Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E12959gna 1ON57957929500.0
SAKL0E14806gna 1ON57857222850.0
Kwal_55.19721na 1ON57757721730.0
KLTH0E01144gna 1ON57257021310.0
ZYRO0G01474gsingletonON57254914500.0
KLTH0G10736gsingletonON56854214280.0
KLLA0E14675gsingletonON57356414280.0
KLTH0B08140gna 2ON56853814260.0
SAKL0G15136g5.112ON56955114210.0
Kwal_23.4458na 2ON56555514070.0
NCAS0D016005.112ON57653614030.0
Suva_4.38na 3ON57153813850.0
SAKL0G14762gsingletonON56555313840.0
SAKL0D01232gna 4ON57456613840.0
KNAG0K01030singletonON58150813830.0
YDL210W (UGA4)na 3ON57153813780.0
KLLA0E24993gsingletonON56857113760.0
Smik_4.30na 3ON57153813660.0
Kwal_0.16singletonON56455313570.0
NDAI0C031505.112ON57453813550.0
ZYRO0B15048gsingletonON58256713530.0
TDEL0G013705.112ON56957413500.0
Skud_4.46na 3ON57153813121e-175
KNAG0E008205.112ON57155113011e-173
ABL116Cna 4ON54455012011e-159
Ecym_4621na 4ON57253311811e-155
Skud_7.2056.205ON5625473837e-39
Suva_7.1936.205ON5635423837e-39
SAKL0A04730g6.205ON5415093792e-38
KLTH0H04444g6.205ON5325223721e-37
KLLA0C15521g6.205ON5475033703e-37
TPHA0E029206.205ON5865363713e-37
YGL077C (HNM1)6.205ON5635213695e-37
Ecym_22126.205ON5454773678e-37
CAGL0H03399g6.205ON5565213661e-36
Smik_7.2066.205ON5635453625e-36
KNAG0D051406.205ON5434933502e-34
NDAI0I011406.205ON6004773493e-34
Kpol_1033.416.205ON5865913483e-34
TBLA0A019606.205ON5945333484e-34
NCAS0D037506.205ON5694813431e-33
TDEL0G014106.205ON5535223412e-33
ZYRO0G08602g6.205ON5695033379e-33
AFL081W6.205ON5424793244e-31
KAFR0K003606.205ON5385173201e-30
Kwal_56.240096.205ON3423162881e-27
TBLA0C057401.173ON6595412662e-23
CAGL0M08272g1.173ON6215162642e-23
SAKL0C05126g1.173ON5685042517e-22
Kwal_33.138061.173ON5495172491e-21
KLTH0F04576g1.173ON5495022445e-21
ZYRO0G18700g1.173ON5915042421e-20
NCAS0B083501.173ON6125402421e-20
TPHA0E033501.173ON6475172393e-20
TDEL0G021201.173ON5935302242e-18
KAFR0G003901.173ON6075342214e-18
KLLA0A06666g1.173ON5604912197e-18
ZYRO0F00242gsingletonON5354632188e-18
Kpol_2002.701.173ON6224992152e-17
KNAG0C009801.173ON7145552153e-17
NDAI0A008901.173ON6415042143e-17
Ecym_81051.173ON5835012109e-17
Suva_11.491.173ON6194761912e-14
YNR056C (BIO5)na 5ON5615641893e-14
Smik_14.390na 5ON5545331875e-14
YKL174C (TPO5)1.173ON6184761876e-14
Skud_11.511.173ON6164811841e-13
Smik_11.551.173ON6194841822e-13
Skud_14.392na 5ON5315211742e-12
SAKL0H11484gna 5ON5604201715e-12
Suva_14.415na 5ON5325351671e-11
KLLA0B00385gna 5ON5644031671e-11
Kthe_YGOB_SAKL0H11484gna 5ON5563961644e-11
AEL125C1.173ON5755301626e-11
Kwal_55.19602na 5ON5583431591e-10
TDEL0G04830singletonON5434011563e-10
NDAI0A01340singletonON554125810.29
KLTH0F01518gna 6ON65165780.77
KNAG0L00110na 7ON571143780.78
CAGL0K10758g4.307ON16776741.0
ZYRO0G07172gna 8ON567129771.0
KLLA0A06930g1.244ON58774751.6
KNAG0D040704.195ON604317723.8
CAGL0M00154gsingletonON550129714.9
NCAS0J00140na 7ON558125706.8
Suva_2.716singletonON60367706.9
Skud_11.2751.244ON602200698.9
Kpol_543.791.244ON60535699.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E12959g
         (579 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E12959g Chr5 complement(1146299..1148038) [1740 bp, 579 aa]...  1140   0.0  
SAKL0E14806g Chr5 (1222639..1224375) [1737 bp, 578 aa] {ON} simi...   884   0.0  
Kwal_55.19721 s55 complement(95893..97626) [1734 bp, 577 aa] {ON...   841   0.0  
KLTH0E01144g Chr5 complement(113309..115027) [1719 bp, 572 aa] {...   825   0.0  
ZYRO0G01474g Chr7 complement(113623..115341) [1719 bp, 572 aa] {...   563   0.0  
KLTH0G10736g Chr7 complement(902899..904605) [1707 bp, 568 aa] {...   554   0.0  
KLLA0E14675g Chr5 (1312581..1314302) [1722 bp, 573 aa] {ON} simi...   554   0.0  
KLTH0B08140g Chr2 complement(659691..661397) [1707 bp, 568 aa] {...   553   0.0  
SAKL0G15136g Chr7 complement(1303874..1305583) [1710 bp, 569 aa]...   551   0.0  
Kwal_23.4458 s23 (729606..731303) [1698 bp, 565 aa] {ON} YDL210W...   546   0.0  
NCAS0D01600 Chr4 (299803..301533) [1731 bp, 576 aa] {ON} Anc_5.112    545   0.0  
Suva_4.38 Chr4 (72470..74185) [1716 bp, 571 aa] {ON} YDL210W (REAL)   538   0.0  
SAKL0G14762g Chr7 complement(1265378..1267075) [1698 bp, 565 aa]...   537   0.0  
SAKL0D01232g Chr4 complement(90918..92642) [1725 bp, 574 aa] {ON...   537   0.0  
KNAG0K01030 Chr11 (202385..204130) [1746 bp, 581 aa] {ON} Anc_8....   537   0.0  
YDL210W Chr4 (84270..85985) [1716 bp, 571 aa] {ON}  UGA4Permease...   535   0.0  
