LF  +++
Sbjct: 482 RSVDELSFKSPTGVWGSYWGLFMIVIM 508

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  225 bits (574), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 149/496 (30%), Positives = 236/496 (47%), Gaps = 18/496 (3%)

Query: 79  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEM 138
           LKK ++ RHV M                                 +G +++ ++   GEM
Sbjct: 116 LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEM 175

Query: 139 A-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVN 196
           A  Y  L G + +Y +   D   GFAV + Y  ++  + P +L   ++ I+YW     VN
Sbjct: 176 ALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT--SVN 233

Query: 197 PGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLG 256
           P V++ I  V +ITIN  G R + E E++ +  KI +M                N   +G
Sbjct: 234 PDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIG 293

Query: 257 FKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPK 316
            KYW +PGAF    +       RF    +  V A FA+ G+E   I  +E  NPRKAVP 
Sbjct: 294 GKYWHDPGAFNGKHSI-----DRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPG 348

Query: 317 AIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPH 376
           A K  +YRI+  +L +I LLG  VP+N   L+            P+V+A+ + G+ V+PH
Sbjct: 349 AAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKAS--PYVIAVASHGVRVVPH 406

Query: 377 IMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALL 436
            +NA IL+ V S ANS  Y ++R L  L+    APR+F   +K G P  ++ V  LF ++
Sbjct: 407 FINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVI 466

Query: 437 AYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQP 496
           A+   S    +VFT+ +    +  L +W +I +++IRF +A +VQG     L ++S    
Sbjct: 467 AFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGV 526

Query: 497 YGAWFSLFFCILIGLIKNF---PAFLGD-TFDYKSFXXXXXXXXXXXXXXXXXKLWYK-- 550
           +G+ ++    ILI LI  F    A +G+   D ++F                 K+W K  
Sbjct: 527 WGSTYACIMMILI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDW 585

Query: 551 TKIIPSEEVDLVSFKE 566
              I ++++DL+S ++
Sbjct: 586 KLFIRADKIDLISHRQ 601

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  224 bits (572), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 128/387 (33%), Positives = 214/387 (55%), Gaps = 9/387 (2%)

Query: 124 VGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
            G +++ ++  LGE+A   P+ G FT+Y+TR+ D + G+A  + Y+ ++ +++P ++ + 
Sbjct: 131 TGTMIYSMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSA 190

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           ++ + +W    K   G ++ +  + I+ IN  GV+ +GE E+  S +K+  +        
Sbjct: 191 SITVNFWGTDPKYRDG-FVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGI 249

Query: 243 XXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGI 302
                  P    +G KYW +PGAF   +    GAK  F    SVFV + F++ G+EL G+
Sbjct: 250 ILNCGGGPEGGYIGGKYWHDPGAF---AGDTPGAK--FKGLCSVFVTSAFSFAGSELVGL 304

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPF 362
             SE  +PRK+VPKA K   +RI +FY++S+ ++G+ VP+NDP LI            PF
Sbjct: 305 AASESVDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAAS--PF 362

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+AI   GI  LP ++N  ILI V S  NS +Y  SR++  LA     P+IFA  +++G 
Sbjct: 363 VIAIKTHGIKGLPTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGR 422

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           P   + V   F L+A++  S    +VF + +    +  L +W  I I +IRF KA   QG
Sbjct: 423 PLVGIAVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQG 482

Query: 483 IDKSTLAYQSPLQPYGAWFSLFFCILI 509
            D   L+++SP   +G+++ LF  +++
Sbjct: 483 RDLDELSFKSPTGVWGSYWGLFMVVIM 509

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  223 bits (569), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 149/520 (28%), Positives = 248/520 (47%), Gaps = 15/520 (2%)

Query: 16  TDEDIEKQQLFG-DDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKH 74
           TD++I    +     N  +  +S    D  ++ K   I +    D++      S+ D   
Sbjct: 2   TDQEITTSGIVTLMSNFEMTDASLTSRDHSTNQKKDAIITAVEQDIER--GSLSDIDTIK 59

Query: 75  DGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSC 134
               + + L++RHV                                   +   V+ +M+ 
Sbjct: 60  PSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQ 119

Query: 135 LGEMAAYIPLDGFTSYST---RYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVD 191
           + EM   IPL G +S ++    Y +    F  G+   +   ++VP ++TA AL+I+YW D
Sbjct: 120 MTEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIEYWTD 179

Query: 192 RDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKI-TVMXXXXXXXXXXXXXXXP 250
               N  +++TI ++    ++ L V+ FGE E+ +S +KI T++                
Sbjct: 180 ---ANAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIFFGGGPA 236

Query: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTELCGIVVSECKN 309
            H+VLGF YW  PGAF  Y   + G+ G F++     + + FA+ +  E+     +E   
Sbjct: 237 QHKVLGFHYWNTPGAFNSY--LVKGSTGAFLAVWKAIIKSGFAFVMIPEITSSCSAEAAF 294

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXX-XXXXXXXPFVVAIVN 368
           PRK +P+A +  +YR+ VFY++   ++G+ V +++  L              PFV+ I  
Sbjct: 295 PRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASPFVIGIQE 354

Query: 369 AGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLL 428
           AGI +LPHI+NACIL   +S + S+LY ASR L+ LA+   AP+ F+K NK GVPY+S+ 
Sbjct: 355 AGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVPYYSVA 414

Query: 429 VGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTL 488
              LF +LAY+N S  S  VF +  N  +I G ++W+ + ITY+RF K      I+   +
Sbjct: 415 ATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKINDR-V 473

Query: 489 AYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
            Y+   Q   A+ S  F  L+ +   F  F+   ++   F
Sbjct: 474 PYRRRGQRALAYASAIFFALLAITNGFYVFIAGNWNVSDF 513

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  225 bits (573), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 148/531 (27%), Positives = 249/531 (46%), Gaps = 19/531 (3%)

Query: 45  SDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXX 104
           S S++    +  GS V          +   +   LKK ++ RH+ M              
Sbjct: 109 SSSQLDNELNPKGSFVTESGIKQPSQEQDQNQENLKKTIKPRHIVMMSLGTGIGTGLLVG 168

Query: 105 XXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIP--LDGFTSYSTRYADPALGFA 162
                              +G  ++ ++   GE+A      + GF +Y +   DPALGF+
Sbjct: 169 NSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVDPALGFS 228

Query: 163 VGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEI 222
           V + Y  ++  + P +L   ++ I+YW    KV+P V++ I  V II IN  G + + E 
Sbjct: 229 VAWVYCLQWLCVCPLELVTASMTIKYWTV--KVDPDVFVVIFYVLIIVINVFGAKGYAEA 286

Query: 223 EYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVS 282
           +++ +  KI ++                    +G +YW NPGAF+      TG + RF  
Sbjct: 287 DFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSRYWHNPGAFR----GNTGIQ-RFKG 341

Query: 283 FASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPF 342
             + FV A FA+  +E   +  SE  NPRKA+P A K  +YRI+  +L S+ L+G  VP+
Sbjct: 342 VVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPY 401

Query: 343 NDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLY 402
               L+            P+V+A+ + G+ V+PH +NA IL+ V S AN   Y +SR L 
Sbjct: 402 TSDQLLGASGSATKAS--PYVIAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRILM 459

Query: 403 GLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLL 462
            LA    AP+ F   +++G P  ++LV  +F ++A+   S    +VFT+ +    +  L 
Sbjct: 460 SLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQLF 519

Query: 463 SWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF-----PA 517
           +WI+I +++IRF +A +VQG     + Y+S +  +G+ +++   +L  LI  F     P 
Sbjct: 520 TWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGIWGSMYAIVMMVL-ALIAQFWVAISPI 578

Query: 518 FLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK--TKIIPSEEVDLVSFKE 566
             G     +SF                 K+W K  T  IP++++DLV+ ++
Sbjct: 579 GGGGKLSAQSFFENYLAMPILIALYVFYKVWKKDWTLFIPADKIDLVTDRQ 629

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  224 bits (570), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 144/498 (28%), Positives = 241/498 (48%), Gaps = 20/498 (4%)

Query: 78  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGE 137
           +LKK +++RHV M                                 +G  ++ ++   GE
Sbjct: 95  KLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGE 154

Query: 138 MA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKV 195
           +A  Y  L G F +Y +   DPALGF+V + Y  ++  ++P +L   ++ I+YW     V
Sbjct: 155 LAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTT--SV 212

Query: 196 NPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVL 255
           NP +++ I  V IITIN  G R + E E++ +  K+ ++                N   +
Sbjct: 213 NPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGNDGYI 272

Query: 256 GFKYWKNPGAFKEYSTAITGAK--GRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKA 313
           G KYW +PG+F       +G K    F    S  V A FA+  TE   +  +E  NPRK+
Sbjct: 273 GGKYWNDPGSF-------SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKS 325

Query: 314 VPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPV 373
           +P A K  +YRI+V Y+ SI L+G  VP N   L+            P+V+AI + G+ V
Sbjct: 326 IPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHAS--PYVIAIASHGVKV 383

Query: 374 LPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLF 433
           +PH++NA IL+ V S  NS  Y +SR L  LA    AP      +++G P  ++++  +F
Sbjct: 384 VPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSVF 443

Query: 434 ALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSP 493
            L++++  S     VFT+ +    +  L +W +I +++IRF +A +VQG     L ++S 
Sbjct: 444 GLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQ 503

Query: 494 LQPYGAWFS--LFFCILIGLIKNFPAFLGD-TFDYKSFXXXXXXXXXXXXXXXXXKLWYK 550
           +  +G++++  +   ILIG      A +G+   D ++F                 K+W +
Sbjct: 504 VGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKR 563

Query: 551 --TKIIPSEEVDLVSFKE 566
             T  IP+ ++DL+S + 
Sbjct: 564 DWTLYIPASKIDLISNRR 581

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  223 bits (569), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 148/500 (29%), Positives = 242/500 (48%), Gaps = 20/500 (4%)

Query: 12  SRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFD 71
           S + T    EK + + D   V  R+    ++   DS      + +G D+++        D
Sbjct: 19  STLKTPNVTEKFEPYPDTTAVKHRTH---FNRFVDSFKRAEVNHNGIDLEDGTNSIQSDD 75

Query: 72  GKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFV 131
                  LKKA+++RHV M                                 V  + +FV
Sbjct: 76  ------NLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFV 129

Query: 132 MSCLGEMAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
           +   GEMA   P    GF +Y++ +     GFA  + +  ++  ++P +L   ++ I+YW
Sbjct: 130 IQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW 189

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
              DK+N  V++ IL V ++ I+F GVR +GE E+  ++ KI ++               
Sbjct: 190 --NDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGA 247

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
                +G KYW++PGAF     A   A  RF   A V V A F+Y G EL  + V+E +N
Sbjct: 248 GVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQEN 302

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           PR++ P A K ++YRI++ YL+++ L+G  VP N   L+            P+V+A+   
Sbjct: 303 PRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHAS--PYVLAVSIH 360

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
           G+ V+PHI+NA ILI V S ANS LY + R L  LA    AP+ F   +++G P  +L++
Sbjct: 361 GVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALIL 420

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
             +F ++A+   S     +FT+      +  L +W SIL++++RF  A + QG   + L 
Sbjct: 421 CSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELG 480

Query: 490 YQSPLQPYGAWFSLFFCILI 509
           Y S    +G+ +  FF +L+
Sbjct: 481 YISITGIWGSLYGCFFNVLV 500

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  224 bits (570), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 132/434 (30%), Positives = 220/434 (50%), Gaps = 11/434 (2%)

Query: 78  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGE 137
            LKK++++RHV M                                 V  + +F++   GE
Sbjct: 100 HLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQAAGE 159

Query: 138 MAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKV 195
           MA   P     F SY + +     GFA  + +L ++  ++P +L   +L I+YW   DK+
Sbjct: 160 MAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYW--NDKI 217

Query: 196 NPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVL 255
           N  V++ I  V ++ I+F GV+ +GE E+  ++ KI ++                +   +
Sbjct: 218 NSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDGYI 277

Query: 256 GFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVP 315
           G KYW +PGAF  ++       GRF     + V A F+Y GTEL  + V+E +NPRK+ P
Sbjct: 278 GGKYWHDPGAFTSHTNI-----GRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKSTP 332

Query: 316 KAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLP 375
           +A K ++YRI+V YL+++ L+G  VP ++  L+            P+V+A    G+ ++P
Sbjct: 333 QAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHAS--PYVLAASIHGVRIVP 390

Query: 376 HIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFAL 435
           H +NA ILI V S ANS LY + R L  LA    AP+     ++QG P  +L    LF +
Sbjct: 391 HFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGV 450

Query: 436 LAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQ 495
           + +   S+   +VFT+      +  L +W  I+++++RF +A +VQG D + L Y++   
Sbjct: 451 IGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSG 510

Query: 496 PYGAWFSLFFCILI 509
            +G+ + +FF IL+
Sbjct: 511 VWGSVYGVFFNILV 524

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  223 bits (569), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 147/488 (30%), Positives = 237/488 (48%), Gaps = 13/488 (2%)

Query: 79  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEM 138
           LK  L++RH+ M                                  G +++ ++  + EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 139 AAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNP 197
           A   P+ G FT+Y+TR+ D + GFA  + Y+ ++ +++P ++ + ++ + YW    K   
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 198 GVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGF 257
           G ++ +  + I+ IN  GV+ +GE E+  S +K+  +               P    +G 
Sbjct: 209 G-FVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGA 267

Query: 258 KYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKA 317
           KYW +PGAF     A  GA+  F  F SVFV A F++ G+EL GI  SE +NPRKAVP A
Sbjct: 268 KYWHDPGAF---VGATAGAQ--FQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPA 322

Query: 318 IKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHI 377
            K   +RI++FY++S+  +G+ VP ND  LI            PFV+AI   GI  LP +
Sbjct: 323 AKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAAS--PFVIAITVHGIRGLPSV 380

Query: 378 MNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLA 437
           +N  ILI V S  NS +Y  SR+L  LA     P++ +  ++ G P   + +   F L+A
Sbjct: 381 INVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVA 440

Query: 438 YMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPY 497
           ++  S    +VF + +    +    +W +I + +IRF  A + Q      L + SPL  +
Sbjct: 441 FVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVF 500

Query: 498 GAWFSLFFCILIGLIKNFPAF--LGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKT-KI- 553
           G+++ LF  +L+   + + A   +GDT    +F                 KLW K  KI 
Sbjct: 501 GSYWGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKNWKIF 560

Query: 554 IPSEEVDL 561
           IP  ++DL
Sbjct: 561 IPLGQLDL 568

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  224 bits (571), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 155/542 (28%), Positives = 253/542 (46%), Gaps = 29/542 (5%)

Query: 34  ERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXX 93
           + SSQL  D + + K   IT      V  +     E + K +   LKK+++ RH  M   
Sbjct: 110 DSSSQL--DNELNRKSSYIT------VDGIKQSPQEQEQKQE--NLKKSIKPRHTVMMSL 159

Query: 94  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIP--LDGFTSYS 151
                                         +G  V+ ++   GE+A      + GF +Y 
Sbjct: 160 GTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYP 219

Query: 152 TRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITI 211
               DPALGF+V + +  ++  + P +L   ++ I+YW     VNP V++ I  V I+ I
Sbjct: 220 LFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTT--SVNPDVFVVIFYVLIVVI 277

Query: 212 NFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYST 271
           N  G + + E +++ +  KI ++                    +G KYW++PGAF+   T
Sbjct: 278 NVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRG-DT 336

Query: 272 AITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLI 331
            I     RF    + FV A FA+  +E   +  SE  NPRKA+P A K  +YRI+  +L 
Sbjct: 337 PIQ----RFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLA 392

Query: 332 SIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAAN 391
           S+ L+G  VP+    L+            P+V+A+ + G+ V+PH +NA IL+ V S AN
Sbjct: 393 SLTLVGFLVPYTSDQLLGAAGSATKAS--PYVIAVSSHGVRVVPHFINAVILLSVLSVAN 450

Query: 392 SDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTY 451
              Y +SR L  LA    AP+ F   +++G P  ++LV  LF ++A+   S    +VFT+
Sbjct: 451 GAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDVFTW 510

Query: 452 FVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGL 511
            +    +  L +WI+I +++IRF +A +VQG     + Y+S +  +G+ +++   +L  L
Sbjct: 511 LLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVL-AL 569

Query: 512 IKNF-----PAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK--TKIIPSEEVDLVSF 564
           I  F     P   G     +SF                 K+W K  +  IP+++VDLVS 
Sbjct: 570 IAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKDWSLFIPADKVDLVSH 629

Query: 565 KE 566
           + 
Sbjct: 630 RN 631

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  223 bits (568), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 139/434 (32%), Positives = 224/434 (51%), Gaps = 11/434 (2%)

Query: 78  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGE 137
            LKKA++ RHV M                                 V ++ + ++   GE
Sbjct: 90  HLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQAAGE 149

Query: 138 MA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKV 195
           MA AY  L G F +Y++ +     GFA  + +  ++  ++P +L   +L+I+YW +  KV
Sbjct: 150 MAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYWTE--KV 207

Query: 196 NPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVL 255
           N  V++ I  V ++ I+F+GV+ +GE E+  +  KI ++                +   +
Sbjct: 208 NADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHDGYI 267

Query: 256 GFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVP 315
           G KYW +PGAF     A T A  RF     V V   F+Y GTEL  + V+E +NPRK+ P
Sbjct: 268 GGKYWHSPGAF-----AGTNAAERFKGVCYVLVSGYFSYGGTELYVLSVNEQENPRKSTP 322

Query: 316 KAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLP 375
            A K ++YRI+V YL+++ L+G  VPFND  L+            P+V+A    G+ V+P
Sbjct: 323 IAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHAS--PYVLAASIHGVRVVP 380

Query: 376 HIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFAL 435
           HI+NA ILI V S ANS LY A R L  LA    AP+     +++G P ++LL   +F +
Sbjct: 381 HIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVFGV 440

Query: 436 LAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQ 495
           +A+   S    +VFT+      +  L +W SI+++++RF +A ++QG D + + Y +   
Sbjct: 441 IAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIANTG 500

Query: 496 PYGAWFSLFFCILI 509
            +G+ + + F IL+
Sbjct: 501 YWGSVYGVVFNILV 514

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  223 bits (567), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 138/472 (29%), Positives = 229/472 (48%), Gaps = 15/472 (3%)

Query: 44  QSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGI----RLKKALEARHVSMXXXXXXXXX 99
           Q  + +H   +      +  +   S+ +   D I    +LKK +++RHV M         
Sbjct: 36  QDSTMIHRFVNSFKRAEQPPLKQDSDLEEDTDTIVTDTQLKKTMKSRHVVMMSLGTGIGT 95

Query: 100 XXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIP-LDG-FTSYSTRYADP 157
                                   V  + +F++   GEMA   P L G F +Y + +   
Sbjct: 96  GLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISK 155

Query: 158 ALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVR 217
             GFA  + +  ++  ++P +L   A+ +QYW   D +N  V++ I  V ++ I+F GV+
Sbjct: 156 PFGFATVWLFFIQWLTVLPLELITAAMTVQYW--NDSINADVYVVIFYVFLLFIHFFGVK 213

Query: 218 FFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAK 277
            +GE E+  +  KI  +                N   +G KYW +PGAF   + A     
Sbjct: 214 AYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAFTSDTNA----- 268

Query: 278 GRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLG 337
           GRF     V V A F+Y G EL  + V+E +NPR++ P A K ++YRI+V YL+++ L+G
Sbjct: 269 GRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVG 328

Query: 338 MCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVA 397
             VP N   L+            P+V+A    G+ V+PHI+NA ILI + S  NS LY A
Sbjct: 329 FNVPSNSNELMGSGGSVTHAS--PYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAA 386

Query: 398 SRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVS 457
            R +  LA    AP+     +++G P ++L+V  +F ++ ++  SS   +VF +      
Sbjct: 387 PRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAG 446

Query: 458 IFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
           +  L +W  I+I++IRF +A ++Q      + Y+SP   YG++F +FF +L+
Sbjct: 447 LAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLV 498

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  223 bits (568), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 141/442 (31%), Positives = 222/442 (50%), Gaps = 11/442 (2%)

Query: 71  DGK-HDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVF 129
           DG+  DGI LKK ++ RHV M                                 V  + +
Sbjct: 86  DGESKDGIHLKKQMKTRHVVMMSLGTGIGTGLLIANAKGLHFAGPAPLVIGYGMVSFVTY 145

Query: 130 FVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQ 187
           F++   GE+A AY  L G F SY         GFA  +    ++  ++P +  A +L I+
Sbjct: 146 FMIQAAGELAVAYPTLPGNFNSYFGILISKPFGFATVWLAAVQWLTVLPLEFIAASLTIK 205

Query: 188 YWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXX 247
           YW DR  ++  V++ I  V ++ I+F+GVR +GE E+  +  K+ ++             
Sbjct: 206 YWNDR--ISGDVFVVIFYVFLLFIHFVGVRAYGETEFIFNLCKVLMIIGFIILSIVINAG 263

Query: 248 XXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSEC 307
              N   +G KYW +PGAF     A   A  RF     + V   F+Y GTEL  + V+E 
Sbjct: 264 GAGNDGYIGGKYWNDPGAF-----AGETAGSRFKGVCYILVTGYFSYGGTELFVLSVNEQ 318

Query: 308 KNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIV 367
           +NPRK+ P+A K ++YRI++ YL+++ L+G  VP+NDP L+            P+V+A  
Sbjct: 319 ENPRKSTPQAAKHSIYRIVIIYLLTMILIGFNVPYNDPRLMGADDASGSHAS-PYVLAAS 377

Query: 368 NAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSL 427
             G+ ++PH +NA +LI + S  NS LY A R +  LA    AP+I A  +++G P  SL
Sbjct: 378 IHGVKIVPHFINAVVLIALISVGNSALYAAPRMMVSLAEQGFAPKIMAYVDREGRPLVSL 437

Query: 428 LVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKST 487
            +  LF L+ +   SS   +VFT+      +  L +W +  I++IRF  A ++QG D   
Sbjct: 438 GICALFGLIGFAASSSKEEQVFTWLAAIAGLSELFTWSAFFISHIRFRWAMKLQGKDIKE 497

Query: 488 LAYQSPLQPYGAWFSLFFCILI 509
           + + +    YG+++ LFF IL+
Sbjct: 498 VGFLASTGLYGSFYGLFFNILV 519

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  223 bits (567), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 139/450 (30%), Positives = 236/450 (52%), Gaps = 13/450 (2%)

Query: 124 VGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
            G +++ ++  LGE+A   P+ G FT+Y+TR+ D + G+A  + Y+ ++ +++P ++ + 
Sbjct: 131 TGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSA 190

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           ++ + +W    K   G ++ +  +AI+ IN  GV+ +GE E+  S +K+  +        
Sbjct: 191 SITVNFWGTDPKYRDG-FVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGI 249

Query: 243 XXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGI 302
                  P    +G KYW +PGAF   +    GAK  F    SVFV A F++ G+EL G+
Sbjct: 250 ILNCGGGPTGGYIGGKYWHDPGAF---AGDTPGAK--FKGVCSVFVTAAFSFAGSELVGL 304

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPF 362
             SE   PRK+VPKA K   +RI +FY++S+ ++G+ VP+ND  LI            PF
Sbjct: 305 AASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAAS--PF 362

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+AI   GI  LP ++N  ILI V S  NS +Y  SR++  LA     P IF+  +++G 
Sbjct: 363 VIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGR 422

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           P   + V   F L+A++  S    EVF + +    +  L +W  I I +IRF KA   QG
Sbjct: 423 PLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQG 482

Query: 483 IDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAF--LGDTFDYKSFXXXXXXXXXXXX 540
                L+++SP   +G+++ LF  I++ + + + A   +GD+   + F            
Sbjct: 483 RGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMV 542

Query: 541 XXXXXKLWYKT--KIIPSEEVDLVSFKEAV 568
                K++ +     IP+E++D+ + +  V
Sbjct: 543 MYIGHKIYKRNWKLFIPAEKMDIDTGRREV 572

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  222 bits (566), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 166/589 (28%), Positives = 264/589 (44%), Gaps = 42/589 (7%)

Query: 3   EKVYLDAQLSRVDTD------------EDIEKQQLFGDDNIVIERSSQLFYD--GQSDSK 48
           +  + D  L  +DTD            E +E+  L GDD    E  S+  +    ++  +
Sbjct: 4   DAAHTDKALGELDTDIGMQELKSNTGSESVERISLPGDDYKFHEDDSKSRFRRFARTFHR 63

Query: 49  VHGITSG-HGSDVKNVVTHTSEFDG---KHDGIRLKKALEARHVSMXXXXXXXXXXXXXX 104
             G+  G  G+DV        EF     +    +LK+ +  RHV M              
Sbjct: 64  ADGLGDGASGNDV--------EFGAEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVG 115

Query: 105 XXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFA 162
                              +G  ++ ++   GE+A +Y  L G F +Y +   + A GF+
Sbjct: 116 NGKALHNGGPAGLVIGYAIMGSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFS 175

Query: 163 VGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEI 222
           V + Y  ++  ++P +L   ++ I+YW     VNP +++ I  V II +N  G R + E 
Sbjct: 176 VAWIYCLQWLCVLPLELVTASITIKYWTT--SVNPDIFVAIFYVLIILVNMFGARGYAEA 233

Query: 223 EYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVS 282
           E++ +  K+ ++                N   +G +YW NPGAF  Y T        F  
Sbjct: 234 EFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYIGGRYWNNPGAF--YGTKPIH---HFKG 288

Query: 283 FASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPF 342
             S  V A FA+  TE   +  +E  NPR+A+P A K  +YRI++ +L  I L+G  VP 
Sbjct: 289 IISTMVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPH 348

Query: 343 NDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLY 402
           N P L+            P+V+A+ + G+ V+PH +NA IL+ V S  NS  Y +SR L 
Sbjct: 349 NSPELMGSGSSATHAS--PYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLL 406

Query: 403 GLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLL 462
            LA  + AP      ++ G P  ++LV  +F L++++  S     VFT+ +    +  L 
Sbjct: 407 ALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLF 466

Query: 463 SWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFF--CILIGLIKNFPAFLG 520
           +WISI +++IRF KA  VQG     L Y+S     G++++ F   CILIG      A +G
Sbjct: 467 TWISICVSHIRFRKALIVQGKPIGELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMG 526

Query: 521 DT-FDYKSFXXXXXXXXXXXXXXXXXKLWYK--TKIIPSEEVDLVSFKE 566
               D  SF                 K+W +     IP E++DL S ++
Sbjct: 527 SAKLDANSFFENYLALPLFVVLYFGFKIWKRDWRLYIPLEQIDLDSHRK 575

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  222 bits (566), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 131/432 (30%), Positives = 213/432 (49%), Gaps = 9/432 (2%)

Query: 79  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEM 138
           LK  L+ RH+ M                                    +++ ++  LGE+
Sbjct: 95  LKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGEL 154

Query: 139 AAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNP 197
           A   P+ G FT+Y+TR+ D + GFA  + Y  ++   +P ++ + ++ + YW   ++   
Sbjct: 155 AVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRD 214

Query: 198 GVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGF 257
           G ++ +  + I+ IN  GVR FGE E+  S +K+  +               P    +G 
Sbjct: 215 G-FVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGG 273

Query: 258 KYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKA 317
           +YW NPGAF         A  +F    SVFV A F++ G+EL GI  +E  NPRK+VP+A
Sbjct: 274 RYWHNPGAFVG-----DNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRA 328

Query: 318 IKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHI 377
            K  ++RI++FY+ S+ ++G+ VP+ DP LI            PFV+AIV  GI  LP +
Sbjct: 329 AKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASAS--PFVIAIVTHGIRGLPSV 386

Query: 378 MNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLA 437
           +N  ILI V S  NS ++  SR++  L+     P IF   +++G P   ++V   F L+A
Sbjct: 387 INVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIA 446

Query: 438 YMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPY 497
           ++  S    EVF + +    +  L +W  I + +IRF  A + QG   + L + SP    
Sbjct: 447 FIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGII 506

Query: 498 GAWFSLFFCILI 509
           G+ + LF  +L+
Sbjct: 507 GSSWGLFMLLLM 518

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  222 bits (565), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 158/564 (28%), Positives = 260/564 (46%), Gaps = 25/564 (4%)

Query: 12  SRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFD 71
           S  +  E I    L   D   + R    F +  S  + +  T     D++    ++   +
Sbjct: 22  SNSNLRESISSNDLSDGDRGFVNRKLHNFCN--SFKRANSDTFDASQDLEGASINSVRSN 79

Query: 72  GKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFV 131
            K      K+++++RHV M                                 V ++ + +
Sbjct: 80  SK-----FKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIM 134

Query: 132 MSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
           M   GEMA AY  L G F  YS+ +   + GFA  + Y  ++  ++P +L   +L I+YW
Sbjct: 135 MQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTIKYW 194

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
                +NP  +I I    I+ I+F G   +GE E+  S  K++++               
Sbjct: 195 --NSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGA 252

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
                +G +YW+NPGAF   S       G F   A V V A F+Y G EL  + V+E  N
Sbjct: 253 GTGGYIGGEYWRNPGAFAGGSPI-----GHFKGIAYVLVTAYFSYGGMELFALTVNEQAN 307

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           PRKAVP A K  +YRI++ Y++++ L+G  VP+N   L+            P+V+A+ + 
Sbjct: 308 PRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHAS-PYVIAVASH 366

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
           G+ V+PHI+NA ILI V S  NS +Y A R L  LA    AP+IF+  ++ G P  +L+ 
Sbjct: 367 GVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVG 426

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
             +F LL+++  S    +VFT+      +  L +W +I ++++RF  A + QG   S L 
Sbjct: 427 CSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELG 486

Query: 490 YQSPLQPYGAWFSLFFCILIGLIKNF-----PAFLGDTFDYKSFXXXXXXXXXXXXXXXX 544
           Y+S    +G+ +++FF I++  +  F     P   G   D ++F                
Sbjct: 487 YKSKTGYWGSIYAIFFNIIV-FVAQFWVALAPIGNGGKADAEAFFQSYLAFPIWISCYVG 545

Query: 545 XKLWYKT--KIIPSEEVDLVSFKE 566
            K++ K    ++P +E+DL S + 
Sbjct: 546 YKIYSKEWKLLVPLDEIDLNSHRH 569

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  222 bits (565), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 145/451 (32%), Positives = 222/451 (49%), Gaps = 14/451 (3%)

Query: 124 VGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
           V   +F V++ LGE+AA  P+  GF  Y TR+ DP+  F+V   YL ++ +++P +L A 
Sbjct: 131 VSTALFTVINSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAA 190

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           +L I+YW   D +N   W+ I    I+  N L V+ FGE E+ +S VKI  +        
Sbjct: 191 SLTIRYW--DDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGI 248

Query: 243 XXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGI 302
                  P    +G KYW +PGAF   S     A  +F    SVFV A F+Y G E+  +
Sbjct: 249 VLTCGGGPKGGYIGGKYWHDPGAFVGDS-----AGTQFKGLCSVFVTAAFSYAGIEMIAV 303

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPF 362
             +E +NPRK +P A K T + I   Y+  + L+G  V +ND  L+            P 
Sbjct: 304 SAAESQNPRKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAAS-PL 362

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+AI N GI  LP +MNA ILI + S ANS +Y  SR +  +A+    P+  +  +K+G 
Sbjct: 363 VIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGR 422

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           P  ++   + F LL+++  S    EVFT+      +  +  W+ I I +IRF +A  VQ 
Sbjct: 423 PLRAIFTTLFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQN 482

Query: 483 IDKSTLAYQSPLQPYGAWFS---LFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXX 539
                + Y S    YG+++    LF  ++     +     GD  D ++F           
Sbjct: 483 RSLDEMPYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILI 542

Query: 540 XXXXXXKLWYKTKII--PSEEVDLVSFKEAV 568
                 KL++K   I  P EE+DL++ ++ V
Sbjct: 543 ACYIGHKLYFKNWRIMTPLEEIDLLTGRKEV 573

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  221 bits (562), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 212/386 (54%), Gaps = 9/386 (2%)

Query: 125 GLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGA 183
           G +++ ++  LGE+A   P+ G FT+Y+TR+ D + G+A  + Y+ ++ +++P ++ + +
Sbjct: 132 GTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSAS 191

Query: 184 LVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXX 243
           + + +W    K   G ++ +  V I+ IN  GV+ +GE E+  S +K+  +         
Sbjct: 192 ITVNFWGTDPKYRDG-FVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGII 250

Query: 244 XXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIV 303
                 P    +G KYW +PGAF   +    GAK  F    SVFV + F++ G+EL G+ 
Sbjct: 251 LNCGGGPEGGYIGGKYWHDPGAF---AGDTPGAK--FKGVCSVFVTSAFSFAGSELVGLA 305

Query: 304 VSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFV 363
            SE   PRK+VPKA K   +RI +FY++S+ ++G+ VP+ND  LI            PFV
Sbjct: 306 ASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAAS--PFV 363

Query: 364 VAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVP 423
           +AI   GI  LP ++N  ILI V S  NS +Y  SR++  LA     P+IFA  +++G P
Sbjct: 364 IAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRP 423

Query: 424 YWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGI 483
              + V   F L+A++  S    +VF + +    +  L +W  I I +IRF KA   QG 
Sbjct: 424 LVGIGVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGR 483

Query: 484 DKSTLAYQSPLQPYGAWFSLFFCILI 509
           D   L+++SP   +G+++ LF  +++
Sbjct: 484 DLDELSFKSPTGVWGSYWGLFMVVIM 509

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  223 bits (568), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 155/542 (28%), Positives = 254/542 (46%), Gaps = 29/542 (5%)

Query: 34  ERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXX 93
           + SSQL  D + + K   IT      V  +     E + K +   LKK+++ RH  M   
Sbjct: 110 DSSSQL--DNELNRKSSYIT------VDGIKQAPQEQEQKQE--NLKKSIKPRHTVMMSL 159

Query: 94  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIP--LDGFTSYS 151
                                         +G  V+ ++   GE+A      + GF +Y 
Sbjct: 160 GTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYP 219

Query: 152 TRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITI 211
               DPALGF+V + +  ++  + P +L   ++ I+YW    KV+P V++ I  V II I
Sbjct: 220 LFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTV--KVDPDVFVVIFYVLIIVI 277

Query: 212 NFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYST 271
           N  G + + E +++ +  KI ++                    +G KYW++PGAF+   T
Sbjct: 278 NVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRG-DT 336

Query: 272 AITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLI 331
            I     RF    + FV A FA+  +E   +  SE  NPRKA+P A K  +YRI+  +L 
Sbjct: 337 PIQ----RFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLA 392

Query: 332 SIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAAN 391
           S+ L+G  VP+    L+            P+V+A+ + G+ V+PH +NA IL+ V S AN
Sbjct: 393 SLTLVGFLVPYTSDQLLGAAGSATKAS--PYVIAVSSHGVRVVPHFINAVILLSVLSVAN 450

Query: 392 SDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTY 451
           S  Y +SR L  LA    AP+ F   +++G P  ++LV  LF ++A+   S    +VFT+
Sbjct: 451 SAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVIAFCASSKKEEDVFTW 510

Query: 452 FVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGL 511
            +    +  L +WI+I +++IRF +A +VQG     + Y+S +  +G+ +++   +++ L
Sbjct: 511 LLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLM-MMLAL 569

Query: 512 IKNF-----PAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK--TKIIPSEEVDLVSF 564
           I  F     P   G     +SF                 K+W    +  IP+ +VDLVS 
Sbjct: 570 IAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYIFFKVWKNDWSLFIPANKVDLVSH 629

Query: 565 KE 566
           + 
Sbjct: 630 RN 631

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  222 bits (565), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 146/465 (31%), Positives = 228/465 (49%), Gaps = 18/465 (3%)

Query: 56  HGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXX 115
           H S     V   S  D + +  +LKK ++ RHV M                         
Sbjct: 77  HESVFDTAVVEISAVDNQINE-KLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPA 135

Query: 116 XXXXXXXFVGLLVFFVMSCLGEMAA-YIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWI 173
                   +   ++ VM  +GEMA  Y+ L  GF++Y     DP L FAV + Y  +++ 
Sbjct: 136 GLIIGYAIMSTCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFC 195

Query: 174 IVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITIN-FLGVRFFGEIEYYISAVKIT 232
           + P +L   ++ IQYW    KVN  +++ I  + +I IN F G R + E E++ +  KI 
Sbjct: 196 VCPLELVTASMTIQYWTT--KVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKIL 253

Query: 233 VMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKG--RFVSFASVFVLA 290
           +M                N   +G +YW +PGAF+       G  G  RF    S  V A
Sbjct: 254 MMTGFFILGIILICGGAGNSGFIGARYWHSPGAFR-------GDNGINRFKGIVSTLVTA 306

Query: 291 LFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXX 350
            FA+ GTE   I  SE  NPRKA+P A K  +YR ++ Y+ SI ++G  VP+N   L+  
Sbjct: 307 AFAFGGTEFLAITASEQANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGS 366

Query: 351 XXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKA 410
                     P+V+A+ + GI V+PH +NA ILI VFS A+S  Y +SR L  LA    A
Sbjct: 367 SGPATKAS--PYVIAVASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFA 424

Query: 411 PRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILIT 470
           P+IF   +K+G P    +VG + A++++   SS  ++VF + ++   +  + +W  I ++
Sbjct: 425 PKIFTYVDKRGRPTLGFVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLS 484

Query: 471 YIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF 515
           +IRF +A +VQG     + ++S    +G+ ++    IL+ LI  F
Sbjct: 485 HIRFRRAMKVQGRSLDEIGFKSQAGVWGSVYAFVMMILV-LIGQF 528

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  221 bits (563), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 146/500 (29%), Positives = 238/500 (47%), Gaps = 18/500 (3%)

Query: 34  ERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXX 93
           E+ S L      DSKV        +D  +V++H  + +     + L K L  RH+     
Sbjct: 34  EKDSTLSPLASLDSKVPHEKIQTTTDFASVISHEDDINN----VNLNKNLSIRHLLTLAV 89

Query: 94  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYST 152
                                         +   +F V++ LGEMAA  P+  GF  Y T
Sbjct: 90  GGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGEMAAAFPVVGGFNVYIT 149

Query: 153 RYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITIN 212
           R+ DP++GFAV   YL ++ +++P +L A ++ I+YW   + +N   W+ I    I   N
Sbjct: 150 RFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYW--NETINSDAWVAIFYCVIALAN 207

Query: 213 FLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTA 272
            L V+ FGE E+ +S +KI  +               P+   +G KYW +PG+F  +++ 
Sbjct: 208 MLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPGSFVGHNSG 267

Query: 273 ITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLIS 332
                 +F    SVFV A F+Y G E+  +  +E K+PR  +PKA K T + I   Y+  
Sbjct: 268 T-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAAKRTFWLITASYVTI 322

Query: 333 IFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANS 392
           + L+G  VP++DP L+            P V+AI N GI  LP +MNA ILI + S ANS
Sbjct: 323 LTLIGCLVPYDDPRLLSGTSSVDAASS-PLVIAIENDGIKGLPSLMNAIILISIISVANS 381

Query: 393 DLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYF 452
            +Y  SR +  +A     PRI  + + +G P  +++  + F LL+++  S   ++VFT+ 
Sbjct: 382 AVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWL 441

Query: 453 VNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLI 512
                +  +  W++I +++IRF ++   Q      L + S    +G+W+      L+ L+
Sbjct: 442 SALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLV-LV 500

Query: 513 KNFPAFL----GDTFDYKSF 528
            +F   L    G + D +SF
Sbjct: 501 ASFWTSLFPLGGTSADAESF 520

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  221 bits (563), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 164/547 (29%), Positives = 254/547 (46%), Gaps = 33/547 (6%)

Query: 43  GQSDSKVHGITSG---------HGSDVKNVVTHTSEFDGKHDGIR--LKKALEARHVSMX 91
           G+S S+VH  TS            S +++ +  TS+     + I   L K L  RH+   
Sbjct: 31  GRSSSQVHSFTSNTPSPFNEKSKDSPIEDNIDITSQSSVTKEDINKSLNKDLSIRHLLTL 90

Query: 92  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSY 150
                                           +   +F V++ LGE+AA  P+  GF  Y
Sbjct: 91  AVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSLGELAAAFPVVGGFNVY 150

Query: 151 STRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIIT 210
            TR+ DP+  FAV   YL ++ +++P +L A ++ I+YW     +N   W+ I    I  
Sbjct: 151 ITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--NSTINSDAWVAIFYTVITL 208

Query: 211 INFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYS 270
            N L V+ FGE E+ +S VKI  +               P    LG KYW NPGAF  ++
Sbjct: 209 ANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAFVGHT 268

Query: 271 TAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYL 330
           +       +F    SVFV A F+Y G E+  +  +E K+PRK +PKA K T + I   Y+
Sbjct: 269 SGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYV 323

Query: 331 ISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAA 390
             + L+G  VP++DP L+            P V+AI N GI  L  +MNA ILI + S A
Sbjct: 324 TILTLVGCLVPYDDPRLMSGTSSVDAAAS-PLVIAIENGGIKGLDSLMNAIILISIISVA 382

Query: 391 NSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFT 450
           NS +Y  SR +  +A     P+   K +K+G P  + LV + F LL+++  S   +EVFT
Sbjct: 383 NSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFT 442

Query: 451 YFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIG 510
           +      +  +  W++I I++IRF +A   Q      + Y   L   G W SL+  +++ 
Sbjct: 443 WLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPY---LSQTGVWGSLYGVVVLF 499

Query: 511 LIKN-------FPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK--TKIIPSEEVDL 561
           L+         FP   GD+ D +SF                 KL++K  + ++  EE+DL
Sbjct: 500 LVLVASFWTSLFP-LGGDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWSWVVTLEEMDL 558

Query: 562 VSFKEAV 568
            + ++A+
Sbjct: 559 DTGRKAL 565

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  220 bits (561), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 134/436 (30%), Positives = 212/436 (48%), Gaps = 14/436 (3%)

Query: 79  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEM 138
           LKK ++ RHV M                                 +G +++ ++   GE+
Sbjct: 116 LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEL 175

Query: 139 A-AYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVN 196
           A  Y  L  G+ +Y +   D   GFAV + Y  ++  + P +L   ++ I+YW     VN
Sbjct: 176 ALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT--SVN 233

Query: 197 PGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLG 256
           P V++ I  V +ITIN  G R + E E++ +  KI +M                N   +G
Sbjct: 234 PDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIG 293

Query: 257 FKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPK 316
            KYW +PGAF    +       RF    +  V A FA+ G+E   I  +E  NPRKA+P 
Sbjct: 294 GKYWHDPGAFNGKHSI-----DRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPG 348

Query: 317 AIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPH 376
           A K  +YRI+  +L +I +LG  VP+N   L+            P+V+AI + G+ V+PH
Sbjct: 349 AAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKAS--PYVIAIASHGVRVVPH 406

Query: 377 IMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALL 436
            +NA IL+ V S ANS  Y ++R    L+    AP+ F+  ++ G P  ++ V  LFA++
Sbjct: 407 FVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVI 466

Query: 437 AYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQP 496
           A+   S    +VFT+ +    +  L +W +I  ++IRF +A +VQG     L ++S    
Sbjct: 467 AFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQT-- 524

Query: 497 YGAWFSLFFCILIGLI 512
            G W S++ CI++ LI
Sbjct: 525 -GVWGSMYACIMMLLI 539

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  219 bits (559), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 134/437 (30%), Positives = 216/437 (49%), Gaps = 11/437 (2%)

Query: 75  DGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSC 134
           D   +KKA+++RHV M                                 V  + +F++  
Sbjct: 74  DDDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQA 133

Query: 135 LGEMAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192
            GEMA   P     F +Y++ +     GFA  + +  ++  ++P +L   ++ I+YW   
Sbjct: 134 AGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW--N 191

Query: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNH 252
           D +NP V+I I  V ++ I+F GV+ +GE E+  ++ KI ++                  
Sbjct: 192 DTINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRD 251

Query: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRK 312
             +G KYW NPGAF   S A      RF   A + V   F+Y GTEL  + V+E KNPRK
Sbjct: 252 GYIGNKYWINPGAFASESPA-----ARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRK 306

Query: 313 AVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIP 372
           + P A K ++YRI++ YL+++ L+G  VP +   L+            P+V+A    G+ 
Sbjct: 307 STPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHAS--PYVLAASLHGVK 364

Query: 373 VLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVL 432
           V+PH +NA ILI V S ANS LY + R +  LA    AP+ F   +++G P  +L +  L
Sbjct: 365 VVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGL 424

Query: 433 FALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQS 492
           F ++ ++  S    + FT+      +  L +W SI I++IRF  A +VQG     L Y++
Sbjct: 425 FGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRA 484

Query: 493 PLQPYGAWFSLFFCILI 509
               +G+ +S+FF +L+
Sbjct: 485 TTGIWGSVYSVFFNMLV 501

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  219 bits (559), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 138/439 (31%), Positives = 219/439 (49%), Gaps = 18/439 (4%)

Query: 79  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEM 138
           LK+ L+ RH+ M                                  G +V+ V+  LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 139 AAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNP 197
           A  +P+ G + SY +R+ +P+ GFA+ Y YL    I +P +L A ++ + YW D D    
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYW-DVDSKYA 207

Query: 198 GVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHE-VLG 256
             ++ +  + I+ IN  GV+ +GE E+  S +K+T +               P+ E  +G
Sbjct: 208 DAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIG 267

Query: 257 FKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPK 316
            +YW NPG F        G KG    FA++FV + F++ G+E+  +  +E +NPRK +P+
Sbjct: 268 ARYWYNPGGFAH------GFKG----FAAIFVTSAFSFAGSEMFALAAAETENPRKDLPR 317

Query: 317 AIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPH 376
           A K   +RI +FY+IS+ L+G  VP+ D  L             PFV+AI  AGI  LP 
Sbjct: 318 AAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASAS--PFVIAIARAGIKGLPS 375

Query: 377 IMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALL 436
           ++N  ILI V S  N  +Y ASR++  LA     PR F   +++G P   +L+  +F LL
Sbjct: 376 VVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLL 435

Query: 437 AYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQP 496
           ++++ SS   EVF + +    +     W SI + ++RF +A  VQG     L+Y++    
Sbjct: 436 SFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQT-- 493

Query: 497 YGAWFSLFFCILIGLIKNF 515
            G W SL+   LI ++  F
Sbjct: 494 -GIWGSLYGIGLIFIVLCF 511

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  219 bits (559), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 122/384 (31%), Positives = 209/384 (54%), Gaps = 9/384 (2%)

Query: 127 LVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALV 185
           +++ ++  LGE+A   P+  GFT+Y+TR+ D + G+A  + Y  ++ +++P ++ + ++ 
Sbjct: 151 MIYSMVMALGELAVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASIT 210

Query: 186 IQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXX 245
           + YW    +   G ++ +  + I+ IN  GV+ FGE E+  S +K+T +           
Sbjct: 211 VNYWGTPTRYRDG-FVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLV 269

Query: 246 XXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVS 305
               P    +G KYW +PGAF  +     G+  +F    SVFV A F++ G+EL GI  +
Sbjct: 270 CGGGPKGGFVGAKYWHDPGAFVGH-----GSGAQFKGVCSVFVTAAFSFAGSELIGITAA 324

Query: 306 ECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVA 365
           E  NPRK++P A K  ++RI++FY+ ++ ++G+ VP+ND  LI            PFV+A
Sbjct: 325 EAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAAS--PFVIA 382

Query: 366 IVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYW 425
           IV  GI  LP ++N  ILI V S  NS ++  SR++  L+     P++F   ++ G P  
Sbjct: 383 IVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLV 442

Query: 426 SLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDK 485
            + +   F LLA++  S    EVF + +    +  L +W  I + +IRF  A + QG D 
Sbjct: 443 GIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDT 502

Query: 486 STLAYQSPLQPYGAWFSLFFCILI 509
           + L + SP    G+++ LF  +L+
Sbjct: 503 NELTFVSPAGVAGSYWGLFMIVLM 526

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  220 bits (561), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 130/392 (33%), Positives = 207/392 (52%), Gaps = 18/392 (4%)

Query: 124 VGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
           +G  ++ ++   GEMA AY  L G F +Y +   D A GF+V + Y  ++  ++P +L  
Sbjct: 176 MGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVT 235

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
            ++ IQYW     VN  V++ I  V II IN  G + + E E++ ++ K+ +M       
Sbjct: 236 ASMTIQYWTT--TVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILA 293

Query: 242 XXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKG--RFVSFASVFVLALFAYLGTEL 299
                    N   +G KYW NPGAF+       G K   RF    S F  A FA+  +E 
Sbjct: 294 IVINTGGAGNDGYIGAKYWHNPGAFR-------GDKSIDRFKDVMSTFTTAAFAFGASEF 346

Query: 300 CGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXX 359
             I  SE  NPR+A+P A K  +YRI+  +L SI L+G  VP+N   L+           
Sbjct: 347 IAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKAS- 405

Query: 360 XPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNK 419
            P+V+A+ + G+ V+PH +NA IL+ V S ANS  Y + R LY L+    AP  F   ++
Sbjct: 406 -PYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDR 464

Query: 420 QGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFR 479
           +G P  ++++  LF+++A+   SS   +VFT+ +    +  L +WI+I +++IRF +A +
Sbjct: 465 EGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMK 524

Query: 480 VQGIDKSTLAYQSPLQPYGAWFSLFFCILIGL 511
           VQG     + ++S +   G W S +  I++ L
Sbjct: 525 VQGRSVDEIGFKSQV---GVWGSSYAAIMMTL 553

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  219 bits (557), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 135/435 (31%), Positives = 219/435 (50%), Gaps = 12/435 (2%)

Query: 79  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEM 138
           LK+ L+ RH+ M                                  G +++ ++  +GE+
Sbjct: 77  LKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGEL 136

Query: 139 AAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNP 197
           A   P+ G FT+Y+TR+ D + G+A  + Y+ ++ +++P ++ A ++ + YW    K   
Sbjct: 137 AVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 196

Query: 198 GVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGF 257
           G ++ +  V I++IN  GV+ +GE E+  S +K+  +               P    +G 
Sbjct: 197 G-FVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGG 255

Query: 258 KYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKA 317
             W NPGAF   +     A  RF    SVFV A F++ G+EL G+  +E  NPRK++P+A
Sbjct: 256 ANWHNPGAFVGNT-----AGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPRA 310

Query: 318 IKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHI 377
            K   +RI +FY+IS+ L+G+ VP+ND  LI            PFV+AI N GI  LP +
Sbjct: 311 AKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAAS--PFVLAIKNHGIKGLPSV 368

Query: 378 MNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLA 437
           +N  ILI V S  NS ++  SR+L  LA     P+IF   +++G P   +     F LL+
Sbjct: 369 VNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLS 428

Query: 438 YMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPY 497
           ++  S    EVF + +    +  L +W++I I ++RF +A   QG     L++ SP    
Sbjct: 429 FIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPA--- 485

Query: 498 GAWFSLFFCILIGLI 512
           G W S++  +LI LI
Sbjct: 486 GVWGSIYGTVLIMLI 500

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  218 bits (556), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 139/451 (30%), Positives = 224/451 (49%), Gaps = 22/451 (4%)

Query: 126 LLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
           +L   + +C     +Y  L G + SY +   D    FAV + Y  ++ I++P +L   ++
Sbjct: 124 MLYCVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSM 183

Query: 185 VIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXX 244
            I+YW   D +NP V++ I    I+ I+F G + + E E+  ++ K+ +M          
Sbjct: 184 TIKYW--NDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISV 241

Query: 245 XXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKG--RFVSFASVFVLALFAYLGTELCGI 302
                 +  + G KYW  PGAF        G K    F    SV+V + FAY G+E   +
Sbjct: 242 NCGASKSGYI-GGKYWHTPGAF-------VGEKAIDHFKGICSVWVQSAFAYGGSEFIAL 293

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPF 362
             +E  NPRK+VPKA K  +YR+++ +L  I L+G  VP++ PLL+            PF
Sbjct: 294 TAAEQTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHAS-PF 352

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+A  + G+ V+PHI+NA ILI V S  NS  Y A R L  LA     P++F   +++G 
Sbjct: 353 VIAAASHGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGR 412

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           P  ++L   +F L++++  S     VFT+    VS+  L +W +I +++IRF  A + QG
Sbjct: 413 PLVTMLFVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQG 472

Query: 483 IDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF-----PAFLGDTFDYKSFXXXXXXXXX 537
                L Y++    +G+W+++ F I++ L   F     P   G   D  +F         
Sbjct: 473 RSLGELGYKANTGYWGSWYAIAFNIIV-LAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPV 531

Query: 538 XXXXXXXXKLWYK--TKIIPSEEVDLVSFKE 566
                   KLWY+     IP+++VDL S ++
Sbjct: 532 LVFFYFGYKLWYRDWKLFIPADKVDLESHRK 562

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  219 bits (558), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 140/460 (30%), Positives = 224/460 (48%), Gaps = 16/460 (3%)

Query: 60  VKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 119
           + + ++ T++         LKK ++ RHV M                             
Sbjct: 101 ISSSISETNKGHQNEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVI 160

Query: 120 XXXFVGLLVFFVMSCLGEMAA-YIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPN 177
               +G  ++ ++   GE+A  Y  L+G F +Y +   DPALGF+V + Y  ++  + P 
Sbjct: 161 GYAIMGTCLYCIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPL 220

Query: 178 QLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXX 237
           +L   ++ I+YW    KV+P V++ I  V II IN  G R + E E++ +  K+ +M   
Sbjct: 221 ELVTASMTIKYWTT--KVDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGF 278

Query: 238 XXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKG--RFVSFASVFVLALFAYL 295
                        N   LG KYW +PGAF        G K   RF      FV A FA+ 
Sbjct: 279 FILGIIITAGGAGNDGYLGAKYWHDPGAF-------NGDKSIDRFKGVMDTFVTAAFAFG 331

Query: 296 GTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXX 355
            TE   +  +E  NPRKA+P A K  +YRI+  +L SI L+G  VP+N   L+       
Sbjct: 332 ATEFIALTAAEQSNPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGI 391

Query: 356 XXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFA 415
                P+V+A+ + G+ V+PH +NA IL+ V S  NS  Y +SR L  LA    AP+ F 
Sbjct: 392 KAS--PYVIAVSSHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFD 449

Query: 416 KTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFD 475
             +++G P+ ++L+  LF ++A+   S   +EVF++ +    +  L +WI+I +++IRF 
Sbjct: 450 YVDREGRPFRAMLMSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFR 509

Query: 476 KAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF 515
           +A +VQG     + Y S    YG+ ++    + + LI  F
Sbjct: 510 RAMQVQGRSLGEVGYLSQSGVYGSAYAAIM-LFLALIAQF 548

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  218 bits (554), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 139/415 (33%), Positives = 221/415 (53%), Gaps = 20/415 (4%)

Query: 124 VGLLVFFVMSCLGEMAAYIPLDG---FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLT 180
           +   V+ +++ L EM A IPL G     S +  Y    L F  G+   +   +I P+++T
Sbjct: 96  MSFFVWTIVNQLTEMVALIPLPGEASMYSLARMYVGRPLAFMCGWNLFYAMAMIAPSEIT 155

Query: 181 AGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXX 240
           A A++IQYW D    N  ++I+I +V  + I  L VR FGE E+ +S++K+  +      
Sbjct: 156 ACAMLIQYWTD---ANSAIFISIFIVFSVAITMLPVRVFGESEFCVSSIKLLTIVGLIIV 212

Query: 241 XXXXXXXXXPNHE-VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY-LGTE 298
                    P+ + +LGF YWK PGAFKE+   + G+ G+F++  +  + + F++ L  E
Sbjct: 213 GIVIFFGGGPSQDHILGFHYWKKPGAFKEH--LVPGSTGKFLAVWTAIIKSGFSFVLVPE 270

Query: 299 LCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDP-LLIXXXXXXXXX 357
                 +E  +PR+ +P+A +  +YR+ +FY+  + ++ + V  +D  LL          
Sbjct: 271 TVASCSAESASPRRNMPRACQRFVYRLALFYVAGVLVVTVVVGSDDANLLNAIHSGASNA 330

Query: 358 XXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKT 417
              P+V+ I  AGI VLPHI+NACIL   +S   ++LY  SR L+ +A+   AP+IFAK 
Sbjct: 331 AASPYVIGIKEAGIKVLPHIINACILTSAYSCGTAELYGCSRILHSMAMKGDAPQIFAKV 390

Query: 418 NKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKA 477
           N+ GVPY+S  V  LF LLAY+N S  SS VF +  N  +I G +SW+ + +TY RF   
Sbjct: 391 NRFGVPYYSTAVACLFTLLAYLNCSKSSSLVFNWLSNIATISGFISWVFVSVTYTRFRTV 450

Query: 478 FRVQGIDKSTLAYQSP----LQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
                IDK  L  + P     Q   A+  + F +L+ L   +  F+   ++   F
Sbjct: 451 -----IDKLDLNDRIPFRRRFQKGFAYACIAFFVLLSLTNGYAVFIKGNWNTSDF 500

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  219 bits (559), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 151/506 (29%), Positives = 241/506 (47%), Gaps = 19/506 (3%)

Query: 69  EFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLV 128
           + + K D   LKK ++ RHV M                                 +G  +
Sbjct: 141 KIENKSD--ELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCL 198

Query: 129 FFVMSCLGEMA-AYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVI 186
           + ++  +GEMA AY  L  GF +Y +   DPA GF+V + Y  ++  + P +L   ++ I
Sbjct: 199 YCIIQAVGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTI 258

Query: 187 QYWVDRDKVNPGVWITILLVAIITINFLG-VRFFGEIEYYISAVKITVMXXXXXXXXXXX 245
           +YW    KV+P V++ I  V I+ IN +G    + E E+  ++ KI +M           
Sbjct: 259 KYWTT--KVDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIII 316

Query: 246 XXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVS 305
                N   +G KYW  PGAF+        A  RF    +  V A FA+  +E  G+  S
Sbjct: 317 CGGAGNDGYIGGKYWHEPGAFRGEH-----AIDRFKGVMATLVNAAFAFGMSEFIGVTAS 371

Query: 306 ECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVA 365
           E  NPRKA+P A K  +YRI+  +L SI ++G  VP++   L+            P+V+A
Sbjct: 372 EQSNPRKAIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKAS--PYVLA 429

Query: 366 IVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYW 425
           +   G+ V+PH +NA ILI V S ANS  Y +SR L  LA    AP+IF   +++G P  
Sbjct: 430 VSTHGVKVVPHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLV 489

Query: 426 SLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDK 485
            + +  LF ++A+   S    EVF + +    +  L +WI+I ++++RF +A  VQG   
Sbjct: 490 GMAMASLFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSI 549

Query: 486 STLAYQSPLQPYGAWFS--LFFCILIGLIKNFPAFLGD-TFDYKSFXXXXXXXXXXXXXX 542
             L ++S +  +G+ ++  +  CILI       A +G+   D K+F              
Sbjct: 550 GELGFRSQVGAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALY 609

Query: 543 XXXKLWYK--TKIIPSEEVDLVSFKE 566
              K++ K  T  I ++++DLVS + 
Sbjct: 610 FGYKIYTKNWTIFIRAKDIDLVSHRN 635

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  218 bits (555), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 151/515 (29%), Positives = 240/515 (46%), Gaps = 26/515 (5%)

Query: 6   YLDAQLSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDS---KVHGITSGHGSDVKN 62
           Y +   S  D D  I   Q    +  +  R +  +Y    DS     HG  +   +D+++
Sbjct: 24  YANNLASTNDDDISIASSQ----NRSLSHRKNTSYYRNFIDSFKRAEHGNLNEKSADLED 79

Query: 63  VVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 122
               T+    K     +KK+L+ARHV M                                
Sbjct: 80  ---GTASIQSKS---YMKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYV 133

Query: 123 FVGLLVFFVMSCLGEMAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLT 180
            V  +V+F++   GEMA   P     F +Y + +   + GFA  + +  ++  ++P +L 
Sbjct: 134 IVSFIVYFMIQAAGEMAVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELI 193

Query: 181 AGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXX 240
             +L IQYW D   +N  +++ I  V ++ I+F+GV+ +GE E+  +  KI ++      
Sbjct: 194 TSSLTIQYWTD---LNGDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIF 250

Query: 241 XXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELC 300
                     N   +G KYW  PG+F E      G   RF     V V   F+Y GTEL 
Sbjct: 251 SIVVNCGGAGNDGYIGGKYWHTPGSFAE-----GGPTSRFKGICYVLVAGYFSYGGTELY 305

Query: 301 GIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXX 360
            + V+E   PRKA P A K ++YRI+V YL+++ L+G  VP N   L+            
Sbjct: 306 VLSVNEQAEPRKATPAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHAS-- 363

Query: 361 PFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQ 420
           P+V+A    G+ V+PHI+NA ILI V S ANS LY + R L  LA    AP+     +++
Sbjct: 364 PYVLAASIHGVKVVPHIINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDRE 423

Query: 421 GVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRV 480
           G P  +LL+  +F  +A++  S    +VFT+      +  + +W  I+ +++RF  A +V
Sbjct: 424 GRPLVALLLCAVFGCIAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKV 483

Query: 481 QGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF 515
           Q  D   + Y++    YG+WF   F +L+ LI  F
Sbjct: 484 QNKDIDEVGYKATAGIYGSWFGSIFGVLV-LIAQF 517

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  217 bits (553), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 144/455 (31%), Positives = 228/455 (50%), Gaps = 22/455 (4%)

Query: 124 VGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
           +   +F +++ LGE+++  P+  GF  Y +R+ +P+ GFAV   YL ++ +++P +L A 
Sbjct: 115 ISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAA 174

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           +L I+YW     +N   W+ I    I   N L V+ FGE E+ +S VKI  +        
Sbjct: 175 SLTIRYW--NSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGI 232

Query: 243 XXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGI 302
                  P    +G KYW NPGAF   +++      RF    SVFV A F+Y GTEL  +
Sbjct: 233 VLTCGGGPEGGYIGGKYWSNPGAFVGNTSS-----QRFHGLCSVFVTAAFSYSGTELIAV 287

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPF 362
             +E  NPR  +PKA K T + I V Y++ + L+G  VP +DP L+            P 
Sbjct: 288 SAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAAS-PL 346

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+AI N GI  LP +MNA ILI V S ANS +Y  SR +  +A     P+ F+  +++G 
Sbjct: 347 VIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGR 406

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           P +++L  ++F LL+++  S+    VFT+      +  L  W +I +++IRF    + +G
Sbjct: 407 PLYAILATLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRG 466

Query: 483 IDKSTLAYQSPLQPYGAWFSLFFCILIGLI-------KNFPAFLGDTFDYKSFXXXXXXX 535
                L + S     G W S + C++I ++         FP+  G     +SF       
Sbjct: 467 RSLDELPFVSMT---GVWGSYYGCVIIFVVLVVCFWTALFPSTEG-VASAESFFETYLSF 522

Query: 536 XXXXXXXXXXKLWYKT--KIIPSEEVDLVSFKEAV 568
                     KL+ K+   + P+ E+D+ S + AV
Sbjct: 523 PILLVCYIGHKLYTKSWRLLTPTTEIDIDSGRRAV 557

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  217 bits (553), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 140/449 (31%), Positives = 221/449 (49%), Gaps = 18/449 (4%)

Query: 126 LLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
           +L   V +C     AY  L G + +Y T   D   GFAV   Y  ++  ++P +L   ++
Sbjct: 116 MLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASM 175

Query: 185 VIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXX 244
            ++YW     VNP V++ I  V ++ I+F G R + E E+  +++K+ +M          
Sbjct: 176 TVKYWTS--SVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISL 233

Query: 245 XXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVV 304
                     +G +YW +PGAF         A  RF    SV+V A FAY G+E   +  
Sbjct: 234 TAGAS-EQGYIGGQYWHDPGAFGG-----DRAIDRFKGICSVWVQAAFAYGGSEFIALTA 287

Query: 305 SECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVV 364
           +E  NPR++VPKA K  +YR++V +L+ + L+G  VP N   L+            PFV+
Sbjct: 288 AEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRAS-PFVI 346

Query: 365 AIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPY 424
           A    G+ V+PHI+N  IL  V S  NS +Y A R L  LA     P+IF   ++QG P 
Sbjct: 347 AAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPL 406

Query: 425 WSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGID 484
            +L+   LF L+A++  S+    VFT+      +  L +W +I ++++RF +A RVQG  
Sbjct: 407 VTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRS 466

Query: 485 KSTLAYQSPLQPYGAWFSLFFCILIGLIKNF-----PAFLGDTFDYKSFXXXXXXXXXXX 539
              L Y++     G+++++FF +++ LI  F     P       D + F           
Sbjct: 467 LGELGYRANTGALGSYYAIFFNVIV-LIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLV 525

Query: 540 XXXXXXKLWYK--TKIIPSEEVDLVSFKE 566
                 KLW +    +IPS EVDL+S ++
Sbjct: 526 VFYLGYKLWKRDFRLVIPSSEVDLLSHRQ 554

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  217 bits (553), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 164/530 (30%), Positives = 249/530 (46%), Gaps = 31/530 (5%)

Query: 51  GITSGH----GSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXX 106
           GI S H    G D + +    S    KH    LK+ ++ RHV M                
Sbjct: 60  GIHSTHERVSGEDFERLAPDDSS---KHK--TLKQNIKPRHVLMISLATGIGTGMLVGNG 114

Query: 107 XXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAA-YIPLDG-FTSYSTRYADPALGFAVG 164
                            V  +++ V+    E+A  Y  L G F +Y     D A  F+V 
Sbjct: 115 KSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVS 174

Query: 165 YAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEY 224
           + Y  ++  I+P +L   ++ I+YW   D +NP  ++ I  V +I INF+G   + E E+
Sbjct: 175 WVYCLQWLCILPLELVTASMTIKYW--NDSINPDAFVVIFYVVLIVINFIGAAGYAEAEF 232

Query: 225 YISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKG--RFVS 282
           + +  K+ ++                N   LG  YW +PGAF+       G  G  RF  
Sbjct: 233 FFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFR-------GNNGINRFKG 285

Query: 283 FASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPF 342
             +V V A FAY G E   +  +E +NP+K++  A K  +YRII  YL++  LLG  VP+
Sbjct: 286 LVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPY 345

Query: 343 NDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLY 402
           N P L+            PFV+AI + G+ V+PHI+NA IL+ V S ANS LY +SR L 
Sbjct: 346 NSPELLGSGSAATHAS--PFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSSRILL 403

Query: 403 GLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLL 462
            L+    AP++F   +++G P   LLV  +F LL ++  S     VFT+ +    +  L 
Sbjct: 404 SLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELF 463

Query: 463 SWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFL--- 519
           +W SI ++++RF ++  VQG     L YQS    +GA++++   +LI LI  F   +   
Sbjct: 464 TWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLI-LIGQFWVAISPV 522

Query: 520 -GDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK--TKIIPSEEVDLVSFKE 566
             +  D  +F                 KLWY+    IIP+ EVDLVS ++
Sbjct: 523 GSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRK 572

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  218 bits (556), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 131/390 (33%), Positives = 208/390 (53%), Gaps = 12/390 (3%)

Query: 124 VGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
           V   +F V++ LGE+AA  P+  GF+ Y  ++ DP+  FAV   YL ++ +++P +L A 
Sbjct: 186 VSTALFTVINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAA 245

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           ++ I+YW     +N   W++I  VAI   N L V+ FGE E+ +S VKI  +        
Sbjct: 246 SITIRYW--NSSINSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGI 303

Query: 243 XXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGI 302
                  P+HE +G KYW +PGAF       T +  +F    SVFV A F++ G E+  +
Sbjct: 304 VLDCGGGPSHEYIGGKYWHDPGAF-----VGTTSGSKFKGLCSVFVTAAFSFSGIEMTAV 358

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPF 362
             +E +NPR+ +PKA K T + I   Y+  + L+G  VP+NDP L+            P 
Sbjct: 359 SAAESRNPRETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASS-PL 417

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+AI N  I  LP +MNA ILI + S ANS +Y  SR +  ++     P++FAK +++G 
Sbjct: 418 VIAIENGHIHGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGR 477

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           P  ++   + F LL+++  S   +EVFT+      +  +  W+ I + +IRF +   VQ 
Sbjct: 478 PIPAICFVLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQ 537

Query: 483 IDKSTLAYQSPLQPYGAWFSLFFCILIGLI 512
           I    L +   L   G W S++  +++ L+
Sbjct: 538 ISLDELPF---LSQTGIWGSIYGIVILFLV 564

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  217 bits (553), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 149/448 (33%), Positives = 229/448 (51%), Gaps = 16/448 (3%)

Query: 128 VFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVI 186
           +F V++ LGE+AA  P+  GF  Y TR+ DP+ GFAV   YL ++ +++P +L A ++ I
Sbjct: 145 LFTVVNSLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITI 204

Query: 187 QYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXX 246
           +YW   DK+N   W+ I   AI   N L V+ FGE E+ +S +KI  +            
Sbjct: 205 RYW--NDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSC 262

Query: 247 XXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSE 306
              P    +G KYW +PGAF   ++       +F    SVFV A F+Y G EL  +  +E
Sbjct: 263 GGGPKGGYIGGKYWHDPGAFVGETSGT-----KFKGLCSVFVTAAFSYSGMELTAVSAAE 317

Query: 307 CKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAI 366
             NPR+ +PKA K T + I + Y+  + L+G  VP+N+P L+            P V+AI
Sbjct: 318 SLNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASS-PLVIAI 376

Query: 367 VNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWS 426
            N GI  LP +MNA ILI + S ANS +Y  SR +  +A     PR   + +++G P  +
Sbjct: 377 ENGGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNA 436

Query: 427 LLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKS 486
            L+ + F LL+++  S    EVFT+      +  + +W++I +++IRF +A   QGI   
Sbjct: 437 TLLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLD 496

Query: 487 TLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFL----GDTFDYKSFXXXXXXXXXXXXXX 542
            L Y S     G+W+ +    L+ L+ +F   L    G   D  SF              
Sbjct: 497 ELPYISMTGVSGSWYGVIVLFLV-LVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCY 555

Query: 543 XXXKLWYKTK--IIPSEEVDLVSFKEAV 568
              KL+ + K  +I   ++DLVS ++ V
Sbjct: 556 VGHKLYIRKKRLLIDVADMDLVSDRKVV 583

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  217 bits (553), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 150/488 (30%), Positives = 230/488 (47%), Gaps = 22/488 (4%)

Query: 34  ERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSE-FDGKHDGIR--LKKALEARHVSM 90
           E+SS       +DSK        G   KN+ T  SE F    + I   L K L  RH+  
Sbjct: 49  EKSSDNMTTYVTDSKTK-----EGGSEKNIETTPSEQFSIAKEDINENLNKDLSIRHLIT 103

Query: 91  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTS 149
                                            +   +F V++ LGE+AA  P+  GF  
Sbjct: 104 LAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGELAAAYPVVGGFNV 163

Query: 150 YSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAII 209
           Y TR+ DP++ FA+   YL ++ +++P +L A ++ I+YW   D +N   W+ I    I 
Sbjct: 164 YITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYW--NDTINSDAWVAIFYSVIA 221

Query: 210 TINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEY 269
             N L V+ FGE E+ +S VKI  +               P    LG  YW +PG+F   
Sbjct: 222 LANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSF--- 278

Query: 270 STAITGAK--GRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIV 327
                G K   +F    SVFV A F+Y G EL  +  +E K+PRK +PKA K T + +  
Sbjct: 279 ----VGDKPGTQFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTA 334

Query: 328 FYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVF 387
            Y+  + ++G  VPF+DP L+            P V++I NAGI  L  +MNA ILI + 
Sbjct: 335 SYVTILTIIGCLVPFDDPRLLNGSSSVDAAAS-PLVISIKNAGIKGLDSLMNAIILISIV 393

Query: 388 SAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSE 447
           S ANS +Y  SR +  +A     P++ ++ +K+G P  ++L  + F LL+++  S   +E
Sbjct: 394 SVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQAE 453

Query: 448 VFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCI 507
           VFT+      +  +  W++I  ++IRF  A +VQ      L Y S     G+W+ +    
Sbjct: 454 VFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLF 513

Query: 508 LIGLIKNF 515
           L+ L+ +F
Sbjct: 514 LV-LVASF 520

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  217 bits (552), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 137/458 (29%), Positives = 228/458 (49%), Gaps = 17/458 (3%)

Query: 58  SDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXX 117
           +++ N+   + +F+ K +  +L+K ++ RHV M                           
Sbjct: 62  NEINNI--KSDQFNDKLNN-QLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGL 118

Query: 118 XXXXXFVGLLVFFVMSCLGEMAA-YIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIV 175
                 +   ++ ++   GEMA  Y+ L  GF +Y +   D A  FAV + Y  ++  + 
Sbjct: 119 LIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVC 178

Query: 176 PNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITIN-FLGVRFFGEIEYYISAVKITVM 234
           P +L   ++ I+YW   +KV+P V++TI  + II IN F G R + E E++ +  KI ++
Sbjct: 179 PLELVTASMTIKYW--NEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMI 236

Query: 235 XXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAY 294
                               +G  YW NPGAF+ ++        RF    S  V A F++
Sbjct: 237 AGFFILGIILICGGAGTSGYIGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSF 291

Query: 295 LGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXX 354
             TE   I  SE  NPRKA+P A K  +YR +  Y+ SI ++G  VP+N P L+      
Sbjct: 292 GQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQ 351

Query: 355 XXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIF 414
                 P+V+A+ + GI + PH +NA ILI V S ANS  Y +SR L  LA    AP+IF
Sbjct: 352 TKAS--PYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIF 409

Query: 415 AKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRF 474
              +++G P + ++   L A +A+   S   +EVF++ +    +  + +W +I +++IRF
Sbjct: 410 TYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRF 469

Query: 475 DKAFRVQGIDKSTLAYQSPLQPYGAWF--SLFFCILIG 510
            +A ++QG   + L Y+S +  +G+ +  ++ F ILIG
Sbjct: 470 RRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIG 507

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  217 bits (553), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 137/454 (30%), Positives = 221/454 (48%), Gaps = 15/454 (3%)

Query: 65  THTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFV 124
           T  +E  GK +   LK +++ RHV M                                 +
Sbjct: 111 TQPAEVAGKSE--ELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIM 168

Query: 125 GLLVFFVMSCLGEMAAYIP--LDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
           G  ++ ++   GEMA      + GF SY +   +PALGF+V + Y  ++  + P +L   
Sbjct: 169 GSCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTA 228

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLG-VRFFGEIEYYISAVKITVMXXXXXXX 241
           ++ I+YW    KV+P V++ I  V II IN LG    + E E++ ++ KI ++       
Sbjct: 229 SMTIKYWTT--KVDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILG 286

Query: 242 XXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCG 301
                    +   +G +YW +PGAF+        A  RF    S  V A FA+  +E+ G
Sbjct: 287 IILICGGAGDDGYIGGRYWHDPGAFRGEH-----AIDRFKGVVSTLVNAAFAFGLSEMIG 341

Query: 302 IVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXP 361
           +  SE  NPRKA+P A K  +YRI+  YL S+ ++G  VP+N   L+            P
Sbjct: 342 VTASEQSNPRKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKAS--P 399

Query: 362 FVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQG 421
           +V+A+   G+ V+PH +NA IL+ V S ANS  Y +SR L GLA    AP+IF   +++G
Sbjct: 400 YVLAVSTHGVRVVPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREG 459

Query: 422 VPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ 481
            P   + V  L  ++++   S    +VF + +    +  L +W +I +++IRF +A  VQ
Sbjct: 460 RPTMGMCVAALVNVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQ 519

Query: 482 GIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF 515
           G     + ++S    +G+W++    +LI LI  F
Sbjct: 520 GRSLGEIGFKSQCGVWGSWYAFIMMMLI-LIAQF 552

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  217 bits (553), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 148/523 (28%), Positives = 236/523 (45%), Gaps = 36/523 (6%)

Query: 14  VDTDEDIEKQQLFGDDNIVIERSSQLFY--DGQSDSKVHGIT----------------SG 55
            + + +IE  +     N    R  +  +  D  S  K HG+                   
Sbjct: 27  TEQENEIEYFETLKGKNAATTREEEYDFTTDSTSGRKRHGVKGYFRDFIDSFKPAENPQP 86

Query: 56  HGSDVKNVVTHTSEFDGKHD------GIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXX 109
           H +    +V  TSE   +H       G +LKK ++ RHV +                   
Sbjct: 87  HTNLDMELVGVTSETIEQHKKDEGDTGDKLKKTIQPRHVILISLGTGIGTGLLVGNGATL 146

Query: 110 XXXXXXXXXXXXXFVGLLVFFVMSCLGEMAA-YIPL-DGFTSYSTRYADPALGFAVGYAY 167
                         +G L++ ++   GEMA  Y+ L  GF +Y T   DP   FA  + Y
Sbjct: 147 AQAGPAGLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVY 206

Query: 168 LFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLG-VRFFGEIEYYI 226
             ++  + P +L   ++ I+YW    KV+P V++ I  V I+ IN LG  R + E E+  
Sbjct: 207 CLQWLCVCPLELVTASMTIKYWTT--KVDPDVFVIIFYVFILGINILGGARGYAEAEFIF 264

Query: 227 SAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASV 286
           ++ KI +M                    +G +YW +PGAF+        A  RF    + 
Sbjct: 265 NSCKILMMIGFFILGIIIICGGAGTDGYIGGRYWHDPGAFRGER-----AVDRFKGVVAT 319

Query: 287 FVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPL 346
            V A F++  +E   +  SE  NPR+A+P A K  +YR +  YL SI LLG  VP+N   
Sbjct: 320 LVTAAFSFGQSEFIAVTASEQSNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQ 379

Query: 347 LIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAI 406
           L+            P+V+A+ N G+ V+PH +NA I+I V S +NS  Y + R L  L+ 
Sbjct: 380 LLGAQSNGIKAS--PYVLAVANHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQ 437

Query: 407 DNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWIS 466
              AP+IF+  ++ G P   ++V  LFA++A+   S    +VFT+ +    +  + +W+S
Sbjct: 438 QGFAPKIFSYVDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMS 497

Query: 467 ILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
           I ++++RF +A  VQG       + S +  YG+ +S F   LI
Sbjct: 498 ICLSHLRFRRAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALI 540

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  216 bits (551), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 147/497 (29%), Positives = 247/497 (49%), Gaps = 17/497 (3%)

Query: 79  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEM 138
           LK  L++RH+ M                                  G +++ ++  +GE+
Sbjct: 87  LKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGEL 146

Query: 139 AAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNP 197
           A   P+ G FT+Y+TR+ D + GFA+ + Y+ ++ I +P ++ + ++ + YW    K   
Sbjct: 147 AVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKYRD 206

Query: 198 GVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGF 257
           G ++ +  V  + IN  GV+ +GE E+  + +K+  +               P    +G 
Sbjct: 207 G-FVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIGA 265

Query: 258 KYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKA 317
           KYW +PGAF   +     A  +F  F +VF+ A F++ G+E+ G+  SE +NPRK+VP A
Sbjct: 266 KYWHHPGAFVGDT-----AGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPGA 320

Query: 318 IKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHI 377
            K   +RI +FY++ + L+GM VP+ND  LI            PFV+A+VN GI  LP +
Sbjct: 321 AKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAAS--PFVIAVVNQGIRGLPSV 378

Query: 378 MNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLA 437
           +N  ILI V S  NS +Y+ SR+L  LA     P+I A  ++ G P  ++ +   F L+A
Sbjct: 379 INVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIA 438

Query: 438 YMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPY 497
           ++  SS   EVF + +    +  L SW +I I +IRF +A   QG     L + S +   
Sbjct: 439 FVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGIA 498

Query: 498 GAWFSLFFCILIGL----IKNFPAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKT-K 552
           G+++ +F C+L+ +    +  FPA  G + + K F                 K+W K  K
Sbjct: 499 GSYWGIFICVLMLIAQFYVGLFPA--GASPNAKDFFMAYLSFPIVLAFYIFHKIWKKNWK 556

Query: 553 I-IPSEEVDLVSFKEAV 568
           + I +E++D+ + +  V
Sbjct: 557 LYIKAEDMDIDTGRREV 573

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  216 bits (550), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 128/390 (32%), Positives = 205/390 (52%), Gaps = 11/390 (2%)

Query: 124 VGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
           +   +F V++ LGE++A  P+  GF  YS R+ +P+  FAV   YL ++ +++P +L A 
Sbjct: 131 ISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAA 190

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           ++ I+YW   DK+N   W+ I    I   N L V+ FGE E+ +S +KI  +        
Sbjct: 191 SITIKYW--NDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGI 248

Query: 243 XXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGI 302
                  P+   +G KYW +PGAF  + +       +F    SVFV A F+Y G E+  +
Sbjct: 249 VLSCGGGPHGGYIGGKYWNDPGAFVGHDSGT-----KFKGLCSVFVTAAFSYSGIEMTAV 303

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPF 362
             +E KNPR+ +PKA K T + I + Y+  + L+G  VP NDP L+            P 
Sbjct: 304 SAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PL 362

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+AI N  I  LP +MNA ILI V S ANS +Y  SR +  +A     P+   + +K+G 
Sbjct: 363 VIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGR 422

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           P  ++++ + F LL+++  S   +EVFT+      +  +  W++I +++IRF +A + Q 
Sbjct: 423 PINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQE 482

Query: 483 IDKSTLAYQSPLQPYGA--WFSLFFCILIG 510
                L + S    +G+   F + F +LI 
Sbjct: 483 RSLDELPFISQTGVWGSIYGFVVLFLVLIA 512

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  217 bits (553), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 144/500 (28%), Positives = 229/500 (45%), Gaps = 16/500 (3%)

Query: 74  HDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMS 133
           +D   LK+ +  RHV M                                 +G +++ ++ 
Sbjct: 125 NDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQ 184

Query: 134 CLGEMA-AYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVD 191
             GEMA AY  L  G+  Y +   +   GFA+ + Y  ++  + P +L   +L I+YW  
Sbjct: 185 ATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTT 244

Query: 192 RDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPN 251
              VN  +++ I    II IN  G + + E E++ +  K+ +M                N
Sbjct: 245 --SVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGN 302

Query: 252 HEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPR 311
              LG  YW  PGAF+  S+        F       V A FAY GTE   +  +E  NPR
Sbjct: 303 DGYLGGLYWHTPGAFRGDSSI-----DHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPR 357

Query: 312 KAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGI 371
            A+P A K  +YRII  YLISI ++G  VPF+   L+            P+V+A    G+
Sbjct: 358 AAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSAS--PYVLAASLHGV 415

Query: 372 PVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGV 431
            V+PH +NA ILI V S  NS  Y +SR L  LA    AP+ F   +++G P  ++L+  
Sbjct: 416 RVVPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSA 475

Query: 432 LFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQ 491
           LF ++A+   S   +EVFT+ +    +  L +W +I +++IRF  A +VQG     + Y 
Sbjct: 476 LFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYL 535

Query: 492 SPLQPYGAWFSLFFCILIGLIKNFPAFL---GDTFDYKSFXXXXXXXXXXXXXXXXXKLW 548
           +    +G+W++LF   LI + + + A           ++F                 K++
Sbjct: 536 AQTGVWGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIY 595

Query: 549 YK--TKIIPSEEVDLVSFKE 566
           YK  T +I +E++DL S ++
Sbjct: 596 YKDWTLLIKAEDIDLQSHRQ 615

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  216 bits (551), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 140/460 (30%), Positives = 217/460 (47%), Gaps = 14/460 (3%)

Query: 43  GQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXX 102
             SD +V G      +DV+  V      D   +  +L K L  RH+              
Sbjct: 78  ADSDMEVDGKRYKEMTDVERAVC-----DAARNSSQLSKNLSIRHLLTLAVGGAIGTGLF 132

Query: 103 XXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGF 161
                                +   +F +++ LGE+A+  P+  GF  Y TR+ +P+ GF
Sbjct: 133 VNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGF 192

Query: 162 AVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGE 221
           AV  +YL ++ +++P +L A ++ I+YW   +K+N   W+ I  V I   N L V+ FGE
Sbjct: 193 AVNISYLAQWAVLLPLELAAASITIKYW--NNKINSDAWVAIFYVCIALANMLDVKSFGE 250

Query: 222 IEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFV 281
            E+ +S VKI  +               P    +G KYW +PGAF   +        +F 
Sbjct: 251 TEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAFVGDTPG-----AQFK 305

Query: 282 SFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVP 341
              SVFV A F+Y GTEL G+  +E  NPR  +P+A K + + I   YL+ + + G  VP
Sbjct: 306 GLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVP 365

Query: 342 FNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSL 401
            NDP L+            P V+AI N GI  +P +MNA ILI + S ANS +Y  SR +
Sbjct: 366 SNDPRLLNGMSSVDVAAS-PLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCM 424

Query: 402 YGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGL 461
             +A     P++F   +++G P  ++L  ++F LL+++  S     +FT+      +  L
Sbjct: 425 VSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTL 484

Query: 462 LSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWF 501
             W +I I++IRF +A   Q      L Y S     G+W+
Sbjct: 485 FCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWY 524

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  215 bits (548), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 138/460 (30%), Positives = 226/460 (49%), Gaps = 20/460 (4%)

Query: 66  HTSEFDGKHDGI-------RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXX 118
           H +  +   DGI       + KK+L +RHV M                            
Sbjct: 57  HNARSEDVEDGIASIRSDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLI 116

Query: 119 XXXXFVGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVP 176
                V  + +F++   GEMA AY  L G F +Y + +   + GFA  + +  ++  ++P
Sbjct: 117 IGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLP 176

Query: 177 NQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLG-VRFFGEIEYYISAVKITVMX 235
            +L   +L I+YW   DK+N  +++ I  V ++ I+ +G +R +GE E+  ++ KI ++ 
Sbjct: 177 LELITSSLTIKYW--NDKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVI 234

Query: 236 XXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYL 295
                          N   +G KYW  PG+F E       A  RF     V V   F+Y 
Sbjct: 235 GFIILSIVINAGGAGNDGYIGGKYWHEPGSFAE-----GDATSRFKGICLVLVSGYFSYG 289

Query: 296 GTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXX 355
           GTEL  + V+E   PRKA P A K ++YRI++ YL+++ L+G  VP N+  L+       
Sbjct: 290 GTELYVLSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSAT 349

Query: 356 XXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFA 415
                P+V+A    G+ ++PH +NA ILI V S ANS L+   R L  LA    AP+I +
Sbjct: 350 HAS--PYVLAATIHGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILS 407

Query: 416 KTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFD 475
             +++G P  +L +  L  L+A+++ +S   EVFT+      +  + +W  I+ +++RF 
Sbjct: 408 YVDREGRPLVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFR 467

Query: 476 KAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF 515
            A +VQG D + L Y++    +G+ +  FF +L+ LI  F
Sbjct: 468 AAMKVQGKDINELGYKANTGVWGSAYGAFFGVLV-LIAQF 506

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  216 bits (549), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 138/448 (30%), Positives = 221/448 (49%), Gaps = 25/448 (5%)

Query: 126 LLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGA 183
           ++++ V+   GE+   Y  L G +T+Y T   DPA+GFAV   Y  ++  ++P QL   A
Sbjct: 153 IMIYCVVQAAGELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAA 212

Query: 184 LVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXX 243
           + I+YW     VNP +++  +LV +I IN  G + + E E++ +  K+ +M         
Sbjct: 213 MTIRYWTT--NVNPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIV 270

Query: 244 XXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIV 303
                  + E +G KYW+ PGAF         A G F   A+VF  A F+Y G E+  + 
Sbjct: 271 INCGGAGDKEYIGVKYWQTPGAF---------ANG-FKGVAAVFCYAAFSYGGIEVLVLT 320

Query: 304 VSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFV 363
            +E  NPRKA+P A +  +YR++  Y+++  ++   VP+N P L+            PFV
Sbjct: 321 ANEQANPRKAIPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFV 380

Query: 364 VAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVP 423
           +A+ + G+ V+PHI+NA ILI V S ANS LY   R L  L+    AP+ F   +++G P
Sbjct: 381 IAVASHGVQVVPHIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRP 440

Query: 424 YWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ-- 481
              +LV V   L+A++       EVFT+ +    +  +  W+SI I+++RF  A R Q  
Sbjct: 441 IICVLVSVAMGLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLG 500

Query: 482 GID-KSTLAYQSPLQPYGAWFSLFFCILIGLIKNF-----PAFLGDTFDYKSFXXXXXXX 535
           G+  +  + Y +     G+  +L   I I L+  F     P       D + F       
Sbjct: 501 GLRARDVVEYTAQTGYVGSLVALAISIFI-LVCQFWVAIAPLGHNGQLDVQIFFENYLAA 559

Query: 536 XXXXXXXXXXKLWYK--TKIIPSEEVDL 561
                     K+W++     IP+ E+DL
Sbjct: 560 PVLLGGYLAYKIWHRDWRLCIPANEIDL 587

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  214 bits (545), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 151/538 (28%), Positives = 245/538 (45%), Gaps = 36/538 (6%)

Query: 43  GQSDSKVHGITSG------HGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXX 96
           G  D +  GI  G       G DV  +    +E DG     ++KK ++ RH+ M      
Sbjct: 26  GSGDERRTGIMRGFIDSFRRGRDVDLMCKADAE-DGTTA--KMKKTIKTRHLLMITLGTG 82

Query: 97  XXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRY 154
                                         +++ ++   GE+   Y  + G +T+YS+  
Sbjct: 83  IGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAGELGICYSGMTGNYTAYSSLL 142

Query: 155 ADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFL 214
            DPA+GF+V + Y  ++  + P QL   A++IQYW D   +NP +++ I+   I+ IN  
Sbjct: 143 VDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTD---INPDIFVAIIYAVIVFINLF 199

Query: 215 GVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAIT 274
           G + + E E++ +  K+ ++                    +G KYW  P  F      + 
Sbjct: 200 GAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYIGDKYWHEPRPF------MN 253

Query: 275 GAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIF 334
           G KG       VF  A FAY G E+  +  SE +NPRK++  A K  +YRI++ YL++  
Sbjct: 254 GFKG----LCFVFCYAAFAYGGIEVMVLSASEQENPRKSISSACKKVIYRIVLIYLLTTV 309

Query: 335 LLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDL 394
           ++   VP + P L             P V+A+   G+ ++PHI+NA ILI V S  NS L
Sbjct: 310 IVCFLVPADHPSL-----ASEGSRASPLVIAVSFHGVKIVPHIINAVILIAVVSVGNSSL 364

Query: 395 YVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVN 454
           Y A R L  LA    AP+IF   ++QG P  +  V ++F LLA++  S    +VF + + 
Sbjct: 365 YSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFLAASPAQDDVFGWLLA 424

Query: 455 CVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKN 514
              +  +  W+SI I++IRF  A + QG     + Y++    +G+W ++    LI LI  
Sbjct: 425 ISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGSWIAVVTAFLI-LIAQ 483

Query: 515 FPAFLGDT----FDYKSFXXXXXXXXXXXXXXXXXKLWYK--TKIIPSEEVDLVSFKE 566
           F   +        D +SF                 K+++K     IP+ EVDL+S ++
Sbjct: 484 FWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKDWRICIPASEVDLISHRQ 541

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  214 bits (546), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 135/453 (29%), Positives = 219/453 (48%), Gaps = 16/453 (3%)

Query: 58  SDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXX 117
           SD++ +   T+    KH        L+ RH+ M                           
Sbjct: 67  SDIEKIAHRTAHAPLKHH-------LKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGI 119

Query: 118 XXXXXFVGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVP 176
                  G +++ ++  +GE++   P+ G FT+Y+TR+ D + GFA  + Y+ ++  ++P
Sbjct: 120 LIGWGLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLP 179

Query: 177 NQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXX 236
            ++ A ++ + YW    K   G ++ +  V I+ IN  GV+ +GE E+  S +K+  +  
Sbjct: 180 LEIVAASITVNYWGTDPKYRDG-FVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIG 238

Query: 237 XXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLG 296
                        P    +G KY+ +PGAF   +     A  RF    SVFV A F++ G
Sbjct: 239 FIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGDT-----AGARFQGVCSVFVTAAFSFAG 293

Query: 297 TELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXX 356
           +EL GI  +E   PRK+VPKA K   +RI +FY++S+ ++G+ VP+ D  LI        
Sbjct: 294 SELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAA 353

Query: 357 XXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAK 416
               PFV+AI + GI  LP ++N  ILI V S  NS +Y  SR+L  LA  N  P+IF  
Sbjct: 354 AS--PFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGY 411

Query: 417 TNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDK 476
            ++ G P + +     F L+A++  S    EVF + +    +  L +W  I   +IRF  
Sbjct: 412 IDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRA 471

Query: 477 AFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
           A   QG     L +++P   YG+ + LF  +L+
Sbjct: 472 ALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLM 504

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  214 bits (544), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 147/515 (28%), Positives = 241/515 (46%), Gaps = 33/515 (6%)

Query: 9   AQLSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSD-SKVHGI---------TSGHGS 58
           +Q  ++D   D E Q   G      E   Q  Y  QSD S V G                
Sbjct: 2   SQEKKLDYSIDQETQLESG------EFHEQNSYVSQSDASPVEGTRWERFRDSFKRADTQ 55

Query: 59  DVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXX 118
           D+   +T   +         LK+ L++RH+ M                            
Sbjct: 56  DLDPNLTDAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGIL 115

Query: 119 XXXXFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPN 177
                 G +++ ++  +GE+A   P+  GFT+Y++R+ D + GFA    Y+ ++ +++P 
Sbjct: 116 IGWALTGTMIYCMVMAMGELAVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPL 175

Query: 178 QLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXX 237
           ++ A ++ + YW   DK   G ++ +  V I+ INF GV+ +GE E+  S +K+  +   
Sbjct: 176 EIVAASITVNYWGTPDKYRDG-FVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGY 234

Query: 238 XXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGT 297
                       P    +G + W NPGAF        G KG      SVFV A F++ G+
Sbjct: 235 IILGVILVCGGGPQGGYIGGRLWHNPGAFAN------GFKG----VCSVFVTAAFSFAGS 284

Query: 298 ELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXX 357
           EL G+  +E  NPRK++P A K   +RI +FY++++ ++G+ VP+    LI         
Sbjct: 285 ELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAA 344

Query: 358 XXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKT 417
              PFV++I NAGI  LP ++N  ILI V S  NS ++  SRS+  LA     P+IF   
Sbjct: 345 S--PFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYI 402

Query: 418 NKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKA 477
           ++ G P   ++V  +F LL+++  S    EVF + +    +  L +W  I++ +IR  +A
Sbjct: 403 DRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRA 462

Query: 478 FRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLI 512
              Q    + L++ +P    G W S++  +LI LI
Sbjct: 463 LAAQNRTTAELSFTAPT---GVWGSVYGFVLIILI 494

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  215 bits (547), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 141/516 (27%), Positives = 244/516 (47%), Gaps = 21/516 (4%)

Query: 60  VKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 119
           V  +   + E + K +   LKK+++ RH  M                             
Sbjct: 128 VDGIKQSSQEQEPKQE--NLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLII 185

Query: 120 XXXFVGLLVFFVMSCLGEMAAYIP--LDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPN 177
               +G  V+ ++   GE+A      + GF +Y +   DPA+GF+V + +  ++  + P 
Sbjct: 186 GYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPL 245

Query: 178 QLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXX 237
           +L   ++ I+YW    KVN  V++ I  V I+ IN  G + + E +++ +  KI ++   
Sbjct: 246 ELVTASMTIKYWTV--KVNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGF 303

Query: 238 XXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGT 297
                            +G +YW++PGAF+   T+I     RF    + FV A FA+  +
Sbjct: 304 FILAIIIDCGGAGTDGYIGSRYWRDPGAFRG-DTSIQ----RFKGVVATFVTAAFAFGMS 358

Query: 298 ELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXX 357
           E   +  SE  NPRKA+P A K  +YRI+  +L S+ L+G  VP+    L+         
Sbjct: 359 EQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKA 418

Query: 358 XXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKT 417
              P+V+A+ + G+ V+PH +NA IL+ V S ANS  Y +SR L  LA    AP+ F   
Sbjct: 419 S--PYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYI 476

Query: 418 NKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKA 477
           +++G P  +++V  +F ++A+   S    +VFT+ +    +  L +WI+I +++IRF K 
Sbjct: 477 DREGRPAVAMIVSAVFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKG 536

Query: 478 FRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF-----PAFLGDTFDYKSFXXXX 532
            +VQG     + Y+S +  +G+ +++   +L  LI  F     P         +SF    
Sbjct: 537 MKVQGRSLGEVGYKSQVGVWGSAYAVVLMVL-ALIGQFWVAISPIGGDKKLSAQSFFENY 595

Query: 533 XXXXXXXXXXXXXKLWYK--TKIIPSEEVDLVSFKE 566
                        K+W +  +  IP++++DLVS + 
Sbjct: 596 LAMPILIALYIFYKVWKRDWSLFIPADKIDLVSHRN 631

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  213 bits (542), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 164/568 (28%), Positives = 259/568 (45%), Gaps = 30/568 (5%)

Query: 6   YLDAQLSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVH-GITSGHGSDVKNVV 64
           Y +++ S+ D  E  +       +  VI  SS    +G +  +   G+ +      K   
Sbjct: 13  YSNSKDSKNDGFEVKDISATVSPETNVITASSSASNEGPATPQPQLGVVASFLDSFKRKE 72

Query: 65  THTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFV 124
              S    ++D   L KA+ +RH+ M                                  
Sbjct: 73  HDDSTAGDEND---LNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVS 129

Query: 125 GLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
            L+VF ++   GE+   Y  + G FT Y T   DPA GFA+ + Y  ++ I++P QL   
Sbjct: 130 SLMVFLIIQAAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTA 189

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           A+ IQ+W     VN  V++    V ++ IN  G R + E E++ +  KI ++        
Sbjct: 190 AMTIQFW--NVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGI 247

Query: 243 XXXXXXXPNHE--VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELC 300
                  PN     +G KYW+NPG F        G KG      SVF  A F+Y G E  
Sbjct: 248 IITAGGIPNGPDGYIGGKYWRNPGLFAN------GFKG----VCSVFCYAAFSYGGVETL 297

Query: 301 GIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXX 360
            +  +E KNP K++P A K  MYRI+  YL+S+ ++   VP+  P L+            
Sbjct: 298 VLSAAEQKNPLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSS-- 355

Query: 361 PFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQ 420
           PFV+AI + G+ V+PH++NA ILI V S ANS LYVA R L  LA    AP+     +K+
Sbjct: 356 PFVIAIASHGVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKR 415

Query: 421 GVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRV 480
           G P    LV VLF ++ ++  S     VFT+ ++   +  +  WISI +++IRF  A RV
Sbjct: 416 GRPTTCTLVVVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRV 475

Query: 481 QGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF-----PAFLGDTFDYKSFXXXXXXX 535
           QG   + +AY++    +G++ ++   + + L+  F     P       D  +F       
Sbjct: 476 QGHPLTEIAYKAQTGYWGSYVAIALALFV-LVCQFWVAIAPVGAHGKLDATNFFQNYLAF 534

Query: 536 XXXXXXXXXXKLWYK--TKIIPSEEVDL 561
                     K++YK    +IP+++++L
Sbjct: 535 PVVLCAYLGFKVYYKQWQLLIPADKIEL 562

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  214 bits (544), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 136/457 (29%), Positives = 222/457 (48%), Gaps = 22/457 (4%)

Query: 56  HGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXX 115
            GSD  +++T+T           LKKA+++RHV M                         
Sbjct: 102 EGSDHDSIITNT----------HLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPA 151

Query: 116 XXXXXXXFVGLLVFFVMSCLGEMAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWI 173
                   V  + +F++   GEMA   P     F +YS+ +   A GFA  + +  ++  
Sbjct: 152 ALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLT 211

Query: 174 IVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITIN-FLGVRFFGEIEYYISAVKIT 232
           ++P +L   +L I+YW   DK+N  V+I I  V ++ I+ F GV  +GE E+  +  KI 
Sbjct: 212 VLPLELITASLTIKYW--NDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKIL 269

Query: 233 VMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALF 292
           ++                N E +G K+W +PGAF     A   A  RF     V V   F
Sbjct: 270 MVIGFIIMSIVINAGGAGNREYIGGKFWHDPGAF-----AGKTAGSRFKGICYVLVSGYF 324

Query: 293 AYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXX 352
           +Y GTEL  + V+E  NPR++ P+A K ++YRI++ YL+++ L+G  VP++   L+    
Sbjct: 325 SYGGTELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGG 384

Query: 353 XXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPR 412
                   P+V+A    G+ + PH +NA ILI V S ANS LY A R +  LA    AP+
Sbjct: 385 SATHAS--PYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPK 442

Query: 413 IFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYI 472
                ++QG P  +L+  +L  ++ ++  S    EVFT+      +  L +W SI+++++
Sbjct: 443 FLDYVDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHV 502

Query: 473 RFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
           RF  A ++Q      L Y++    YG+ + + F +L+
Sbjct: 503 RFRMAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLV 539

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  212 bits (540), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 150/496 (30%), Positives = 238/496 (47%), Gaps = 28/496 (5%)

Query: 29  DNIVIERSSQL---FYDGQSDSKVHGITSGHGSDVKNVVTHTSE-----FDGKHDGIRLK 80
           DN++   S  L   F DG    +            KN+V    +      DG +    LK
Sbjct: 12  DNLLSPSSGDLEMKFSDGIMSKETEIDLDKKEDKNKNIVRRMIDSFKPPLDGSYHSDNLK 71

Query: 81  KALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAA 140
           + L++RH+ M                                  G  +   +  LGE+  
Sbjct: 72  RKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLGEITM 131

Query: 141 YIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGV 199
             P+ G F +YSTR  DP++ F V   Y+ +++ ++P +L A A+ +Q+W    KV+P V
Sbjct: 132 RFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTT--KVDPVV 189

Query: 200 WITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKY 259
           W+ I  V ++++N  GV+ FGE E+  S VK+  +               P+H  +G +Y
Sbjct: 190 WVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIGTEY 249

Query: 260 WKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIK 319
           W +PGA         G KG     ASVFV A ++  G+E+  +  +E  +P K +P AIK
Sbjct: 250 WHHPGALAN------GFKG----VASVFVTASYSLGGSEMVCLCSAE-TDP-KELPHAIK 297

Query: 320 LTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMN 379
              +RI+ F+L+S+ L+G  VP+ +  L+            PFV+AI  +GI VLP I+N
Sbjct: 298 QVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSSVNNS----PFVIAIKLSGIRVLPSIIN 353

Query: 380 ACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYM 439
           A ILI + S  NS ++ +SR+L  +A     PR+F   ++ G P   ++V  LF LLA++
Sbjct: 354 AVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFL 413

Query: 440 NVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGA 499
             S+    VF + +    +   + W+SI I++IRF  A + Q      L ++S +  YG+
Sbjct: 414 VKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSVGVYGS 473

Query: 500 WFSLFFCILIGLIKNF 515
            +S    ILI LI  F
Sbjct: 474 IYSATVNILI-LIAQF 488

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  213 bits (541), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 134/434 (30%), Positives = 215/434 (49%), Gaps = 19/434 (4%)

Query: 70  FDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVF 129
            DG  D   LK++L+ARH+ M                                  G  + 
Sbjct: 76  LDGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQII 135

Query: 130 FVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQY 188
             +  LGE+    P+ G F +YSTR+ DP+L F +   Y+ +++ ++P ++ + A+ +QY
Sbjct: 136 GTIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQY 195

Query: 189 WVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXX 248
           W     ++P VW+ I   AI++IN  G R FGE E+  S+VK+  +              
Sbjct: 196 W--NQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGG 253

Query: 249 XPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECK 308
            P+H+ +G KYW +PG           A G F    SV V+A ++  GTE+  + ++  +
Sbjct: 254 GPDHDFVGAKYWHDPGCL---------AHG-FPGVLSVLVVASYSLGGTEM--VCLASGE 301

Query: 309 NPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVN 368
              K +P AIK T +RI+ F+L+S+ L+G  VP+ +  L+            PFV+AI  
Sbjct: 302 TDPKELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSSVNNS----PFVIAIKL 357

Query: 369 AGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLL 428
             I VLP I+NA ILI + S  NS ++ +SR+L  +A     PR F   ++ G P   ++
Sbjct: 358 HQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGII 417

Query: 429 VGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTL 488
              LF LLA++  SS  SEVF + +    +   + W+SI I++IRF  A + QG     L
Sbjct: 418 TNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDEL 477

Query: 489 AYQSPLQPYGAWFS 502
            + S +  +G+ +S
Sbjct: 478 EFVSAVGIWGSAYS 491

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  213 bits (541), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 132/445 (29%), Positives = 214/445 (48%), Gaps = 15/445 (3%)

Query: 75  DGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSC 134
           D   L+K++  RHV M                                 +G  ++ ++  
Sbjct: 115 DDAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQA 174

Query: 135 LGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192
            GEMA  Y  L G F +Y +   D  + F V + Y  ++  ++P +L   ++ I YW   
Sbjct: 175 CGEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTT- 233

Query: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNH 252
            KVN  V++ I  V I  IN  G + + E E++ ++ K+ +M                N 
Sbjct: 234 -KVNSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND 292

Query: 253 EVLGFKYWKNPGAFKEYSTAITGAKG--RFVSFASVFVLALFAYLGTELCGIVVSECKNP 310
             +G KYW NPGAF+       G K   RF    S F  A FA+  +E   I  SE  NP
Sbjct: 293 GYIGAKYWHNPGAFR-------GDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNP 345

Query: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAG 370
           R+A+P A K  +YRI+  +L SI L+G  VP++   L+            P+V+A+ + G
Sbjct: 346 RRAIPSAAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQAS-PYVIAVASHG 404

Query: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430
           + V+PH +NA IL+ V S ANS  Y + R LY LA    AP+ F   +++G P  ++LV 
Sbjct: 405 VRVVPHFINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVT 464

Query: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490
            +F ++A+ + S    +VF + ++   +  L +W +I +++IRF +A +VQG     + +
Sbjct: 465 TIFGVIAFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGF 524

Query: 491 QSPLQPYGAWFSLFFCILIGLIKNF 515
           +S +  +G+ ++    IL  LI  F
Sbjct: 525 KSQVGVWGSGYAAIMMIL-ALIAEF 548

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  212 bits (540), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 144/504 (28%), Positives = 239/504 (47%), Gaps = 20/504 (3%)

Query: 72  GKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFV 131
           G     +LKK +++RHV M                                 +G  ++ +
Sbjct: 89  GDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCI 148

Query: 132 MSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
           +   GE+A  Y  L G F +Y +   DPALGF+V + Y  ++  ++P +L   ++ I+YW
Sbjct: 149 IQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYW 208

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
                VNP +++ I  V  I IN  G R + E E++ +  K+ ++               
Sbjct: 209 TT--SVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGA 266

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAK--GRFVSFASVFVLALFAYLGTELCGIVVSEC 307
            N   +G KYW +PG+F       +G K    F    S  V A FA+  TE   +  +E 
Sbjct: 267 GNDGYIGGKYWNDPGSF-------SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQ 319

Query: 308 KNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIV 367
            NPRK++P A K  +YRIIV +L SI L+G  VP N   L+            P+V+AI 
Sbjct: 320 ANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHAS--PYVIAIA 377

Query: 368 NAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSL 427
           + G+ V+PH +NA IL+ V S  NS  Y +SR L  LA    AP      +++G P  ++
Sbjct: 378 SHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAM 437

Query: 428 LVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKST 487
           ++  +F L++++  S     VFT+ +    +  L +W +I +++IRF +A +VQG     
Sbjct: 438 IISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGE 497

Query: 488 LAYQSPLQPYGAWFS--LFFCILIGLIKNFPAFLGD-TFDYKSFXXXXXXXXXXXXXXXX 544
           L ++S +  +G++++  +   ILIG      A +G+   D ++F                
Sbjct: 498 LGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFG 557

Query: 545 XKLWYK--TKIIPSEEVDLVSFKE 566
            K+W +  T  IP+ ++DL+S + 
Sbjct: 558 YKVWKRDWTLYIPASKIDLISNRR 581

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  213 bits (543), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 147/547 (26%), Positives = 248/547 (45%), Gaps = 18/547 (3%)

Query: 27  GDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEAR 86
            D+N V   S Q F +   + K +        D   V   +   + + +  +LK+ ++ R
Sbjct: 98  ADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPR 157

Query: 87  HVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMA-AYIPLD 145
           HV M                                 +G  ++ ++   GE+A AY  ++
Sbjct: 158 HVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVN 217

Query: 146 G-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITIL 204
           G F ++ +   DP   FAV + Y  ++  + P +L   ++ I+YW    KV+P V++ I 
Sbjct: 218 GSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTT--KVDPDVFVVIF 275

Query: 205 LVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPG 264
            V I+ INF G + + E E++ +  K+ +M                    +G KYW +PG
Sbjct: 276 YVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPG 335

Query: 265 AFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYR 324
           AF+   T I     RF      FV A FA+  TE   +  +E  NPRKA+P A K   YR
Sbjct: 336 AFRG-QTKIE----RFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVAYR 390

Query: 325 IIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILI 384
           I++ +L SI L+G  VP+N   L+            P+V+A    G+ V+ H +NA IL+
Sbjct: 391 ILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSAS--PYVLAASLHGVHVVQHFINAVILL 448

Query: 385 FVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSG 444
            V S ANS  Y +SR L GLA    AP+ F   ++ G P  S+L   + A++A+   S  
Sbjct: 449 SVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAVIAFCATSPK 508

Query: 445 SSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLF 504
            ++VFT+ +    +  + +W +I +++IRF +  +VQG     L +++     G++++  
Sbjct: 509 ETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAI 568

Query: 505 FCILIGLIKNFPAFL----GDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK--TKIIPSEE 558
             + + L+  F   L      T D ++F                 KLW +     I ++ 
Sbjct: 569 M-LFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKN 627

Query: 559 VDLVSFK 565
           +DL+S +
Sbjct: 628 IDLISHR 634

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  212 bits (539), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 132/461 (28%), Positives = 229/461 (49%), Gaps = 17/461 (3%)

Query: 75  DGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSC 134
           D   LKKA+++RHV M                                 V  + +F++  
Sbjct: 71  DASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQA 130

Query: 135 LGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192
            GEMA AY  L G F SY++ +     GFA  + +  ++  + P +L   +L I+YW   
Sbjct: 131 AGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYW--N 188

Query: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNH 252
           DK+N  V+I I  V ++ I+F GV+ +GE E+  ++ K+ ++                  
Sbjct: 189 DKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKD 248

Query: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRK 312
             +G KYW++PG+F E  +       +F     + V A F+Y G EL  + V+E +NPRK
Sbjct: 249 GYIGAKYWRDPGSFAEGDSV-----EKFKGICYILVTAYFSYGGAELFSLSVNEQENPRK 303

Query: 313 AVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIP 372
           + P+A K ++YRI++ YL+++ L+G  VP N+  L+            P+V+A    G+ 
Sbjct: 304 STPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHAS--PYVLAASIHGVK 361

Query: 373 VLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVL 432
           V+PH +NA ILI V S ANS LY + R +  LA    AP+     +++G P  +L++  +
Sbjct: 362 VVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAV 421

Query: 433 FALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQS 492
           F ++ +++ SS   EVFT+      +  L +W  I+++++RF +  ++ G  +  + +++
Sbjct: 422 FGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRA 481

Query: 493 PLQPYGAWFSLFFCILIGLIKNF-----PAFLGDTFDYKSF 528
               +G+ + + F +L+  I  F     P  L    D +SF
Sbjct: 482 VTGIWGSMYGISFNMLV-FIAQFWVALAPPSLHGKVDAESF 521

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  211 bits (536), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 142/453 (31%), Positives = 217/453 (47%), Gaps = 20/453 (4%)

Query: 68  SEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLL 127
           +EFD  H G+  K+AL+ RH+S+                                 +GL+
Sbjct: 34  NEFD-PHSGV--KRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGFGIIGLV 90

Query: 128 VFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVI 186
            F +M  +GE+    P  G F + + R+    L    GYAY+  ++ ++ N+    + ++
Sbjct: 91  CFSIMESIGELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTISSIL 150

Query: 187 QYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXX 246
           Q+W  +  +    +  I     +    +GV  FGE EY+++  KI  +            
Sbjct: 151 QFWGPQVPIYG--YTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMS 208

Query: 247 XXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSE 306
              P    +GF+YWKNPGA              F   A VFV     Y GTE   +  +E
Sbjct: 209 GGIPGKPPIGFQYWKNPGALSH----------GFRGIAVVFVFCSTFYSGTESVALAATE 258

Query: 307 CKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAI 366
            +NPRKAVP A++ T +RI++ YL   F  G+ VP+NDP L             P  +A+
Sbjct: 259 SRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTL----GAQTKSLKSPISIAL 314

Query: 367 VNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWS 426
             AG     H++NA IL+   SA NS LY+ SR+L  LA +  APRI A T+K+GVP  +
Sbjct: 315 SRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPA 374

Query: 427 LLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKS 486
           L+V     L++ MNVS G+S  + Y VN   +   + W +I IT++RF KA+  QG   S
Sbjct: 375 LIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLS 434

Query: 487 TLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFL 519
            L Y++   P+   FSL   I + LI+ + + +
Sbjct: 435 ELPYRALFYPWTTIFSLAANIFLALIQGWTSLV 467

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  212 bits (539), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 137/447 (30%), Positives = 215/447 (48%), Gaps = 20/447 (4%)

Query: 70  FDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVF 129
            DG      LK+ L+ARH+ M                                  G  + 
Sbjct: 76  LDGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIV 135

Query: 130 FVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQY 188
             +  LGE+    P+ G F +YSTR+ DP++ F +   Y+ +++ ++P ++ A A+ IQY
Sbjct: 136 GTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQY 195

Query: 189 WVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXX 248
           W     ++P VW+ I    I++IN  G R FGE E+  S++K+  +              
Sbjct: 196 W--NQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGG 253

Query: 249 XPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECK 308
            P+H+ +G +YW +PG               F    SV V+A ++  GTE+  +   E  
Sbjct: 254 GPDHDFVGARYWHDPGCLSH----------GFPGVLSVLVVASYSLGGTEMVCLASGE-T 302

Query: 309 NPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVN 368
           NPR+ +P AIK T +RI+ F+LIS+ L+G  VP+ +P L+            PFV+AI  
Sbjct: 303 NPRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSSVNNS----PFVIAIKL 357

Query: 369 AGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLL 428
             I  LP I+NA ILI + S  NS ++ +SR+L  +A     P+ F   ++ G P   +L
Sbjct: 358 HHIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGIL 417

Query: 429 VGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTL 488
              LF LLA++  SS   EVF + +    +   + W+SI I++IRF  A + QG     L
Sbjct: 418 TNSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDEL 477

Query: 489 AYQSPLQPYGAWFSLFFCILIGLIKNF 515
            + S +  +G+ +S     LI LI  F
Sbjct: 478 EFVSAVGMWGSAYSALINSLI-LIAQF 503

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  211 bits (538), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 119/387 (30%), Positives = 205/387 (52%), Gaps = 15/387 (3%)

Query: 127 LVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALV 185
           ++  +   LGE+A   P+ G + +Y+ R+ D + GFA  + Y+ +  +++P ++ A ++ 
Sbjct: 131 MILIMCLSLGELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVT 190

Query: 186 IQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXX 245
           + YW D D      ++ +  V I++IN  GVR FGE E   S +K+  +           
Sbjct: 191 VGYW-DTDPKYKLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLI 249

Query: 246 XXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVS 305
               P+HEV+G KYW +PG F   + +      +F    SVFV A F++ G+EL G+  +
Sbjct: 250 SGGGPDHEVIGGKYWNDPGPFVGNAPS-----DKFKGVCSVFVTAAFSFAGSELIGLAAA 304

Query: 306 ECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVA 365
           E + PRK++PKA K   +RI +FY++S+ ++G+ VP N+  L+            PFV+A
Sbjct: 305 ETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHS--PFVIA 362

Query: 366 IVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYW 425
           +    I VLP I+N  IL  V S  NS +Y +SR++  LA     P+IF   +++G P +
Sbjct: 363 MDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLF 422

Query: 426 SLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDK 485
           ++    LF LL ++  +    E+F + +    +    +W++I + ++RF  A + QG   
Sbjct: 423 AICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTT 482

Query: 486 STLAYQSPLQPYGAWFSLFFCILIGLI 512
           + L++ SP    G+      C  +GLI
Sbjct: 483 NELSFTSPTGFIGS------CYAVGLI 503

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  211 bits (538), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 127/434 (29%), Positives = 216/434 (49%), Gaps = 11/434 (2%)

Query: 78  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGE 137
           RLKK++++RHV M                                 V  + +F++   GE
Sbjct: 85  RLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGE 144

Query: 138 MAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKV 195
           M    P     F +Y++ +   + GFA  + +  ++  ++P +L   ++ I+YW   DK+
Sbjct: 145 MGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYW--NDKI 202

Query: 196 NPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVL 255
           N  V+I I  V ++ I+F GV+ +GE E+  S+ KI ++                    +
Sbjct: 203 NSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYI 262

Query: 256 GFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVP 315
           G KYW++PG+F E + A      RF     + V A F++ G EL  + ++E  NPRK+ P
Sbjct: 263 GGKYWRDPGSFAEGNGAT-----RFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTP 317

Query: 316 KAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLP 375
            A K ++YRI++ YL+++ L+G  VP N+  L+            P+V+A     + V+P
Sbjct: 318 VAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHAS--PYVLAASIHKVRVVP 375

Query: 376 HIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFAL 435
           HI+NA ILI V S ANS LY A R +  LA    AP+     +++G P  +L V  L  +
Sbjct: 376 HIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGV 435

Query: 436 LAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQ 495
           + ++  S    + FT+      +  L +W  I++++IRF KA +VQG     + Y++   
Sbjct: 436 IGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTG 495

Query: 496 PYGAWFSLFFCILI 509
            +G+++ +FF IL+
Sbjct: 496 IWGSYYGVFFNILV 509

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  211 bits (537), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 159/565 (28%), Positives = 254/565 (44%), Gaps = 37/565 (6%)

Query: 17  DEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITS--------GHGSDVKNVVTHTS 68
            E IEK  L   D          ++DGQ  S+   +T+        G G DV       +
Sbjct: 22  SESIEKVSLPASD--------YQYHDGQVLSRFQRLTNSFKRAGEHGRGGDVDAEGQPVA 73

Query: 69  EFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLV 128
             + K     LK+ + +RH+ M                                 +G  +
Sbjct: 74  PRETK-----LKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCI 128

Query: 129 FFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVI 186
           + ++   GEMA +Y  L G F +Y +   DPALGF+V + Y  ++  ++P +L    + I
Sbjct: 129 YCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITI 188

Query: 187 QYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXX 246
           +YW     VNP V++ I  V  + +N  G R + E E++ +  K+ ++            
Sbjct: 189 KYWTT--AVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNC 246

Query: 247 XXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSE 306
               N   LG KYW +PGA   Y T        F    +  V A FA+  TE   +  +E
Sbjct: 247 GGAGNDGYLGGKYWHDPGAL--YGTKPIH---HFKGIIATMVTAAFAFGATEFIALTAAE 301

Query: 307 CKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAI 366
             NPR+A+P A K  +YR+++ +L  I LLG  VP+N   L+            P+V+AI
Sbjct: 302 QANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHAS--PYVIAI 359

Query: 367 VNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWS 426
            + G+ V+PH +NA IL+ V S  NS  Y +SR L  L+  + AP      +++G P  +
Sbjct: 360 ASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRA 419

Query: 427 LLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKS 486
           +LV  +F L+A++  S     VFT+ +    +  L +WI I +++IRF KA  VQG    
Sbjct: 420 MLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLG 479

Query: 487 TLAYQSPLQPYGAWFS--LFFCILIGLIKNFPAFLG-DTFDYKSFXXXXXXXXXXXXXXX 543
            L Y+S     G++++  +  C+L G      A +G D  D  +F               
Sbjct: 480 ELGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYF 539

Query: 544 XXKLWYK--TKIIPSEEVDLVSFKE 566
             ++W +     IP E++DLVS ++
Sbjct: 540 GYRVWKRDWKLYIPLEQIDLVSHRK 564

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  211 bits (537), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 131/432 (30%), Positives = 209/432 (48%), Gaps = 10/432 (2%)

Query: 80  KKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMA 139
           KK +++RHV M                                 V  + +F++   GEMA
Sbjct: 94  KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMA 153

Query: 140 AYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNP 197
              P     F +Y++ +     GFA  + +  ++  ++P +L   A+ I+YW     ++P
Sbjct: 154 VTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYW--NTSIDP 211

Query: 198 GVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGF 257
            V++ I  V ++ I+F GV+ +GE E+  +A KI ++                    +G 
Sbjct: 212 DVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGG 271

Query: 258 KYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKA 317
           KYW +PGAF     A +    RF       V A F+Y G EL  + V++ KNPRK+ P A
Sbjct: 272 KYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAA 326

Query: 318 IKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHI 377
            K  +YRI+V YL+++ L+G  VP N   L+            P+V+A    GI V+PHI
Sbjct: 327 AKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHAS-PYVLAASIHGIKVVPHI 385

Query: 378 MNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLA 437
           +NA ILI + S ANS LY   R L  LA    APR  +  +++G P  +LL+  L  ++ 
Sbjct: 386 INAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIG 445

Query: 438 YMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPY 497
           +   S    EVFT+      +  L +W SI+ ++IRF +A ++Q     TL Y++    +
Sbjct: 446 FAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLW 505

Query: 498 GAWFSLFFCILI 509
           G++F + F IL+
Sbjct: 506 GSYFGVGFNILV 517

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  210 bits (534), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 135/521 (25%), Positives = 239/521 (45%), Gaps = 27/521 (5%)

Query: 55  GHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXX 114
           G   DVK +     E        ++KK++++RH+ M                        
Sbjct: 49  GESEDVKELKGENEECGA---ATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGP 105

Query: 115 XXXXXXXXFVGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYW 172
                      ++++ ++   GE+   Y  + G +T+YS+   DPALGF+V + Y  ++ 
Sbjct: 106 AGLVIGYAVASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWM 165

Query: 173 IIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKIT 232
            ++P QL   A+ ++YW +    NP +++ +  V I+ IN  G + + E E+  +  K+ 
Sbjct: 166 TVLPLQLVTAAMTVRYWTN---ANPDIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVL 222

Query: 233 VMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALF 292
           ++                    +G KYW +PG+F        G KG       VF  A F
Sbjct: 223 MIAGFVILGIAINCGGAGTSGYIGAKYWHSPGSFA------AGFKG----VCYVFCYAAF 272

Query: 293 AYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXX 352
           +Y G E+  +  SE +NPRK++P A K  +YRI++ Y+++  ++   VP+N   L+    
Sbjct: 273 SYGGIEVMVLTASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSG 332

Query: 353 XXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPR 412
                   P V+A+ + G+ ++PHI+NA ILI V S  NS +Y A R L  L+    AP+
Sbjct: 333 ESASHAS-PLVIAVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPK 391

Query: 413 IFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYI 472
                ++QG P     + +L AL+A++  S    ++F + +    +  +  W SI ++++
Sbjct: 392 FLNYVDRQGRPLICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHV 451

Query: 473 RFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF-----PAFLGDTFDYKS 527
           RF  A   QG+    + Y+S    +G+WF++   +L+ LI  F     P       + ++
Sbjct: 452 RFRDAMHAQGLSLGQIGYKSQTGYWGSWFAIVISVLV-LIAQFWVAIAPIGEEGRLNAET 510

Query: 528 FXXXXXXXXXXXXXXXXXKLWYK--TKIIPSEEVDLVSFKE 566
           F                 K+++K     IP+ EVDL S + 
Sbjct: 511 FFQNYLAFPILLGAYFGYKVYHKDWRLCIPASEVDLSSHRN 551

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  210 bits (535), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 139/519 (26%), Positives = 247/519 (47%), Gaps = 20/519 (3%)

Query: 1   MAEKVYLDAQLSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDV 60
           M+E + + +++ + +T+ ++    L+ + N     S        S+   +G+        
Sbjct: 1   MSEPIVMSSKMEK-NTEFEVTDSPLYNNFNTSTTASLSPEVKEHSEESRNGLVHRFVDSF 59

Query: 61  KNVVTHTSEFDGK-HDGIR-------LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXX 112
           +   +   E +    DG R       LKK++++RHV M                      
Sbjct: 60  RRAESQCLEENNDLEDGTRPMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLA 119

Query: 113 XXXXXXXXXXFVGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFK 170
                      V  + +F++   GEM  AY  L G F +Y++ +   + GFA  + +  +
Sbjct: 120 GPGSLVIGYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQ 179

Query: 171 YWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVK 230
           +  ++P +L   ++ I+YW   D +N  V+I I  V ++ I+F GV+ +GE E+  ++ K
Sbjct: 180 WLTVLPLELITSSMTIKYW--NDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCK 237

Query: 231 ITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLA 290
           I ++                    +G KYW++PG+F + S A      RF     + V A
Sbjct: 238 ILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFADGSNAT-----RFKGICFILVTA 292

Query: 291 LFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXX 350
            F++ G EL  + ++E  N RK+ P A K ++YRI++ YL+++ L+G  VP N+  L+  
Sbjct: 293 YFSFGGIELFVLSINEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGS 352

Query: 351 XXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKA 410
                     P+V+A     + V+PHI+NA ILI V S ANS LY A R +  LA    A
Sbjct: 353 GSAATHAS--PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYA 410

Query: 411 PRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILIT 470
           PR     +++G P  +L V  L  ++ ++  S    + FT+      +  + +W  I+++
Sbjct: 411 PRFLNYIDREGRPLRALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLS 470

Query: 471 YIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
           +IRF KA +VQG     L Y++    +G+++ +FF IL+
Sbjct: 471 HIRFRKAMKVQGRSLGELGYKANTGIWGSYYGVFFNILV 509

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  210 bits (534), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 141/480 (29%), Positives = 225/480 (46%), Gaps = 25/480 (5%)

Query: 42  DGQSDSKVHGITSGHGSDVKNVVTHTSE-----FDGKHDGIRLKKALEARHVSMXXXXXX 96
           DG   +        H    +N++    +      DG      LKK+L+ARH+ M      
Sbjct: 31  DGSEKTSTPSTVVNHRGTKRNIIQRMVDSFKPPLDGSFHSDNLKKSLKARHLIMIAIGGS 90

Query: 97  XXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYA 155
                                       G  +   +  LGE+    P+ G F  Y TR+ 
Sbjct: 91  IGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFL 150

Query: 156 DPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLG 215
           +P++ F V   Y+ ++  ++P ++ A A+ ++YW     V P  W+ I    I  +N LG
Sbjct: 151 EPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYW--GSSVPPVAWVAIFYAFIALVNLLG 208

Query: 216 VRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITG 275
           VR FGE E+  S +K+  +               P HE +G KYW +PG          G
Sbjct: 209 VRGFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPKHEFVGAKYWSDPGPLAN------G 262

Query: 276 AKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFL 335
            KG     A+VFV+A ++  GTE+  +   E  +P K +P AIK   +RI+ F+L+S+ L
Sbjct: 263 FKG----VAAVFVIASYSLGGTEMACLASGE-TDP-KELPSAIKQVFWRIVFFFLVSLTL 316

Query: 336 LGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLY 395
           +G  VP+ +  L+            PFV+AI   GI  LP ++NA IL+ + S  NS ++
Sbjct: 317 VGFLVPYTNENLMGGSSVDNS----PFVIAIRLHGIKALPSVVNAVILVSLLSVGNSCIF 372

Query: 396 VASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNC 455
            +SR+L  +A     PRIF   ++ G P   +L  + F LLA++  SS S +VFT+ +  
Sbjct: 373 ASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFGLLAFLVKSSSSDDVFTWLMAI 432

Query: 456 VSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF 515
             +   + W+SI +++IRF  A + QG+    L + S +  YG+ +S    +LI L+  F
Sbjct: 433 AGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAVGVYGSVYSATINVLI-LVAQF 491

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  210 bits (534), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 217/456 (47%), Gaps = 15/456 (3%)

Query: 56  HGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXX 115
            G D++     T   DG     RL++++  RHV+M                         
Sbjct: 61  QGGDLETASVQTDLTDG-----RLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPG 115

Query: 116 XXXXXXXFVGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWI 173
                   V ++ + +M   GEMA AY  + G F +YS+ +     GFA  + Y  ++  
Sbjct: 116 GLIIGYAAVSVVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLT 175

Query: 174 IVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITV 233
           + P +L   +L I+YW D   VN  V+I I  V I+ I+F G R +GE E+     K+ +
Sbjct: 176 VFPLELITASLTIKYWTD--SVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLM 233

Query: 234 MXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFA 293
           +                N   +G +YW +PGAF     A+     +F  F  V V   F+
Sbjct: 234 IAGFVILAIVINCGGAGNSGYIGARYWHDPGAF-----AVGDPASKFKGFCYVLVTGYFS 288

Query: 294 YLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXX 353
           Y GTEL  + V+E  +PR+A+  A K  +YRI+V Y++++ L+G  VP     L+     
Sbjct: 289 YGGTELYAMTVNEQSSPRRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGK 348

Query: 354 XXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRI 413
                  P+V+A+   G+ V+PHI+NA ILI V S  NS +Y   R L  LA    AP+ 
Sbjct: 349 SATHAS-PYVLAVSLHGVKVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKF 407

Query: 414 FAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIR 473
            A  ++ G P  +L+   +  LLA++  S    +VFT+      +  L +W +IL+++IR
Sbjct: 408 LAYIDRAGRPLMALIACSVIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIR 467

Query: 474 FDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
           F +A +  G   S L Y+S    +G+ + + F IL+
Sbjct: 468 FRQAMKYHGYSLSQLGYKSITGLWGSIYGVCFNILV 503

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  211 bits (537), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 137/445 (30%), Positives = 222/445 (49%), Gaps = 13/445 (2%)

Query: 69  EFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLV 128
           E +GK     LKK+++ RHV M                                 +G  +
Sbjct: 115 ELEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCI 174

Query: 129 FFVMSCLGEMAAYIP--LDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVI 186
           + ++   GEMA      + GF +Y +    P LGFAV + Y  ++  + P +L   ++ I
Sbjct: 175 YCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTI 234

Query: 187 QYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXX 246
           +YW    KVNP V++ I    II IN  G R + E E++ +  K+ ++            
Sbjct: 235 KYWTT--KVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINC 292

Query: 247 XXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSE 306
               N   +G KYW +PGAF+        A  RF   A+  V A FA+ G+E   +  SE
Sbjct: 293 GGAGNDGYIGGKYWHDPGAFRG-----DKAIDRFKGVAATLVTAAFAFGGSEFIALTASE 347

Query: 307 CKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAI 366
             NPRKA+P A K  +YRII+ +L SI ++G  VP+N   L+            P+V+AI
Sbjct: 348 QSNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKAS--PYVIAI 405

Query: 367 VNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWS 426
            + G+ V+PH +NA IL+ V S  NS  Y +SR L  L+    AP+ F   +++G P  +
Sbjct: 406 SSHGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARA 465

Query: 427 LLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKS 486
           +++G LFA++A+   SS   +VFT+ +    +  + +W +I +++IRF +A  VQG    
Sbjct: 466 MVIGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLG 525

Query: 487 TLAYQSPLQPYGAWFS--LFFCILI 509
            + ++S L  +G++++  + F +LI
Sbjct: 526 EIGFKSELGVWGSYYAAGMMFLVLI 550

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  209 bits (533), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 130/439 (29%), Positives = 218/439 (49%), Gaps = 18/439 (4%)

Query: 79  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEM 138
           LK+ L+ RH+ M                                  G +V+ V+  +GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 139 AAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNP 197
              +P+ G + SY +R+ DP+ GFA+ Y YL    + +P ++ A ++ + YW    K   
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 198 GVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHE-VLG 256
           G ++ +  V ++ INFLGV+ +GE E+  S +K+  +                N+   +G
Sbjct: 204 G-FVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIG 262

Query: 257 FKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPK 316
            KYW NPG F        G KG    FA++FV + F++ G+E+  +  +E KNPR+ +PK
Sbjct: 263 TKYWHNPGGFAH------GFKG----FAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPK 312

Query: 317 AIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPH 376
           A K   +RI +FYLIS+ L+G  VP+ +  L             PFV+AI  AGI  LP 
Sbjct: 313 AAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASAS--PFVIAIKEAGISGLPS 370

Query: 377 IMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALL 436
           ++N  IL+ V S  N+ ++ +SR+   LA     P+ FA  +++G P   L++ ++F LL
Sbjct: 371 VINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLL 430

Query: 437 AYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQP 496
           ++++ S     VF + +    +    +W SI + ++RF +  R QG     LA+++    
Sbjct: 431 SFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQT-- 488

Query: 497 YGAWFSLFFCILIGLIKNF 515
            G W S++   LI ++  F
Sbjct: 489 -GIWGSIYGITLISVVLCF 506

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  210 bits (534), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 134/443 (30%), Positives = 231/443 (52%), Gaps = 13/443 (2%)

Query: 124 VGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
            G ++F ++  LGE+A   P+ G F +Y+TR+ D + GFA  + Y+F++ + +P ++ A 
Sbjct: 133 TGTMIFTMVMALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAA 192

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           ++ + YW    +   G ++ +  + ++ IN  GVR +GE E+  S +K+  +        
Sbjct: 193 SITVDYWETPVRYTDG-FVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGI 251

Query: 243 XXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGI 302
                  P    +G +YW +PGAF  +S        RF  F SVFV A F++ G+EL GI
Sbjct: 252 ILVCGGGPVGGYVGGRYWHDPGAFAGHSPG-----RRFKGFCSVFVTAAFSFAGSELVGI 306

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPF 362
             +E KNPRK+VP+A K   +RI++FY++ + L+G+ VP+ DP L+            PF
Sbjct: 307 ASAESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASAS--PF 364

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGV 422
           V+AIV  GI  LP ++N  ILI V S  NS +Y  SR+L  L+     P+  A  +++G 
Sbjct: 365 VIAIVTHGISGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGR 424

Query: 423 PYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQG 482
           P   + +   F L+A++  S+   ++F + +    I   L+W SI   +IRF  A +V G
Sbjct: 425 PLVGIAICSGFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNG 484

Query: 483 IDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAF--LGDTFDYKSFXXXXXXXXXXXX 540
                L ++SP+   G+++ +   +L+ + + + A   +G + +   F            
Sbjct: 485 RSDDELPFKSPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLA 544

Query: 541 XXXXXKLWYKT--KIIPSEEVDL 561
                KLW +    +IP +++D+
Sbjct: 545 FYIAHKLWKRNWKLLIPLKDIDI 567

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  209 bits (532), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 155/569 (27%), Positives = 264/569 (46%), Gaps = 37/569 (6%)

Query: 17  DEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKV--HGITSGHGSDVKNVVTHTSEFDGKH 74
            +D+EK      +   ++R  +       +S++     T+  G   + + +     DG  
Sbjct: 4   QKDVEKAASELSNTSAVQRVLKKRSSVLEESRLLEESRTNKRGLVRRCIDSFKPPVDGSF 63

Query: 75  DGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSC 134
           D   LK+ L++RH+ M                                  G  +   +  
Sbjct: 64  DPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHG 123

Query: 135 LGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRD 193
           LGE+    P+ G F +YSTR+ DP++ F V   Y+ +++ ++P ++ A A+ +++W    
Sbjct: 124 LGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTT-- 181

Query: 194 KVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHE 253
            V+P VW+ +    II+IN  GVR+FG+ ++  S +K+  +               P HE
Sbjct: 182 SVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHE 241

Query: 254 VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKA 313
            +G +YW +PGA         G KG     A+V V A ++  G+E+  +   E  +P K 
Sbjct: 242 FIGARYWHDPGALAN------GFKG----VAAVMVTASYSLGGSEMTCLASGET-DP-KE 289

Query: 314 VPKAIKLTMYRIIVFYLISIFLLGMCVPF-NDPLLIXXXXXXXXXXXXPFVVAIVNAGIP 372
           +P AIK   +RII F+L+S+ L+G  VP+ ND LL             PFV+AI    I 
Sbjct: 290 IPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLL-----GGSNVNNSPFVIAIKMHNIR 344

Query: 373 VLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVL 432
           VLPHI+N  IL+ + S  NS ++ +SR+L  +A     PRIF   ++ G P   +L   L
Sbjct: 345 VLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSL 404

Query: 433 FALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQS 492
           F LLA++  SS +  VFT+ +    +   + W+SI +++IRF  A + QG     L + S
Sbjct: 405 FGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVS 464

Query: 493 PLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYK-------SFXXXXXXXXXXXXXXXXX 545
            +  +G+ +S    +++ L+  F   L     +K       +F                 
Sbjct: 465 AVGMWGSVYSGVMNVVV-LVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAH 523

Query: 546 KLWYKT------KIIPSEEVDLVSFKEAV 568
           K++Y++      KI+P  E+DL S ++ +
Sbjct: 524 KIYYRSTTGQWWKILPLAEIDLESGRKNI 552

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  207 bits (528), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 149/451 (33%), Positives = 214/451 (47%), Gaps = 19/451 (4%)

Query: 79  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEM 138
           +K+AL+ RH+S+                                 +G++ F VM  +GEM
Sbjct: 44  VKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEM 103

Query: 139 AAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNP 197
               P   GF++ S R+   AL    GYAY+  ++ ++ N+    + ++Q+W    +V  
Sbjct: 104 ITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFW--GPQVPL 161

Query: 198 GVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGF 257
             +I I  VA      LGV  FGE EY+++  KI  +                N    GF
Sbjct: 162 YGYILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFGF 221

Query: 258 KYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKA 317
            YW NPGA  +      G KG     A VFV     Y GTE   +  +E +NP KAVP A
Sbjct: 222 HYWNNPGALAD------GFKG----IAVVFVFCSSFYSGTESVALAATESRNPGKAVPIA 271

Query: 318 IKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHI 377
           IK T +RII+ YL      G  VP+ND  L             P  +AI  AG     H+
Sbjct: 272 IKQTFWRIIIVYLGIAVFYGATVPYNDTSL----GAHTKALKSPIAIAITRAGWEGGVHL 327

Query: 378 MNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLA 437
           +NA ILI   SA N  LY+ SR+L  LA +  AP+    T+K+GVP  ++ +     L++
Sbjct: 328 VNAFILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVS 387

Query: 438 YMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPY 497
            MNVS G+S  ++Y VN   +   + W  I +T++RF KA+ +QG   S L Y+S L P+
Sbjct: 388 LMNVSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPW 447

Query: 498 GAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
           G  FSL   I +GLI+ +  F+   F  K F
Sbjct: 448 GPIFSLAANIFLGLIQGWTTFV--PFSAKDF 476

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  209 bits (531), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 127/445 (28%), Positives = 219/445 (49%), Gaps = 18/445 (4%)

Query: 74  HDGIR-------LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGL 126
            DG R       LKK++++RHV M                                 V  
Sbjct: 74  EDGTRSMRSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSF 133

Query: 127 LVFFVMSCLGEMAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
           + +F++   GEM    P     F +Y++ +   + GFA  + +  ++  ++P +L   ++
Sbjct: 134 VTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSM 193

Query: 185 VIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXX 244
            I+YW   D +N  V+I I  V ++ I+F GV+ +GE E+  ++ KI ++          
Sbjct: 194 TIKYW--NDTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVII 251

Query: 245 XXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVV 304
                     +G +YW+NPG+F + S+A      RF     + V A F++ G EL  + +
Sbjct: 252 NCGGAGVDGYIGGEYWRNPGSFADGSSAT-----RFKGICFILVTAYFSFGGIELFVLSI 306

Query: 305 SECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVV 364
           +E  NPRK+ P A K ++YRI++ YL+++ L+G  VP ++  L+            P+V+
Sbjct: 307 NEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGSSATHAS--PYVL 364

Query: 365 AIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPY 424
           A    G+ V+PHI+NA ILI V S ANS LY A R +  LA    AP+     +++G P 
Sbjct: 365 AASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPL 424

Query: 425 WSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGID 484
            +L+V     L+ ++  SS   + FT+      +  + +W  I++++IRF KA +VQG  
Sbjct: 425 RALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRS 484

Query: 485 KSTLAYQSPLQPYGAWFSLFFCILI 509
              + Y+S    +G+++ + F IL+
Sbjct: 485 LDEVGYKSNTGIWGSYYGVIFNILV 509

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  206 bits (525), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 138/446 (30%), Positives = 218/446 (48%), Gaps = 20/446 (4%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           +G  D   LK++L++RH+ M                                  G  +  
Sbjct: 69  NGSFDPDSLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVG 128

Query: 131 VMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
            +  LGE+    P+ G F  Y TR+ DP+L F V   Y+ +++ ++P ++ A A+ IQ+W
Sbjct: 129 TIHGLGEITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFW 188

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
                ++P VW+ I  V I+ IN  GVR FGE E+  S++K+  +               
Sbjct: 189 --NTSIDPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGG 246

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
           P HE +G +YW +PGA         G KG     ASVFV A ++  G+E+  +   E  +
Sbjct: 247 PTHEYVGARYWHDPGALAH------GFKG----VASVFVTASYSLGGSEMACLASGE-TD 295

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           P K +P AIK   +RII F+L+S+ L+G  VP+ +  L+            PFV+A    
Sbjct: 296 P-KELPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSVNNS----PFVIACNLY 350

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
            I VLP I+NA IL+ + S  NS ++ +SR+L  +A     P+IF   ++ G P   ++ 
Sbjct: 351 HIKVLPSIINAVILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIIT 410

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
             LF LLA++  SS  SEVF + +    +   + W+SI +++IRF  A + Q      L 
Sbjct: 411 NSLFGLLAFLVKSSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELE 470

Query: 490 YQSPLQPYGAWFSLFFCILIGLIKNF 515
           + S +  +G+ +S    +LI LI  F
Sbjct: 471 FVSAVGIWGSVYSAVVNVLI-LIAQF 495

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  207 bits (528), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 139/449 (30%), Positives = 219/449 (48%), Gaps = 18/449 (4%)

Query: 126 LLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
           +L   V +C     AY  L G + +Y T   D   GFAV   Y  ++ I++P +L   ++
Sbjct: 119 MLYCVVQACCELGVAYATLPGNYNAYPTFLVDRGFGFAVALVYGLQWAIVLPLELVTASM 178

Query: 185 VIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXX 244
            I+YW +   VNP V++ I  + I+ I+F G R + E E+  + +K+ +M          
Sbjct: 179 TIKYWTE--SVNPDVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLKVLLMAGFIIMGISL 236

Query: 245 XXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVV 304
                     +G KYW NPG F     +I   KG      SV+V + FAY G+E   +  
Sbjct: 237 NCGAS-KLGYIGAKYWSNPGTFAG-ERSINHLKG----ICSVWVQSAFAYGGSEFIALTA 290

Query: 305 SECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVV 364
           +E  NPR++VP A K  +YR++V +LI I L+   VP+    L+            PFV+
Sbjct: 291 AEQANPRESVPSATKRWLYRVVVVFLIPIALICFLVPYTSDQLLSSSGASASHAS-PFVI 349

Query: 365 AIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPY 424
           A    G+ ++PHI+NA IL  V S  NS +Y A R L  LA +   P+IF   ++ G P 
Sbjct: 350 AAAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRILLSLAENGLCPKIFTYVDRAGRPL 409

Query: 425 WSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGID 484
            +LL   +F LL+++  S     VFT+      +  L +W SI +++IRF  A +VQG  
Sbjct: 410 ATLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHIRFRAAMKVQGRS 469

Query: 485 KSTLAYQSPLQPYGAWFSLFFCILIGLIKNF-----PAFLGDTFDYKSFXXXXXXXXXXX 539
              L Y S     G+++++FF I++ L+  F     P       D +SF           
Sbjct: 470 LGELGYTSTTGAIGSYYAVFFNIVV-LVAQFWIAIAPIDKHGELDAESFFKNYLAFAVLV 528

Query: 540 XXXXXXKLWYK--TKIIPSEEVDLVSFKE 566
                 K+WY+    +IP +++DL + ++
Sbjct: 529 LFYVGYKIWYREVQLLIPVDKIDLETHRQ 557

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  207 bits (527), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 126/405 (31%), Positives = 203/405 (50%), Gaps = 25/405 (6%)

Query: 123 FVGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
            VG  +F V+    E+A   P+ G + S+ +R+ D +LGF V   Y   + ++ P++L  
Sbjct: 113 LVGTSMFCVIQSAAELACQFPVSGSYASHVSRFVDESLGFTVATNYTLAWLVLFPSELIG 172

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
            +L I YW     +NP VW++I LV ++ IN  GVR F E E+ +S +K+  +       
Sbjct: 173 CSLTISYW--NSSINPAVWVSIFLVFVLWINLFGVRIFAETEFILSIIKVLAIIIFIIIG 230

Query: 242 XXXXXXXXPN-HEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELC 300
                   P+    +G KYW +PG F         AK  F +    FV A F++ GTE+ 
Sbjct: 231 IVLIAGGGPDPGGYIGTKYWHDPGPF---------AKPVFKNLCQTFVAAAFSFGGTEMV 281

Query: 301 GIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXX 360
            +  +E KN   ++ +A K T YRI +FY+ ++ ++G  VP+NDP L+            
Sbjct: 282 LLTGTESKNV-SSIARAAKGTFYRIAIFYVTTVVVIGCLVPYNDPRLLSASSSEDISAS- 339

Query: 361 PFVVAIVNAGI--PVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTN 418
           PFV+A+ N G     + H MNA IL+ V S  NS +Y +SR +  L    + P+IF   +
Sbjct: 340 PFVIALSNTGSMGAKVSHFMNAVILVAVVSVCNSTVYASSRLIQALGTAGQLPKIFGYMD 399

Query: 419 KQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAF 478
           ++G P   + V   F LL ++  +   SEVFT+     S+   ++W SI +  +R+  A 
Sbjct: 400 RKGRPLVGIAVSATFGLLGFLVATKKQSEVFTWLFALCSVAAFVTWFSICLAQVRYRMAM 459

Query: 479 RVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTF 523
           R +     ++AY+S L  +G         ++G I NF    G+ +
Sbjct: 460 RARKRSLDSIAYKSILGIWGG--------VVGCIVNFLLVAGEVY 496

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  206 bits (523), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 128/390 (32%), Positives = 198/390 (50%), Gaps = 20/390 (5%)

Query: 123 FVGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
            VG  +  V+ C  E++   P+ G +  +++R+ DP++GF++G  YL  + I  P++L  
Sbjct: 112 LVGASMLCVVQCGAELSCQYPVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVG 171

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
            +L I YW     VNP  W+ I  V  + +N  G R F E E+Y+S  KI  +       
Sbjct: 172 CSLTISYWAP--SVNPAAWVAIAFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIG 229

Query: 242 XXXXXXXXPNHE-VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELC 300
                   P+    +G KYW +PG+F         A   F +  + FV A +++ GTE+ 
Sbjct: 230 IVLIAGGGPDSTGYIGTKYWHDPGSF---------AVPVFKNLCNTFVSAAYSFSGTEMV 280

Query: 301 GIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXX 360
            +  +E ++   +V +A K T +RII+FY++++ ++G  VP+NDP LI            
Sbjct: 281 VLTSTEARSV-SSVSRAAKGTFWRIIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITAS- 338

Query: 361 PFVVAIVNAGI--PVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTN 418
           PFV+A+ N G     + H MNA ILI VFS  NS +Y +SR + GLA   + P+I A  +
Sbjct: 339 PFVIALSNTGAMGTRVSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMD 398

Query: 419 KQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAF 478
           + G P   + +   F LL ++ VS     VFT+     SI    +W  I    +RF  A 
Sbjct: 399 RNGRPLVGMAICGAFGLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAM 458

Query: 479 RVQGIDKSTLAYQSPLQPYGAWFSLFFCIL 508
           + QG  K  + Y+S L  YG    +F CIL
Sbjct: 459 KAQGRSKDDIIYRSTLGIYGG---IFGCIL 485

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  207 bits (528), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 137/450 (30%), Positives = 218/450 (48%), Gaps = 18/450 (4%)

Query: 124 VGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
           +G  ++ ++   GEMA AY  L G F ++ +   DP   FAV + Y  ++  + P +L  
Sbjct: 204 MGTCIYCIIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 263

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
            ++ IQYW    KV+P V++ I  V I+ INF G + + E E+  +  K+ ++       
Sbjct: 264 ASMTIQYWTT--KVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILA 321

Query: 242 XXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCG 301
                        +G KYW +PGAF+   T I     RF      FV A FA+  TE   
Sbjct: 322 ICIDTGAAGTDGYIGAKYWNDPGAFRG-QTKIE----RFKGVMDTFVTAAFAFGATEFIA 376

Query: 302 IVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXP 361
           +  +E  NPRKA+P A K  +YR++V +L +I L+G  VP++   L+            P
Sbjct: 377 LTAAEQSNPRKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKAS--P 434

Query: 362 FVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQG 421
           +V+AI   G+ V  H +NA ILI V S  NS  Y +SR L  LA    AP+IF   +++G
Sbjct: 435 YVLAISLHGVRVAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREG 494

Query: 422 VPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ 481
            P  ++    + A++A+   S   +EVFT+ +    +  L +W +I ++++RF +A +VQ
Sbjct: 495 RPLIAMCCSAVIAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQ 554

Query: 482 GIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFL----GDTFDYKSFXXXXXXXXX 537
           G     + Y S     G+ ++    IL  LI  F   L      T D  SF         
Sbjct: 555 GRSLGEMGYLSQTGILGSLYAAIMMIL-ALIAQFWVALVPMGTHTPDANSFFSNYLAMPI 613

Query: 538 XXXXXXXXKLWYK--TKIIPSEEVDLVSFK 565
                   K+W +     I ++++DL+S +
Sbjct: 614 LIVFYFGYKIWKRDWRLFIRAKDIDLISHR 643

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  206 bits (524), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 142/507 (28%), Positives = 235/507 (46%), Gaps = 24/507 (4%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           + KH+   LK+ +++RH+ M                                 +GL V+ 
Sbjct: 84  NAKHE--NLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYC 141

Query: 131 VMSCLGEMA-AYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQY 188
           V+   GE+A  Y  L  GF +Y +   DPALGFA  + Y  ++  + P +L   ++ I++
Sbjct: 142 VIQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKF 201

Query: 189 WVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXX 248
           W     VNP +++ I  V II INF G R + E E++ ++ K+ +M              
Sbjct: 202 WPGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGA 261

Query: 249 XPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASV---FVLALFAYLGTELCGIVVS 305
                 +G KYW++PG+         G +  F  F  +    V A F+   +E   +  +
Sbjct: 262 VGTSGYIGGKYWRDPGSL--------GGRTHFDHFKGIVATLVNAAFSLGCSEFVALTAA 313

Query: 306 ECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVA 365
           E  NPRK++P A K  +Y+I V +L S+ L+G  VP +   L+            P+V+A
Sbjct: 314 EQANPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVS--PYVIA 371

Query: 366 IVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYW 425
           +   G+ V+P  +NA IL+ V S  NS  Y +SR L+ LA  N AP+IF   ++ G P  
Sbjct: 372 VRMHGVNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLM 431

Query: 426 SLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDK 485
           ++++ +LF  + ++  S    EVF + +    +  L +W +I +++IRF +A  VQG   
Sbjct: 432 AMIISILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYST 491

Query: 486 STLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFL---GDTF-DYKSFXXXXXXXXXXXXX 541
             L +++     G++ S    +L  LI  F   L   G T  D +SF             
Sbjct: 492 DELGFKAQTGIIGSYVSAIMMVL-ALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLF 550

Query: 542 XXXXKLWYK--TKIIPSEEVDLVSFKE 566
               K+W K     I ++++DLVS + 
Sbjct: 551 YFGYKIWNKDWRLFIRADQIDLVSHRR 577

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  206 bits (523), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 135/440 (30%), Positives = 215/440 (48%), Gaps = 19/440 (4%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DG  D   LKK L+ARH+ M                                  G  +  
Sbjct: 78  DGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQIIG 137

Query: 131 VMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
            +  LGE+    P+ G F +YSTR+ DP++ F V   Y+ +++ ++P ++ + A+ +QYW
Sbjct: 138 TIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQYW 197

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
              + ++P VW+ I  V I++IN  GVR FGE E+  S +K+  +               
Sbjct: 198 --NESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGG 255

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
           P+H  +G +YW NPG           A G F    SV V+A ++  GTE+  +   E  +
Sbjct: 256 PDHVYVGSRYWHNPGCL---------ANG-FPGVLSVMVVASYSLGGTEMTCLASGE-TD 304

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           P K +P AIK   +RI+ F+L+S+ L+G  VP+ +  L+            PFV+AI   
Sbjct: 305 P-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSSVDNS----PFVIAIKIH 359

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
            I VLP I+NA ILI + S  NS ++ +SR+L  +A  +  P  F   ++ G P   ++ 
Sbjct: 360 HIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIIT 419

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
             LF LLA++  S   SEVF + +    +   + W+SI +++IRF  A + QG   + L 
Sbjct: 420 NSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELE 479

Query: 490 YQSPLQPYGAWFSLFFCILI 509
           + S +  +G+ +S     LI
Sbjct: 480 FVSAVGIWGSVYSAIINCLI 499

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  205 bits (521), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 132/450 (29%), Positives = 218/450 (48%), Gaps = 18/450 (4%)

Query: 69  EFDGKHDGIR-------LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 121
           E +   DG R       LKKA+++RHV M                               
Sbjct: 36  EENDLEDGTRSIVTKTHLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGY 95

Query: 122 XFVGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQL 179
             V  + +F++   GEMA AY  L G F SY++ +     GFA  + +  ++  + P +L
Sbjct: 96  VLVSFVTYFMIQAAGEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLEL 155

Query: 180 TAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXX 239
              +L ++YW   DK+N  V+I I    ++ I+F GV+ +GE E+  ++ K+ ++     
Sbjct: 156 ITASLTVKYW--NDKINADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFII 213

Query: 240 XXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTEL 299
                          +G KYW +PG+F +    IT    RF     + V A F+Y G EL
Sbjct: 214 LSIVINCGGAGTDGYIGAKYWHDPGSFAD-GPPIT----RFKGVCFILVSAYFSYGGAEL 268

Query: 300 CGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXX 359
             + V+E +NPRK+ P A K ++YRI++ YL ++ L+G  VP N   L+           
Sbjct: 269 FSLSVNEQENPRKSTPAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHAS- 327

Query: 360 XPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNK 419
            P+V+A     + V+PH +NA ILI V S ANS LY A R +  LA    AP+     ++
Sbjct: 328 -PYVLAASLHSVKVVPHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDR 386

Query: 420 QGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFR 479
           +G P   L++  LF ++ +++ SS   EVFT+      +  L +W  I++++IRF +A +
Sbjct: 387 EGRPLRGLILCALFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMK 446

Query: 480 VQGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
             G     + +++    +G+++   F IL+
Sbjct: 447 FNGKSTDEIGFKAVTGIWGSYYGCAFNILV 476

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score =  205 bits (521), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 128/405 (31%), Positives = 201/405 (49%), Gaps = 25/405 (6%)

Query: 123 FVGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
            VG  +  V+ C  E++   P+ G +  +++R+ DP++GF++G  YL  + I  P++L  
Sbjct: 112 LVGASMLCVVQCGAELSCQYPVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVG 171

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
            +L I YW     VNP  W+ I  V  + +N  G R F E E+Y+S  KI  +       
Sbjct: 172 CSLTISYWAP--SVNPAAWVAIAFVLSMLLNMFGARGFAESEFYMSIFKIVALFIFIIIG 229

Query: 242 XXXXXXXXPNHE-VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELC 300
                   P+    +G KYW +PG+F         A   F +  + FV A +++ GTE+ 
Sbjct: 230 IILIAGGGPDSTGYIGTKYWHDPGSF---------APPVFKNLCNTFVSAAYSFSGTEMV 280

Query: 301 GIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXX 360
            +  +E +N   +V +A K T +RI++FY++++ ++G  VP+ND  LI            
Sbjct: 281 VLTSTEARNV-SSVSRAAKGTFWRIVIFYIVTVIIIGCLVPYNDSRLINGSSSEDITAS- 338

Query: 361 PFVVAIVNAGI--PVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTN 418
           PFV+A+ N G     + H MNA ILI VFS  NS +Y +SR + GLA   + PRI A  +
Sbjct: 339 PFVIALSNTGTMGKRVSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPRICAYMD 398

Query: 419 KQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAF 478
           + G P   + +   F LL ++ VS     VFT+     SI    +W  I    +RF  A 
Sbjct: 399 RNGRPLVGMAICGAFGLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAM 458

Query: 479 RVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTF 523
           + QG  K  + Y+S L  YG         ++G I N    +G+ +
Sbjct: 459 KAQGRSKDDIIYRSSLGIYGG--------IVGCILNVLLVIGEIY 495

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  202 bits (515), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 133/433 (30%), Positives = 210/433 (48%), Gaps = 19/433 (4%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DG      LKK+L+ARH+ M                                  G  +  
Sbjct: 65  DGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVG 124

Query: 131 VMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
            +  LGE+    P+ G F  Y TR+ +P++ F V   Y+ ++  ++P ++ A A+ ++YW
Sbjct: 125 TIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYW 184

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
                V+P VW+ I    I  IN +GVR FGE E+  S +K+  +               
Sbjct: 185 --DTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGG 242

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
           P  E +G KYW +PG           A G F   A V V+A ++  GTE+  +   E  +
Sbjct: 243 PKKEFVGAKYWHDPGPL---------ANG-FKGVAGVLVIASYSLGGTEMACLASGE-TD 291

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           P K +P AIK   +RI+ F+L+S+ L+G  VP+ +  L+            PFV+AI   
Sbjct: 292 P-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSSVDNS----PFVIAIRLH 346

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
           GI  LP I+NA IL+ + S  NS ++ +SR+L  +A     PR+F   ++ G P   +L 
Sbjct: 347 GINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILT 406

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
            +LF LLA++  S  + +VFT+ +    +   + W+SI I++IRF  A + QG+D   L 
Sbjct: 407 NLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELE 466

Query: 490 YQSPLQPYGAWFS 502
           + S +  YG+ +S
Sbjct: 467 FVSGVGIYGSVYS 479

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  205 bits (521), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 139/497 (27%), Positives = 238/497 (47%), Gaps = 20/497 (4%)

Query: 42  DGQSDSKVHGITSGHGSDVKNVVTHTSEF-DGK---HDGIRLKKALEARHVSMXXXXXXX 97
           DG  D     I       V+  V ++S+  DG+       +LK+ ++ RHV +       
Sbjct: 31  DGHRDGLFQRIVDSF-KRVEGEVRNSSDLEDGEVTSAHSTKLKQNMKTRHVVLMSLGTGI 89

Query: 98  XXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYA 155
                                    FV ++ + +M   GEMA AY  L G F +YS+ + 
Sbjct: 90  GTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMMQAAGEMAVAYPTLPGNFNAYSSIFI 149

Query: 156 DPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLG 215
               GFA  + +  ++  I+P +L   ++V++YW    K+N  +++ I  + I+ I+F G
Sbjct: 150 SKPFGFATVWLFCIQWTTILPLELITSSIVVKYWTT--KINADIFVLIFYLFILCIHFCG 207

Query: 216 VRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITG 275
            R +GE E+  ++ K+ ++                +   +G KYW  PGAF     A   
Sbjct: 208 ARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDDGYIGGKYWHEPGAF-----AAGS 262

Query: 276 AKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFL 335
              RF   A V V A F+Y G EL  + V+E  NPRKA+P A    +YRI++ Y++++ +
Sbjct: 263 GIDRFKGIAYVLVTAYFSYGGMELYALSVNELPNPRKAIPSACAKGVYRILIIYMLTMVI 322

Query: 336 LGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLY 395
           +G  VP +   L+            P+V+A+   GI ++PHI+NA ILI V S  NS +Y
Sbjct: 323 IGFLVPHDSNKLLGSGSSGVHPS--PYVLALSLHGIKIVPHIINAVILISVISVGNSAMY 380

Query: 396 VASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNC 455
              R L  LA    AP+I    ++QG P  +L++  +F L+A++  S    ++F +    
Sbjct: 381 SGPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICSVFGLIAFVAASKYEEDIFGWLAAI 440

Query: 456 VSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF 515
             +  L +W +I +++ RF +A ++QG    TL Y+S    +G+ +++ F + + + + +
Sbjct: 441 SGLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYRSTTGEWGSLYAVVFNVFVLIAQLW 500

Query: 516 PAFL----GDTFDYKSF 528
            A +    G  F  KS 
Sbjct: 501 VAMIPMDNGGKFSVKSL 517

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  202 bits (515), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 133/433 (30%), Positives = 210/433 (48%), Gaps = 19/433 (4%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DG      LKK+L+ARH+ M                                  G  +  
Sbjct: 65  DGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVG 124

Query: 131 VMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
            +  LGE+    P+ G F  Y TR+ +P++ F V   Y+ ++  ++P ++ A A+ ++YW
Sbjct: 125 TIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYW 184

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
                V+P VW+ I    I  IN +GVR FGE E+  S +K+  +               
Sbjct: 185 --DTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGG 242

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
           P  E +G KYW +PG           A G F   A V V+A ++  GTE+  +   E  +
Sbjct: 243 PKKEFVGAKYWHDPGPL---------ANG-FKGVAGVLVIASYSLGGTEMACLASGE-TD 291

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           P K +P AIK   +RI+ F+L+S+ L+G  VP+ +  L+            PFV+AI   
Sbjct: 292 P-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSSVDNS----PFVIAIRLH 346

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
           GI  LP I+NA IL+ + S  NS ++ +SR+L  +A     PR+F   ++ G P   +L 
Sbjct: 347 GINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILT 406

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
            +LF LLA++  S  + +VFT+ +    +   + W+SI I++IRF  A + QG+D   L 
Sbjct: 407 NLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELE 466

Query: 490 YQSPLQPYGAWFS 502
           + S +  YG+ +S
Sbjct: 467 FVSGVGIYGSVYS 479

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  204 bits (520), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 137/443 (30%), Positives = 217/443 (48%), Gaps = 22/443 (4%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DG      LKK+L++RH+ M                                  G  +  
Sbjct: 70  DGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIVG 129

Query: 131 VMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
            +  LGE+    P+ G F SY+TR+ DP++ F V   Y+ +++ ++P ++ A A+ +QYW
Sbjct: 130 TIHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAITVQYW 189

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
              D ++P V++ I    I++IN  G R FGE E+  S VKI  +               
Sbjct: 190 --NDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIAGGG 247

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
           P+HE +G KYW NPG+         G KG      SV V+A ++  GTE+  +   E  +
Sbjct: 248 PDHEYIGAKYWHNPGSLAH------GFKGVL----SVLVVASYSLGGTEMTCLASGE-TD 296

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           P K +P AIK   +RI+ F+L+S+ L+G  VP+ +P L+            PFV+AI   
Sbjct: 297 P-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSSVDNS----PFVIAIKIH 351

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
            I VLP I+NA IL+ + S  NS ++ +SR+L  +A  +  P  F   ++ G P   +++
Sbjct: 352 NIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIII 411

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
             LF LLA++  SS  +EVF + +    +   + W+SI I ++RF  A + Q      L 
Sbjct: 412 NSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDELE 471

Query: 490 YQSPLQPYGAWFSLFFCILIGLI 512
           + S +   G W S++  I+  LI
Sbjct: 472 FVSAV---GIWGSVYSGIVNALI 491

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  205 bits (522), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 141/457 (30%), Positives = 227/457 (49%), Gaps = 30/457 (6%)

Query: 124 VGLLVFFVMSCLGEMA-AYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
           +G  ++ ++   GE+A  Y  L   F  Y T   D A GFAV + Y  ++  + P +L  
Sbjct: 162 MGSCLYCIIQACGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVT 221

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
            ++ I+YW     VNP ++++I  V II IN  G R + E E++ ++ K+ +M       
Sbjct: 222 ASMTIKYWTT--SVNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILG 279

Query: 242 XXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCG 301
                        +G KYW +PGAF   +  I   KG      + F  A FA+  +E   
Sbjct: 280 IIITCGGAGTSGYIGAKYWHSPGAFNG-NRPIDHFKG----VMATFTTAAFAFGASEFIS 334

Query: 302 IVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXP 361
           +  +E  NPRKA+PKA K+ +YRI+  +L SI L+G  VP+N P L+            P
Sbjct: 335 LTAAEQSNPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKAS--P 392

Query: 362 FVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQG 421
           +VVA+ + G+ V+PH +NA IL+ V S  NS  Y +SR L  LA    AP++F   +K+G
Sbjct: 393 YVVAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRG 452

Query: 422 VPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ 481
            P  +++   LF  +A+   S    +VFT+ +    +  L +W++I I+++RF +A +VQ
Sbjct: 453 RPLVAMVCSTLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQ 512

Query: 482 GIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFL----GDTFDYKSFXXXXXXXXX 537
           G     + ++S +  YG+ ++    IL  LI  F   L    G+  D ++F         
Sbjct: 513 GHSLGEIGFKSQVGIYGSLYAATMLIL-ALIAQFWVALAPIGGNGLDARNFFQNYLAMPI 571

Query: 538 XXXXXXXXKLWYKTKI--------IPSEEVDLVSFKE 566
                    L++  KI        IP+  +DLVS ++
Sbjct: 572 LLV------LYFGYKIRKRDWKFWIPAHRIDLVSHRK 602

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  204 bits (520), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 123/434 (28%), Positives = 215/434 (49%), Gaps = 11/434 (2%)

Query: 78  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGE 137
            LKK++++RHV M                                 V  + +F++   GE
Sbjct: 85  HLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGE 144

Query: 138 MAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKV 195
           M    P     F +Y++ +   + GFA  + +  ++  ++P +L   ++ ++YW   D +
Sbjct: 145 MGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYW--NDTI 202

Query: 196 NPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVL 255
           N  V+I I  V ++ I+F GV+ +GE E+  ++ KI ++                    +
Sbjct: 203 NADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYI 262

Query: 256 GFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVP 315
           G KYW++PG+F E S A      RF     + V A F++ G EL  + ++E  NPRK+ P
Sbjct: 263 GGKYWRDPGSFAEGSGAT-----RFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTP 317

Query: 316 KAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLP 375
            A K ++YRI++ YL+++ L+G  VP N+  L+            P+V+A     + V+P
Sbjct: 318 VAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHAS--PYVLAASIHKVRVIP 375

Query: 376 HIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFAL 435
           HI+NA ILI V S ANS LY A R +  LA    AP+     +++G P  +L+V  L  +
Sbjct: 376 HIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGV 435

Query: 436 LAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQ 495
           + ++  S    + FT+      +  L +W  I++++IRF KA +VQG     + Y++   
Sbjct: 436 VGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTG 495

Query: 496 PYGAWFSLFFCILI 509
            +G+++ +FF +L+
Sbjct: 496 IWGSYYGVFFNMLV 509

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  205 bits (522), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 127/438 (28%), Positives = 211/438 (48%), Gaps = 13/438 (2%)

Query: 80  KKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMA 139
           K  ++ARHV M                                 V  + +FV+   GEMA
Sbjct: 155 KGGMKARHVIMMTLATGIGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMA 214

Query: 140 AYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNP 197
              P    GF +Y + +     GFA  + +   +  I+P +L   ++ ++YW     +NP
Sbjct: 215 IAYPTLPGGFNTYQSLFISKPFGFATVWIFALNWLTILPLELITSSITVKYWTT--SINP 272

Query: 198 GVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGF 257
            +++ I  + ++ ++F+G+R + E E++ ++ KI ++                +   +G 
Sbjct: 273 DIFVLIFYLFLLFVHFIGLRLYAEAEFFFNSCKILMITGFIIFSIVVNCGGAGHDGYIGG 332

Query: 258 KYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKA 317
           KYW +PG F     A      RF     V + A F+Y GTEL  + V+E +NPRKAVP A
Sbjct: 333 KYWHDPGPF-----ASDNGAARFKEVCYVLINAYFSYGGTELYVLSVNEQENPRKAVPVA 387

Query: 318 IKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHI 377
            K ++YR+ + YL+++ L+G  VP+N P L+            P+V+A    G+ ++PH 
Sbjct: 388 AKTSVYRVAIIYLLTMILIGFNVPYNSPDLMGNANSKDAS---PYVLAAQIHGVKIVPHF 444

Query: 378 MNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLA 437
           +NA IL+ V S ANS L+   R L  LA    AP+     ++ G P  +L V  LF ++A
Sbjct: 445 INAVILLSVISVANSALFAGPRLLATLAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIA 504

Query: 438 YMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPY 497
           +   S    EVFT+      +  L +W  IL+++IRF  A +  G     + Y++    +
Sbjct: 505 FAATSKKEDEVFTWLAAIAGLSELFAWSGILLSHIRFRWAMKYHGKSMDEVGYKAITGIW 564

Query: 498 GAWFSLFFCILIGLIKNF 515
           G+++ LFF +L+ LI  F
Sbjct: 565 GSYYGLFFNLLV-LIAQF 581

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  204 bits (519), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 163/593 (27%), Positives = 272/593 (45%), Gaps = 40/593 (6%)

Query: 3   EKVYLDAQLSRVDTDEDIEKQ----------QLFGDDNIVIERSSQLFYDGQSD------ 46
           E  YLD+QL+   +  +  K+          + F D     + +    +D ++D      
Sbjct: 26  EVEYLDSQLNGDSSSNNSIKEPTSTGAKGHFKSFVDSFRRGDHAKNALHDLENDITTSIS 85

Query: 47  --SKVHGITSGHGSD--VKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXX 102
             S VH ++     D  +++V +         +   L+K ++ RHV M            
Sbjct: 86  HASLVHAVSKAREDDEIMQSVASAEHRKVNNTESDDLQKTIKPRHVIMISLGTGIGTGLL 145

Query: 103 XXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAA-YIPLDG-FTSYSTRYADPALG 160
                                +G  ++ ++   GEMA  Y  L+G F +Y +   DPALG
Sbjct: 146 VGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQAAGEMAVVYSDLNGGFNNYPSFLLDPALG 205

Query: 161 FAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFG 220
           F+V + Y  ++  + P +L   +L I+YW    KV+P V++ I  V II+IN  G R + 
Sbjct: 206 FSVAWVYCLQWLCVCPLELVTASLTIKYWTT--KVDPDVFVIIFYVLIISINVFGARGYA 263

Query: 221 EIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRF 280
           E E++ +  K+ +M                N   LG KYW  PGAF+        A  RF
Sbjct: 264 EAEFFFNVCKVLMMIGFFILGIIITAGGAGNDGYLGAKYWHEPGAFRG-----EHAVDRF 318

Query: 281 VSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCV 340
                 FV A FA+  TE   +  +E  NPRKA+P A K  +YRI++ +L+SI +LG  V
Sbjct: 319 KGVMDTFVAAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVLIFLVSIIMLGFLV 378

Query: 341 PFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRS 400
           P++   L+            P+V+A+   G+ V+PH +NA IL+ V S  NS  Y +SR 
Sbjct: 379 PYDSDQLLGSSGSGVKAS--PYVLAVSLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRL 436

Query: 401 LYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFG 460
           L  L+    AP+ F   ++QG P  ++L+  LF ++A+   S   ++VF + +    +  
Sbjct: 437 LLSLSQQGYAPKWFDYVDRQGRPARAMLMSALFGVIAFCATSPKETDVFNWLLAISGLSQ 496

Query: 461 LLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF----- 515
           L +W +I ++++RF  A +VQG     + + S    YG+ ++    IL  L+  F     
Sbjct: 497 LFTWFAICMSHVRFRYAMKVQGRSIGEVGFHSQTGVYGSLYAATMMIL-ALMAQFWVAIA 555

Query: 516 PAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYKT-KI-IPSEEVDLVSFKE 566
           P   G   D ++F                 KL+Y+  K+ I ++++DL+S ++
Sbjct: 556 PLNEG-KLDAQNFFQSYLAMPILIALYFGYKLYYRDWKLYIKADKIDLISHRQ 607

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  202 bits (515), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 139/407 (34%), Positives = 208/407 (51%), Gaps = 21/407 (5%)

Query: 124 VGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAG 182
           +G+L F +M  +GEM    P  G FT+ + R+   AL    GYAY   ++ ++ N+    
Sbjct: 101 IGILAFIMMESIGEMITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTL 160

Query: 183 ALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           + ++Q+W    +V    +I I   A      LGV  FGE EY+++  KI  +        
Sbjct: 161 SSIMQFW--GPQVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSI 218

Query: 243 XXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGI 302
                   N    GF+YW +PGA         G KG     A+VFV     Y GTE   +
Sbjct: 219 VYISGGVKNRPAFGFQYWNDPGALSN------GFKG----IANVFVFCSTFYSGTESVAL 268

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYL-ISIFLLGMCVPFNDPLLIXXXXXXXXXXXXP 361
             +E KNPR+AVP AI+ T +RI++ YL ISIF  G+ VP+ND  L             P
Sbjct: 269 AATESKNPRRAVPIAIRQTFWRILIVYLGISIFY-GVTVPYNDENL----NFATKVLKSP 323

Query: 362 FVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQG 421
             +AI  AG P   H++NA ILI   SA N  LY+ SR+L  LA +  AP++ A T+++G
Sbjct: 324 IAIAISRAGWPAGVHLVNAFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRG 383

Query: 422 VPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ 481
           VP  ++ V     L++ MNVS  + + + Y VN   +   + W  I +T++RF KA+++Q
Sbjct: 384 VPIPAITVFNALGLISLMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQ 443

Query: 482 GIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528
           G  +  L Y++ L P     S+   I +GL++ +  F    FD K+F
Sbjct: 444 GHTRDELPYKAKLFPVFPIVSIIANIFLGLVQGWSYF--KPFDAKNF 488

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  204 bits (518), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 135/509 (26%), Positives = 234/509 (45%), Gaps = 23/509 (4%)

Query: 66  HTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVG 125
             SE + +     L+K++++RH+ M                                   
Sbjct: 78  QNSELESQEKN-NLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIAS 136

Query: 126 LLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGA 183
           ++++ ++   GE+   Y  L G +T YS+   DP+LGFAV   Y  ++  ++P QL   A
Sbjct: 137 IMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAA 196

Query: 184 LVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXX 243
           + ++YW +   VN  +++ ++ + +I IN  G R + E E+  +  KI ++         
Sbjct: 197 MTVKYWTN---VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIV 253

Query: 244 XXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIV 303
                  +   +G +YW NPG F        G KG      +VF  A F+Y G E+  + 
Sbjct: 254 INCGGAGDRRYIGTEYWHNPGPFAH------GFKG----VCTVFCYAAFSYGGIEVLLLS 303

Query: 304 VSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFV 363
            +E +NP +++P A K  +YRI++ Y+++  L+G  VP+N   L+            PFV
Sbjct: 304 AAEQENPTESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHAS-PFV 362

Query: 364 VAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVP 423
           +A+ + G+ V+PH +NA ILI V S ANS LY   R L  LA     P+  A  ++ G P
Sbjct: 363 IAVSSHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRP 422

Query: 424 YWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGI 483
               LV + F  + ++  S+   +VFT+ +   S+  L  W+S+ +++IRF  A   QG 
Sbjct: 423 LLCFLVSLAFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGR 482

Query: 484 DKSTLAYQSPLQPYGAW----FSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXX 539
               + Y++    +G+W     ++FF +    +   P       D K F           
Sbjct: 483 SMDEVGYKAQTGYWGSWIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVL 542

Query: 540 XXXXXXKLWYKTKI--IPSEEVDLVSFKE 566
                 K+++K+    IP+E++DL S + 
Sbjct: 543 LAYFGHKMYFKSWRFWIPAEKIDLDSHRN 571

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  203 bits (517), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 133/453 (29%), Positives = 216/453 (47%), Gaps = 15/453 (3%)

Query: 59  DVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXX 118
           D+++  TH+           LK++++ RHV+M                            
Sbjct: 68  DLEHATTHSVASSSP-----LKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLI 122

Query: 119 XXXXFVGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVP 176
                V ++ + +M   GEMA AY  L G F +YS++      GFA  + Y  ++  ++P
Sbjct: 123 IGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLP 182

Query: 177 NQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXX 236
            +L   +L I+YW   D +N  V+I I  V I+ I+F G R +GE E+     K+ ++  
Sbjct: 183 LELITASLTIKYW--NDSINADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIG 240

Query: 237 XXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLG 296
                         + + +G KYW +PGAF     A+     +F   A V V   F+Y G
Sbjct: 241 FVILSIVINCGGAGDRKYIGAKYWYDPGAF-----AVGSGATKFKGVAYVLVTGYFSYGG 295

Query: 297 TELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXX 356
           TEL  + V+E  NPR+A+    K  +YRI++ Y++++ L+G  VP     L+        
Sbjct: 296 TELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSAT 355

Query: 357 XXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAK 416
               P+V+A+   G+ ++PHI+NA ILI V S  NS +Y   R L  LA    APR  A 
Sbjct: 356 HAS-PYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAY 414

Query: 417 TNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDK 476
            ++ G P  +L+   +F LLA++  S    +VFT+      +  L +W +I+++++RF +
Sbjct: 415 VDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQ 474

Query: 477 AFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILI 509
           A R      S L Y++     G+   L F IL+
Sbjct: 475 AMRYNNRPLSELGYKANTGVLGSVLGLSFNILV 507

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  202 bits (515), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 138/446 (30%), Positives = 213/446 (47%), Gaps = 20/446 (4%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           DG  D   LK+ L++RH+ M                                  G  +  
Sbjct: 55  DGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVG 114

Query: 131 VMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
            +  LGE+    P+ G F  YSTR+ DP++ F V   Y+ +++ ++P ++ A A+ IQYW
Sbjct: 115 TIHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYW 174

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
                ++P VW+ I    I++IN  G R FGE E+  S +K   +               
Sbjct: 175 --NSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGG 232

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
           P+HE +G KYW +PGA          A G F    SV V+A ++  GTE+  +   E  +
Sbjct: 233 PDHEFIGAKYWHDPGAL---------AHG-FPGVLSVLVVASYSLGGTEMTCLASGE-TD 281

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           P K +P AIK   +RI+ F+L S+ L+G  VP+ +  L+            PFV+AI   
Sbjct: 282 P-KELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSSVDNS----PFVIAIKLH 336

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
            I  LP I+NA ILI + S  NS ++ +SR+L  +A     PR F   ++ G P   ++ 
Sbjct: 337 HIKALPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVT 396

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
             LF LLA++  SS  SEVF + +    +   + W+SI +++IRF  A + Q      L 
Sbjct: 397 NSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELE 456

Query: 490 YQSPLQPYGAWFSLFFCILIGLIKNF 515
           + S +  +G+ +S    +LI LI  F
Sbjct: 457 FVSAVGIWGSAYSALINVLI-LIAQF 481

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  203 bits (516), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 156/535 (29%), Positives = 242/535 (45%), Gaps = 28/535 (5%)

Query: 44  QSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXX 103
           Q  S  H + +G  SD++       E D   D   LKK ++ RHV M             
Sbjct: 77  QPGSLDHDVLAGD-SDIEGKPRTEPEKD--DDARELKKTIKPRHVVMISLGTGIGTGMLV 133

Query: 104 XXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMAA-YIPL-DGFTSYSTRYADPALGF 161
                               +G  ++ ++   GE+A  Y  L  GF +Y +   DPA GF
Sbjct: 134 GNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGF 193

Query: 162 AVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLG-VRFFG 220
           AV + Y  ++  + P +L   ++ I+YW    KV+P V++ I    I+ IN LG    + 
Sbjct: 194 AVAWVYCIQWLCVCPLELVTASMTIKYWTT--KVDPDVFVVIFYCLILCINVLGGAAGYA 251

Query: 221 EIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAK--G 278
           E E++ ++ KI ++                N   +G + W NPG+F+       G K   
Sbjct: 252 EAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIGTRLWHNPGSFR-------GDKPVD 304

Query: 279 RFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGM 338
           RF    S  V A FA+  +E  G+  SE  NPRKA+P A K  +YRII  YL S+ ++G 
Sbjct: 305 RFKGVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGF 364

Query: 339 CVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVAS 398
            VP++   L+            P+V+AI   G+ V+PH +NA IL+ V S  NS  Y +S
Sbjct: 365 LVPYDSDQLLGSSGAATKAS--PYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSS 422

Query: 399 RSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSI 458
           R L  L+    AP      ++ G P  +  V  L  ++A+   S    +VF + +    +
Sbjct: 423 RQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGL 482

Query: 459 FGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF--- 515
             L +W SI ++++RF +A RVQG     + ++S +  YG+ +S    +LI LI  F   
Sbjct: 483 SQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLI-LIAQFWTA 541

Query: 516 --PAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK--TKIIPSEEVDLVSFKE 566
             P   G   D ++F                 K+W K     I +E++DLVS +E
Sbjct: 542 LVPVGEGKP-DVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHRE 595

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  202 bits (514), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 129/437 (29%), Positives = 215/437 (49%), Gaps = 11/437 (2%)

Query: 75  DGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSC 134
           D  +L++ +  RHV M                                 V ++ + +M  
Sbjct: 59  DTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHA 118

Query: 135 LGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDR 192
            GEMA AY  L G F +YS+ +     GFA  + +  ++  + P +L    +VI+YW  +
Sbjct: 119 AGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYW--K 176

Query: 193 DKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNH 252
             VN  V++ I  + II I+F G R +GE E+  +  K+ ++                + 
Sbjct: 177 VSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDT 236

Query: 253 EVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRK 312
             +G +YW+NPG+F    T +   KG     A V V A F++ G EL  + V+E  NP+ 
Sbjct: 237 GYIGDRYWRNPGSFVS-GTPLDKLKGT----AYVLVTAYFSFGGMELYALSVNELPNPKT 291

Query: 313 AVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIP 372
           A+P A K  +YRI++ YL+++ ++G  VP +   L+            P+V+AI   G+ 
Sbjct: 292 AIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPS--PYVLAIEMHGVK 349

Query: 373 VLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVL 432
           VLPHI+NA ILI V S  NS +Y A R L  LA    AP+     +++G P  SL++  +
Sbjct: 350 VLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAI 409

Query: 433 FALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQS 492
           F L+A+   S    ++F +      +  L +W SI +++ RF +A ++QG    TL Y++
Sbjct: 410 FGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRA 469

Query: 493 PLQPYGAWFSLFFCILI 509
               +G+ +++FF +L+
Sbjct: 470 ITGQWGSLYAVFFNLLV 486

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  203 bits (516), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 133/468 (28%), Positives = 225/468 (48%), Gaps = 14/468 (2%)

Query: 66  HTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVG 125
           H      K +   L+K+++ RHV M                                 +G
Sbjct: 114 HDVAITSKEEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMG 173

Query: 126 LLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGA 183
             ++ ++   GEMA +Y  L G F +Y T   D   GFAV + Y  ++  ++P +L   +
Sbjct: 174 TCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTAS 233

Query: 184 LVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXX 243
           + I YW    KVN  +++ I  V II IN  G + + E +++ +  K+ ++         
Sbjct: 234 MTIDYWTT--KVNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAII 291

Query: 244 XXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIV 303
                      +G KYW +PGAF+   +       RF    + F  A FA+  +E   I 
Sbjct: 292 INAGGAGTSGYIGAKYWHDPGAFRGDRSI-----DRFKDVMATFTTAAFAFGASEFIAIG 346

Query: 304 VSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFV 363
            SE  NPR+A+P A K+ +YRI+  +L SI L+G  VP++   L+            P+V
Sbjct: 347 ASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKAS--PYV 404

Query: 364 VAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVP 423
           +AI + G+ V+PH +NA IL+ V S +NS  Y + R L+ L+    AP+ F   +++G P
Sbjct: 405 LAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRP 464

Query: 424 YWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGI 483
             ++++ +LF ++A+   SS   EVFT+ +    +  + +W++I +++IRF +A  VQG 
Sbjct: 465 ARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGR 524

Query: 484 DKSTLAYQSPLQPYGAWFS---LFFCILIGLIKNFPAFLGDTFDYKSF 528
             S L ++S L  +G+ ++   LF  ++     +      D  D KSF
Sbjct: 525 SISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSF 572

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  202 bits (514), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 120/394 (30%), Positives = 200/394 (50%), Gaps = 12/394 (3%)

Query: 124 VGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
           +G  ++ ++   GE+A +Y  L G F  Y +   DPA GF+V + Y  ++  + P +L  
Sbjct: 151 MGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVT 210

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
            ++ I+YW     VN  +++ I  V II IN  G R + E E++ +  KI +M       
Sbjct: 211 ASMTIKYWTT--TVNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILG 268

Query: 242 XXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCG 301
                    N   +G +YW  PGAF     A       F    +  V A FA+  TE   
Sbjct: 269 IVINTGGAGNDGYIGDRYWHTPGAF-----AGDRPIDHFKGIMATMVTAAFAFGATEFIA 323

Query: 302 IVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXP 361
           +  +E  NPRKA+P A K  +YRI+  +L SI L+G  VP++   L+            P
Sbjct: 324 LTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKAS--P 381

Query: 362 FVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQG 421
           +V+A+   G+ V+PH +NA IL+ V S  NS  Y +SR LY LA    AP+ F   +++G
Sbjct: 382 YVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREG 441

Query: 422 VPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ 481
            P+ +++   +FA++++   S    +VFT+ +    +  + +W +I +++IRF KA  VQ
Sbjct: 442 RPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQ 501

Query: 482 GIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF 515
                 + +++    +G+++  F  ++I LI  F
Sbjct: 502 KRSLGEIGFKAQTGVWGSYYVCFMLVMI-LIAQF 534

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  200 bits (509), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 146/502 (29%), Positives = 230/502 (45%), Gaps = 25/502 (4%)

Query: 68  SEFDGKHDGIR--LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVG 125
           S+FD + + IR  L +AL  RH++M                                 +G
Sbjct: 34  SDFDPEQN-IREDLTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIG 92

Query: 126 LLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGAL 184
            +V+  M CLGEM+ ++P+ G F SY+ ++   +   A+ + Y F   + V + LTA  L
Sbjct: 93  GVVYLTMLCLGEMSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQL 152

Query: 185 VIQYWVDRDKVNPGVWITILLVA--IITINFLGVRFFGEIEYYISAVKITVMXXXXXXXX 242
           V+ YW   D   P  W   L+    ++ +N + VR +GE EY+++ +K+  +        
Sbjct: 153 VLDYWHTADHHFP-YWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSI 211

Query: 243 XXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGI 302
                  P HE +GFK W +  A       + G KG    FAS+FV A FAY GTE   +
Sbjct: 212 IVNVGKNPQHEYIGFKNWTHGEA-----PFVNGFKG----FASLFVSACFAYGGTESITL 262

Query: 303 VVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPF 362
              E  NP +  PK +K   +RI++FY++S F +GM +P++ P L             PF
Sbjct: 263 TGGEASNPVRNTPKIVKTVFWRILIFYVLSTFFIGMNIPYDYPGL-----STKSVMTSPF 317

Query: 363 VVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAP-RIFAKTNKQG 421
            +    AG       MNA IL  V SA N  L+  SR +Y +A+D   P +I  +TN+  
Sbjct: 318 TLVFQMAGTRGAGSFMNAVILTSVISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYK 377

Query: 422 VPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQ 481
            PY ++L+      L       G+  ++T+  N V +   ++W+ I IT IRF K   VQ
Sbjct: 378 APYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQ 437

Query: 482 GIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXXXX 541
           G     L +++   P+G +F + F + I LI+ + AF  D +    F             
Sbjct: 438 G-KTDLLQFKNWTYPFGPYFLVIFTVFIILIQGWQAF--DPWSVTDFFSVYLELFVFPFV 494

Query: 542 XXXXKLWYKTKIIPSEEVDLVS 563
                LW +   +  E++D V+
Sbjct: 495 YIIWWLWKRDWFVKYEDMDFVT 516

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  201 bits (511), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 154/546 (28%), Positives = 255/546 (46%), Gaps = 28/546 (5%)

Query: 33  IERSSQLFYDG--QSDSKV-HGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVS 89
           +    ++ Y+G    D++V  GIT+   S+     +   E + K +  +L +++++RH+ 
Sbjct: 44  LNEGDKVKYEGIKNGDTQVTSGITNSFESESLRDDSKPLENEEKTEN-QLNRSIKSRHLL 102

Query: 90  MXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMA-AYIPLDG-F 147
           M                                   ++V+F++   GE+   Y  L G +
Sbjct: 103 MISLGTGIGTGLLVGNGQVLAKSGPAGLVIGYGVASIMVYFIVQAAGELGICYSGLTGNY 162

Query: 148 TSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVA 207
             Y +   DPALGFA+   Y  ++  ++P QL   A+ I YW +   +NP +++ I+LV 
Sbjct: 163 IRYPSILVDPALGFAISIIYTLQWLTVMPLQLVTAAMTIGYWTN---INPNIFVAIVLVI 219

Query: 208 IITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFK 267
           ++  N  G + + E E+  +  K+ +M                    +G  YWKNPGAF 
Sbjct: 220 VVLTNCFGAKGYVEAEFLCNIFKVLMMVGFVLLAILINTGAIGTDGYIGTIYWKNPGAF- 278

Query: 268 EYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIV 327
                   A G F    SVF  A F+Y G E+  +  +E +NP KA+P A K T+YRI+ 
Sbjct: 279 --------ANG-FKGVCSVFCYAAFSYGGIEVLALTAAEQENPIKAIPSACKKTVYRILF 329

Query: 328 FYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVF 387
            Y+++  L+G  VP++ P L+            PFV+AI + G+ V+PH++NA ILI + 
Sbjct: 330 LYMLTTILIGFLVPYDSPQLMGSTSGGGSHSS-PFVIAIASHGVKVVPHLINAVILISIV 388

Query: 388 SAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSE 447
           S ANS  Y ++R L  L+   K P+IF   +K+G P++ +L   LF  + ++  S    E
Sbjct: 389 SVANSAFYSSTRLLLSLSEQGKIPKIFNYVDKEGRPWYCILFASLFGSIGFVASSPYKEE 448

Query: 448 VFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCI 507
           VFT+ +    +  +  W+SI +++IRF +A   QG     + Y++P   +G+W +L    
Sbjct: 449 VFTWLLAISGLSQIFLWMSICLSHIRFRRAMIKQGKSLDEIGYKAPTGCWGSWIALSIA- 507

Query: 508 LIGLIKNF-----PAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK--TKIIPSEEVD 560
           L  LI  F     P       D   F                 K +YK     IPS+++D
Sbjct: 508 LFSLISQFWVAIAPIGKDGKLDVLVFFQNYLAAPIVLIAYLGYKTYYKDWRLYIPSDKID 567

Query: 561 LVSFKE 566
           L   +E
Sbjct: 568 LSYGRE 573

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  200 bits (509), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 134/443 (30%), Positives = 214/443 (48%), Gaps = 22/443 (4%)

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           +G      LK++L++RH+ M                                  G  +  
Sbjct: 68  NGSFHTSNLKRSLKSRHLIMIAIGGSIGTGLFIGSGQALANGGPLALVLGWSIAGSQIVG 127

Query: 131 VMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYW 189
            +  LGE+    P+ G F +Y TR+ DP+L F +   Y+ +++ ++P ++ + A+ +QYW
Sbjct: 128 TIHGLGEITVRFPVVGAFANYQTRFLDPSLSFVISTIYVLQWFFVLPLEILSSAITVQYW 187

Query: 190 VDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXX 249
              D ++P V++ I   AI++IN  GVR FGE E+  S +K+  +               
Sbjct: 188 --NDTIDPVVFVAIFYCAIVSINLFGVRGFGEAEFVFSTIKVITVTGFIILCIILICGGG 245

Query: 250 PNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKN 309
           P HE +G KYW +PG           A G F  F SV + A ++  GTE+  +   E  +
Sbjct: 246 PTHEFIGAKYWHDPGCL---------ANG-FRGFLSVLITASYSLGGTEMTCLASGE-TD 294

Query: 310 PRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNA 369
           P K +P AIK   +RI+ F+L+S+ L+G  VP+ +  L+            PFV+AI   
Sbjct: 295 P-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSSVDNS----PFVIAIKLH 349

Query: 370 GIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLV 429
            I VLP I+NA ILI + S  NS ++ +SR+L  +A     P  F   ++ G P   +++
Sbjct: 350 NIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLTGIVI 409

Query: 430 GVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLA 489
             LF LLA++  SS  SEVF + +    +   + W+SI I +IRF  A + Q      L 
Sbjct: 410 NSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINICHIRFRLAMKAQNKTIDELE 469

Query: 490 YQSPLQPYGAWFSLFFCILIGLI 512
           + S +   G W S++  I+  LI
Sbjct: 470 FVSAV---GVWGSVYSAIINSLI 489

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  201 bits (511), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 206/388 (53%), Gaps = 12/388 (3%)

Query: 123 FVGLLVFFVMSCLGEMAAYIP--LDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLT 180
            +G  V+ V+   GE+       + GF +Y      P+  F+VG+ Y  ++  + P +L 
Sbjct: 161 LMGTCVYCVIQAAGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELV 220

Query: 181 AGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXX 240
             +L I+YW    KV+P V++ I  + I+ INF G + + E +++ + +K+ ++      
Sbjct: 221 TASLTIKYWTT--KVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFIL 278

Query: 241 XXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELC 300
                     +   LG KYW NPGAF+    AI   KG     +SVFV + FA+ G+E  
Sbjct: 279 GIVVACGGAGHDGYLGGKYWHNPGAFRG-EKAIDHFKG----VSSVFVTSAFAFGGSEFV 333

Query: 301 GIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXX 360
            +  SE  NPRK++P A KL +YRII  YL SI +LG  VP++ P L             
Sbjct: 334 ALSASEQANPRKSIPSAAKLILYRIIWVYLTSITILGFLVPWDSPQL---QPSSDGKKTS 390

Query: 361 PFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQ 420
           P+VVAI   G+ V+PH++NA IL+ V S +NS  + +SR L  L+    AP+ F   +++
Sbjct: 391 PYVVAIAMHGVKVVPHLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRK 450

Query: 421 GVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRV 480
           G P  ++L+  LF ++ +   S   ++VF++ +    +  + ++ SI +++IR   A +V
Sbjct: 451 GRPVRAMLISALFGVICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKV 510

Query: 481 QGIDKSTLAYQSPLQPYGAWFSLFFCIL 508
           QG     L ++S +  YG++++    +L
Sbjct: 511 QGRSLGELGFRSQVGTYGSFYACLLLVL 538

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  200 bits (508), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 214/456 (46%), Gaps = 20/456 (4%)

Query: 61  KNVVTHTSEFDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
           + V +  S  DG  D   LK+ L+ RH+ M                              
Sbjct: 60  RCVDSFKSPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIG 119

Query: 121 XXFVGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQL 179
               G  +   +  LGE+    P+ G F +Y TR+ DP++ F V   Y+ +++ ++P ++
Sbjct: 120 WAIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEI 179

Query: 180 TAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXX 239
            A A+ +QYW     ++P +W+ I    I++IN  GVR FGE E+  S +K   +     
Sbjct: 180 IAAAMTVQYW--NSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFII 237

Query: 240 XXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTEL 299
                     P+HE +G KYW +PG           A G F    SV V+A ++  G E+
Sbjct: 238 LCVVLICGGGPDHEFIGAKYWHDPGCL---------ANG-FPGVLSVLVVASYSLGGIEM 287

Query: 300 CGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXX 359
             +   E  +P K +P AIK   +RI+ F+LIS+ L+G  VP+ +  L+           
Sbjct: 288 TCLASGE-TDP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSSVDNS--- 342

Query: 360 XPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNK 419
            PFV+AI    I  LP I+NA ILI V S  NS ++ +SR+L  +A     P  F   ++
Sbjct: 343 -PFVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDR 401

Query: 420 QGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFR 479
            G P   ++   LF LLA++  S   SEVF + +    +   + W+SI +++IRF  A +
Sbjct: 402 AGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMK 461

Query: 480 VQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF 515
            QG     L + S +  +G+ +S     LI LI  F
Sbjct: 462 AQGKSLDELEFVSAVGIWGSAYSALINCLI-LIAQF 496

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  200 bits (508), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 138/500 (27%), Positives = 228/500 (45%), Gaps = 21/500 (4%)

Query: 11  LSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEF 70
           L+  DT E  EK          +++S   +++G        + S   +  +     + + 
Sbjct: 31  LTGSDTTEFFEKAS--------VQKSDFEYFEGDETKFRRFVNSFKKAPGRENDQESLQD 82

Query: 71  DGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFF 130
           + KH+  +LK+ +  RHV M                                 +G  V+ 
Sbjct: 83  NNKHE--KLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYC 140

Query: 131 VMSCLGEMAAYIPL--DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQY 188
           V+   GEMA   P    GF +Y +   DP  GFA  + Y  ++  + P +L   ++ I+Y
Sbjct: 141 VIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKY 200

Query: 189 WVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXX 248
           W     +NP +++ +  + II INF G R + E E++ +  K+ ++              
Sbjct: 201 WTT--AINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGA 258

Query: 249 XPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECK 308
             N   +G KYW+ PG+F  + TAI   KG      S  V A F+   +E   +  +E  
Sbjct: 259 AGNDGYIGAKYWREPGSFGGH-TAIDHFKG----VVSTLVNAAFSLGCSEFVALTAAEQA 313

Query: 309 NPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVN 368
           NPRK+VP A K  +Y++ V +L S+ L+G  VP N   L+            P+V+A+ +
Sbjct: 314 NPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVS--PYVIAVAS 371

Query: 369 AGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLL 428
            G+ V+PH +NA IL+ V S  NS  Y +SR L  LA    AP +F   ++QG P  +++
Sbjct: 372 HGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMM 431

Query: 429 VGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTL 488
           V +    L ++  S     VF + +    +  L +W SI I++IRF KA  VQG     L
Sbjct: 432 VSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGL 491

Query: 489 AYQSPLQPYGAWFSLFFCIL 508
            +++    +G+++S    IL
Sbjct: 492 GFKAQTGVWGSYYSAVIMIL 511

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  200 bits (508), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 127/481 (26%), Positives = 223/481 (46%), Gaps = 30/481 (6%)

Query: 42  DGQSDSKVHGITSGHGSDVKNVV-------------THTSEFDGKHDGIRLKKALEARHV 88
           D +S+ +V    +G+ S ++N               +  SE + +     L K++++RH+
Sbjct: 41  DEESEQQVKPQKTGNKSKLQNECKKILSSFKRQLPPSQNSELESQEKN-NLTKSIKSRHL 99

Query: 89  SMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMA-AYIPLDG- 146
            M                                   ++++ ++   GE+   Y  L G 
Sbjct: 100 VMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLYCIIQAAGELGLCYAGLTGN 159

Query: 147 FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLV 206
           +T Y +   DP+LGFAV   Y  ++  ++P QL   A+ ++YW     VN  +++ ++ +
Sbjct: 160 YTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTS---VNSDIFVAVVFI 216

Query: 207 AIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAF 266
            +I IN  G R + E E+  +  KI ++                + + +G +YW NPG F
Sbjct: 217 FVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGAGDRKYIGTEYWHNPGPF 276

Query: 267 KEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRII 326
                   G KG      +VF  A F+Y G E+  +  +E +NP K++P A K  +YRI+
Sbjct: 277 AH------GFKG----VCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRIL 326

Query: 327 VFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFV 386
           + Y+++  L+   VP+N   L+            PFV+A+ + G+ V+PH +NA ILI V
Sbjct: 327 LIYMLTTILVCFLVPYNSDELLGSDDSSGSHAS-PFVIAVASHGVKVVPHFINAVILISV 385

Query: 387 FSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSS 446
            S ANS LY   R L  LA     P+  A  +++G P    LV + F  + ++  S    
Sbjct: 386 ISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAFGCIGFVATSDAEE 445

Query: 447 EVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFC 506
           EVFT+ +   S+  L  W+S+ +++IRF  A   QG   + + Y++    +G+W ++   
Sbjct: 446 EVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIA 505

Query: 507 I 507
           +
Sbjct: 506 V 506

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  199 bits (507), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 130/448 (29%), Positives = 216/448 (48%), Gaps = 22/448 (4%)

Query: 126 LLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGA 183
           ++++ ++   GE+   Y  L G +T YS+   DP+LGFAV   Y  ++  ++P QL   A
Sbjct: 137 IMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAA 196

Query: 184 LVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXX 243
           + I+YW +   VN  +++  + + +I IN  G + + E E+  +  KI ++         
Sbjct: 197 MTIKYWTN---VNADIFVAAVFIFVIIINLFGSKGYAEAEFMFNICKILMVIGFVILAIV 253

Query: 244 XXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIV 303
                  + + +G KYW NPG F        G KG      +VF  A F+Y G E+  + 
Sbjct: 254 INCGGAGDRKFIGTKYWHNPGPFAH------GFKG----VCTVFCYAAFSYGGIEVLLLS 303

Query: 304 VSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFV 363
            +E +NP K++P A K  +YRI+  Y+++  L+   VP+N   L+            PFV
Sbjct: 304 AAEQENPTKSIPNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSGSSSGSHAS-PFV 362

Query: 364 VAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVP 423
           +A+ + G+ V+PH +NA ILI V S ANS LY A R L  LA     P+  A  ++ G P
Sbjct: 363 IAVASHGVKVVPHFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCLAYVDRNGRP 422

Query: 424 YWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGI 483
               LV ++F  + ++  S    +VFT+ +   S+  L  W+S+ +++IRF  A   QG 
Sbjct: 423 LLCFLVSIIFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGR 482

Query: 484 DKSTLAYQSPLQPYGAWF----SLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXXXX 539
               + Y++    +G+W     +LFF +    +   P       D   F           
Sbjct: 483 SMDEVGYKAQTGYWGSWLAVLIALFFLVCQFWVAIAPVSKHGKLDANVFFQNYLAMPIVL 542

Query: 540 XXXXXXKLWYKTKI--IPSEEVDLVSFK 565
                 K++ K+    IP+E++DL S +
Sbjct: 543 FAYFGHKIYTKSWKFWIPAEKIDLDSHR 570

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score =  199 bits (505), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 124/381 (32%), Positives = 189/381 (49%), Gaps = 17/381 (4%)

Query: 123 FVGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTA 181
            VG  +  V+ C  E++   P+ G +  +++R+ DP+ GF+VG  YL  + I  P++L  
Sbjct: 112 LVGASMLCVVQCGAELSCQYPVSGSYALHASRFIDPSAGFSVGINYLLMWLISFPSELVG 171

Query: 182 GALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXX 241
            +L + YW     VNP VW+ I     + +N  G R F E E+Y+S  KI  +       
Sbjct: 172 CSLTMTYWAP--SVNPAVWVAIAFTLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIG 229

Query: 242 XXXXXXXXPNHE-VLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELC 300
                   P     +G KYW +PG+F         A   F +F + FV A +++ GTE+ 
Sbjct: 230 IILIAGGGPESTGYIGTKYWYDPGSF---------APPAFKNFCNTFVSAAYSFSGTEMV 280

Query: 301 GIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXX 360
            +  +E ++   +V +A K T +RI VFY++++ ++G  VP+NDP LI            
Sbjct: 281 VLTSAEARD-VSSVSRAAKGTFWRIAVFYIVTVIIIGCLVPYNDPRLINGSSSEDITAS- 338

Query: 361 PFVVAIVNAGI--PVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTN 418
           PFV+A+ N G     +   MNA ILI VFS  NS +Y +SR + GLA   + P+I    +
Sbjct: 339 PFVIALSNTGAMGTRVSQFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICGYMD 398

Query: 419 KQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAF 478
           + G P   + +   F LL ++ VS     VFT+     SI    +W  I    IRF  A 
Sbjct: 399 RNGRPLVGMAICGAFGLLGFLVVSKDQGTVFTWLFALCSISFFTTWFCICFCQIRFRMAM 458

Query: 479 RVQGIDKSTLAYQSPLQPYGA 499
           + QG     + Y+SPL  YG 
Sbjct: 459 KAQGKPDDDIIYKSPLGIYGG 479

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  199 bits (507), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 147/499 (29%), Positives = 230/499 (46%), Gaps = 22/499 (4%)

Query: 78  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGE 137
            LK+ ++ RHV M                                 +G  V+ ++   GE
Sbjct: 109 NLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAGE 168

Query: 138 MAA-YIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKV 195
           MA  Y  L+G F +Y T   +P          LF     +   +       +YW  R  V
Sbjct: 169 MAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFGIGYCFDDYKYWTTR--V 226

Query: 196 NPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVL 255
           +P V++ I  V II IN  G R + E E++ +  K+ +M                N   L
Sbjct: 227 DPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYL 286

Query: 256 GFKYWKNPGAFKEYSTAITGAKG--RFVSFASVFVLALFAYLGTELCGIVVSECKNPRKA 313
           G  YW+NPGAF+       G KG   F    +  V A FA+ GTE   +  +E  NPRKA
Sbjct: 287 GNIYWRNPGAFR-------GDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKA 339

Query: 314 VPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPV 373
           +P A K  +YRI++ YL SI L+G  VPF  P L+            P+V+A+ + G+ V
Sbjct: 340 IPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAAS--PYVIAVASHGVRV 397

Query: 374 LPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLF 433
           +PH +NA IL+ V S  NS  Y +SR L  L+    AP+ F   +++G P  +++V  LF
Sbjct: 398 VPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALF 457

Query: 434 ALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSP 493
            ++A+   S   +EVFT+ +    +  + +WISI +++IRF  A + QG     + +++ 
Sbjct: 458 GVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQ 517

Query: 494 LQPYGAWFSLFFCILIGLIKNF---PAFLGDT-FDYKSFXXXXXXXXXXXXXXXXXKLWY 549
              +G+++S+F  IL  LI  F    A +G      ++F                 K+W 
Sbjct: 518 TGIWGSYYSIFLMILT-LIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKIWK 576

Query: 550 K--TKIIPSEEVDLVSFKE 566
           K  T  I +E++DL+S ++
Sbjct: 577 KDWTLYIKAEDIDLISHRQ 595

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  197 bits (502), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 120/439 (27%), Positives = 211/439 (48%), Gaps = 15/439 (3%)

Query: 79  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEM 138
           L+++++ RHV M                                 +G++V   M  +GE+
Sbjct: 25  LRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLIIGVMVVCCMQSVGEL 84

Query: 139 AAYIP--LDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVN 196
               P    GF SY  ++ DP+LGF V + +  ++ +++P +L   ++ I+YW     ++
Sbjct: 85  VVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTASMTIKYW--NSNLS 142

Query: 197 PGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLG 256
           P ++++   + I  +NF G   + E E+  + VK+ V+                N   +G
Sbjct: 143 PSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIVIITGGLGNSGPIG 202

Query: 257 FKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECK--NPRKAV 314
           F+Y K PGAF           G  V+       A F+  G E   +  +E    N  K++
Sbjct: 203 FQYLKTPGAFNTNYNVFKATAGTLVN-------AAFSCGGVEFLALSAAEQNRDNMPKSI 255

Query: 315 PKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVL 374
            +A +    R+ VFYL+SI ++G+ VP++ P+L+            P+V AI   G+ ++
Sbjct: 256 RRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTS--PYVAAIALHGVRIV 313

Query: 375 PHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFA 434
           PHI+NA ILI V S ANS +Y +SR+L+ LA  N APR FA  NK G P   L+V  +  
Sbjct: 314 PHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVG 373

Query: 435 LLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPL 494
           L++++        VF + ++   +  + +W +I I +IRF  A ++QG    TL Y+S  
Sbjct: 374 LISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNT 433

Query: 495 QPYGAWFSLFFCILIGLIK 513
              G++ +    +++ +++
Sbjct: 434 GVIGSYIATAINVVVIIVQ 452

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  198 bits (504), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 135/447 (30%), Positives = 210/447 (46%), Gaps = 20/447 (4%)

Query: 70  FDGKHDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVF 129
            DG  D   LK+ L+ RH+ M                                  G  + 
Sbjct: 69  LDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQII 128

Query: 130 FVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQY 188
             +  LGE+    P+ G F +Y TR+ DP++ F V   Y+ +++ ++P ++ A A+ +QY
Sbjct: 129 GTVHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQY 188

Query: 189 WVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXX 248
           W     ++P +W+ I    I++IN  G R FGE E+  S VK   +              
Sbjct: 189 W--NSSIDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGG 246

Query: 249 XPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECK 308
            P+HE +G KYW +PG           A G F    SV V+A ++  G E+  +   E  
Sbjct: 247 GPDHEFIGAKYWHDPGCL---------AHG-FPGVLSVLVVASYSLGGIEMTCLASGE-T 295

Query: 309 NPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVN 368
           +P K +P AIK   +RII F+L+S+ L+G  VP+ +  L+            PFV+AI  
Sbjct: 296 DP-KGLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSVDNS----PFVIAIKL 350

Query: 369 AGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLL 428
             I VLP I+NA ILI V S  NS ++ +SR+L  +A     P  F   ++ G P   ++
Sbjct: 351 HHIKVLPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIM 410

Query: 429 VGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTL 488
              LF LLA++  S   SEVF + +    +   + W+SI ++++RF  A + QG     L
Sbjct: 411 ANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDEL 470

Query: 489 AYQSPLQPYGAWFSLFFCILIGLIKNF 515
            + S +  +G+ +S     LI LI  F
Sbjct: 471 EFVSAVGIWGSVYSALINCLI-LIAQF 496

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  200 bits (508), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 153/548 (27%), Positives = 248/548 (45%), Gaps = 35/548 (6%)

Query: 44  QSDSKVHGITSGHGSDVKNVV-------------THTSEFDGKHDGIRLKKALEARHVSM 90
           Q  + V+   +   SD++N++              H ++ +       LKK ++ RHV M
Sbjct: 110 QHPTNVNNNGANSESDLENMILYNEDGTPKPLPHHHDAQINDNSKSDELKKTIKPRHVLM 169

Query: 91  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMSCLGEMA-AYIPL-DGFT 148
                                            +G  ++ ++  +GE+A AY  L  GF 
Sbjct: 170 ISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGELAVAYSDLVGGFN 229

Query: 149 SYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAI 208
           +Y +   D A  FAV + Y  ++  + P +L   ++ I+YW    KV+P +++ I  + I
Sbjct: 230 AYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTT--KVDPDIFVIIFYILI 287

Query: 209 ITINFLG-VRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPNHEVLGFKYWKNPGAFK 267
           I IN LG    + E E+  ++ KI +M                    +G KYW +PGA +
Sbjct: 288 IGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIGAKYWHDPGALR 347

Query: 268 EYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIV 327
              T+I     RF    +  V A FA+  +E  G+  SE  NPRKA+P A K  +YRI+ 
Sbjct: 348 G-DTSIQ----RFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMIYRILC 402

Query: 328 FYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGIPVLPHIMNACILIFVF 387
            +L SI ++G  VP+N   L+            P+V+AI   G+ V+PH +NA ILI V 
Sbjct: 403 MFLSSITIVGFLVPYNSDQLLGSTGSGVKAS--PYVLAISTHGVRVVPHFINAVILISVL 460

Query: 388 SAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSE 447
           S ANS  Y +SR L  LA    AP+I++  +++G P   +    +F ++A+   S    E
Sbjct: 461 SVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAFCATSPKEDE 520

Query: 448 VFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCI 507
           VF + +    +  L +W++I I++IRF +A  VQG     L ++S +  YG+ ++     
Sbjct: 521 VFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYGSAYAAIMMF 580

Query: 508 LIGLIKNF-------PAFLGDTFDYKSFXXXXXXXXXXXXXXXXXKLWYK--TKIIPSEE 558
           +I LI  F        A L    D K+F                 K+W K     I ++ 
Sbjct: 581 MI-LIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKKDWKLFIRAKN 639

Query: 559 VDLVSFKE 566
           +DL+S + 
Sbjct: 640 IDLISHRN 647

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  197 bits (501), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 131/451 (29%), Positives = 217/451 (48%), Gaps = 22/451 (4%)

Query: 74  HDGIR--LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFV 131
           HD IR  L ++L  RH++M                                 +G +V+  
Sbjct: 50  HDKIRESLNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYLT 109

Query: 132 MSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190
           M CLGEM+ ++P+ G F SY+ ++   +  FA+   Y F   + V + LTA  LV+ YW 
Sbjct: 110 MLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYWK 169

Query: 191 DRDKVNPGVWITILL--VAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXX 248
                 P  W   LL  V ++ +N + VR +GE EY+++ +K+  +              
Sbjct: 170 SSQHNFP-YWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGH 228

Query: 249 XPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECK 308
            P+HE +GFKYW    ++KE +  + G KG    F ++FV + F+Y GTE   +   E +
Sbjct: 229 NPDHEYIGFKYW----SYKE-APFVNGFKG----FVTIFVSSAFSYGGTESITLTAGEAR 279

Query: 309 NPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVN 368
           NP +  P+ +K   +RI++FY+ ++F + M +P++ P L             PF +    
Sbjct: 280 NPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYDYPNL-----STKSVMTSPFTIIFQM 334

Query: 369 AGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKA-PRIFAKTNKQGVPYWSL 427
           AG       MNA IL  + SA N  L+  SR LY + ++    P++  KTN+   PY ++
Sbjct: 335 AGTKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAV 394

Query: 428 LVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKST 487
           ++      L +     G+  ++T+  N V +   ++W+SI +T IRF K    QG     
Sbjct: 395 ILTWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQG-KTQE 453

Query: 488 LAYQSPLQPYGAWFSLFFCILIGLIKNFPAF 518
           L +++   PYG +F + F  LI L++ + AF
Sbjct: 454 LQFKNWTYPYGPYFLVIFVTLIILVQGWSAF 484

>TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  197 bits (502), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 128/438 (29%), Positives = 207/438 (47%), Gaps = 11/438 (2%)

Query: 74  HDGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVGLLVFFVMS 133
           ++   LKKA+++RHV M                                 V  + +F++ 
Sbjct: 92  NESTELKKAMKSRHVVMMSLGTGIGTGLLVANAKGLAISGPAPLVIGYGLVSFITYFMIQ 151

Query: 134 CLGEMA-AYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVD 191
             GE+   Y  L G F  Y         GFA  +    ++  ++P +L   A+ I+YW +
Sbjct: 152 AAGELGVTYASLPGNFNVYFGTLVSRPFGFATVWLASVQWLTVIPLELITCAITIKYWTE 211

Query: 192 RDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXXXXXXXXXXXXXPN 251
             KVN  +++ I+ V ++ I+  GV+ +GE E+  +  KI ++                N
Sbjct: 212 --KVNGDIFVLIIYVFLLFIHIFGVKAYGEAEFLFNTCKILMIAGFIILSIVINVGGAGN 269

Query: 252 HEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPR 311
              +G  YW NPGAF     A   A  RF S   + V   F+Y GTEL  + V+E +NPR
Sbjct: 270 DGYIGGSYWNNPGAF-----ASDNAASRFKSICYILVTGYFSYGGTELFVLSVNEQENPR 324

Query: 312 KAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXXXXPFVVAIVNAGI 371
           K+ P+A K ++YRI+V YL+++ L+G  VP +   L+            P+V+A    G+
Sbjct: 325 KSTPQAAKHSIYRILVIYLLTMILIGFNVPHDSDQLMGSAGSSAHAS--PYVLAASLHGV 382

Query: 372 PVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGV 431
            V+PH +NA ILI + S ANS LY A R +  LA    AP+     +++G P   + V  
Sbjct: 383 KVVPHFINAVILIALISVANSSLYAAPRMMVSLAQQGFAPKFLTYVDREGRPLLGIAVCA 442

Query: 432 LFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQ 491
           +F ++ +   S    +VFT+      +  L +W +  +++IRF +A +VQG +     Y 
Sbjct: 443 VFGVIGFAASSDKEEDVFTWLAAIAGLSELFTWSAFFLSHIRFRQAMKVQGKNIKECGYL 502

Query: 492 SPLQPYGAWFSLFFCILI 509
           S    +G+   L F IL+
Sbjct: 503 SVTGIWGSIIGLCFNILV 520

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  196 bits (499), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 144/506 (28%), Positives = 235/506 (46%), Gaps = 25/506 (4%)

Query: 64  VTHTSEFDGKHDGIR--LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 121
           +T   ++D + + IR  L++AL+ RH++M                               
Sbjct: 38  LTTEEDYDPEAN-IREDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNY 96

Query: 122 XFVGLLVFFVMSCLGEMAAYIPLDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLT 180
             +G +V+  + CLGEM+ Y+P+ G F SY+ ++   +   A+ + Y F   + V + +T
Sbjct: 97  TIMGGVVYLTLLCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMT 156

Query: 181 AGALVIQYWVDRDKVNPGVWIT--ILLVAIITINFLGVRFFGEIEYYISAVKITVMXXXX 238
           A  LV+ YW D +      W    +    ++ +N + VRF+GE EY+++ +K+  +    
Sbjct: 157 ALQLVMDYW-DTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFF 215

Query: 239 XXXXXXXXXXXPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTE 298
                      P HE +GFK W +  A       + G KG    FAS+FV A FAY GTE
Sbjct: 216 ILSIVVNVGHNPQHEYIGFKNWNHGEA-----PFVDGFKG----FASLFVSASFAYGGTE 266

Query: 299 LCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLIXXXXXXXXXX 358
              +   E  NP +  PK +K   +RI+VFY+ S F + M +P++ P L           
Sbjct: 267 SITLTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYPGL-----DTKSVV 321

Query: 359 XXPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAP-RIFAKT 417
             PF +    AG       MNA I+  V SA N  L+  SR +Y + ++   P +I ++T
Sbjct: 322 TSPFTLVFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRT 381

Query: 418 NKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKA 477
           N+  VPY S+L+     LL +     G+  V+T+  N V +   ++W+ I IT IRF K 
Sbjct: 382 NRYKVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKG 441

Query: 478 FRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFXXXXXXXXX 537
              QG     L Y++   PYG +F + F   I L++ + AF  D +D  +F         
Sbjct: 442 LEKQG-KTHELRYKNWTYPYGPYFLVIFVTFIILVQGWSAF--DPWDVTNFFSYYLDLFV 498

Query: 538 XXXXXXXXKLWYKTKIIPSEEVDLVS 563
                    L+ + + +  E++D V+
Sbjct: 499 FPFCFIIWWLYKRDRFVKLEDMDFVT 524

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.142    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,357,139
Number of extensions: 1948007
Number of successful extensions: 7390
Number of sequences better than 10.0: 365
Number of HSP's gapped: 5981
Number of HSP's successfully gapped: 386
Length of query: 605
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 490
Effective length of database: 40,294,809
Effective search space: 19744456410
Effective search space used: 19744456410
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)