KLLA0E24993g Chr5 complement(2214864..2216570) [1707 bp, 568 aa]...   534   0.0  
Smik_4.30 Chr4 (62468..64183) [1716 bp, 571 aa] {ON} YDL210W (REAL)   530   0.0  
Kwal_0.16 s0 complement(7307..9001) [1695 bp, 564 aa] {ON} YDL21...   527   0.0  
NDAI0C03150 Chr3 complement(717726..719450) [1725 bp, 574 aa] {O...   526   0.0  
ZYRO0B15048g Chr2 complement(1226178..1227926) [1749 bp, 582 aa]...   525   0.0  
TDEL0G01370 Chr7 (274664..276373) [1710 bp, 569 aa] {ON} Anc_5.112    524   0.0  
Skud_4.46 Chr4 (81451..83166) [1716 bp, 571 aa] {ON} YDL210W (REAL)   509   e-175
KNAG0E00820 Chr5 (152560..154275) [1716 bp, 571 aa] {ON} Anc_5.112    505   e-173
ABL116C Chr2 complement(181138..181889,181944..182826) [1635 bp,...   467   e-159
Ecym_4621 Chr4 complement(1216034..1217752) [1719 bp, 572 aa] {O...   459   e-155
Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON...   152   7e-39
Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON...   152   7e-39
SAKL0A04730g Chr1 (432222..433847) [1626 bp, 541 aa] {ON} simila...   150   2e-38
KLTH0H04444g Chr8 (397467..399065) [1599 bp, 532 aa] {ON} simila...   147   1e-37
KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]...   147   3e-37
TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.2...   147   3e-37
YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}  ...   146   5e-37
Ecym_2212 Chr2 (417948..419585) [1638 bp, 545 aa] {ON} similar t...   145   8e-37
CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {...   145   1e-36
Smik_7.206 Chr7 complement(356650..358341) [1692 bp, 563 aa] {ON...   144   5e-36
KNAG0D05140 Chr4 complement(937630..939261) [1632 bp, 543 aa] {O...   139   2e-34
NDAI0I01140 Chr9 (276535..278337) [1803 bp, 600 aa] {ON} Anc_6.205    139   3e-34
Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa] ...   138   3e-34
TBLA0A01960 Chr1 complement(473787..475571) [1785 bp, 594 aa] {O...   138   4e-34
NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {O...   136   1e-33
TDEL0G01410 Chr7 (285255..286916) [1662 bp, 553 aa] {ON} Anc_6.2...   135   2e-33
ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {...   134   9e-33
AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic ho...   129   4e-31
KAFR0K00360 Chr11 (79233..80849) [1617 bp, 538 aa] {ON} Anc_6.20...   127   1e-30
Kwal_56.24009 s56 complement(812371..813399) [1029 bp, 342 aa] {...   115   1e-27
TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa] ...   107   2e-23
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...   106   2e-23
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...   101   7e-22
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...   100   1e-21
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    99   5e-21
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    98   1e-20
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    98   1e-20
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    97   3e-20
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    91   2e-18
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    90   4e-18
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    89   7e-18
ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar ...    89   8e-18
Kpol_2002.70 s2002 complement(159457..161325) [1869 bp, 622 aa] ...    87   2e-17
KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {O...    87   3e-17
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    87   3e-17
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    86   9e-17
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    78   2e-14
YNR056C Chr14 complement(731618..733303) [1686 bp, 561 aa] {ON} ...    77   3e-14
Smik_14.390 Chr14 complement(688421..690085) [1665 bp, 554 aa] {...    77   5e-14
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    77   6e-14
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    75   1e-13
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    75   2e-13
Skud_14.392 Chr14 complement(699671..701266) [1596 bp, 531 aa] {...    72   2e-12
SAKL0H11484g Chr8 complement(983765..985447) [1683 bp, 560 aa] {...    70   5e-12
Suva_14.415 Chr14 complement(716463..718061) [1599 bp, 532 aa] {...    69   1e-11
KLLA0B00385g Chr2 complement(25847..27541) [1695 bp, 564 aa] {ON...    69   1e-11
Kthe_YGOB_SAKL0H11484g Chr5 complement(59674..60886,60889..61346...    68   4e-11
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    67   6e-11
Kwal_55.19602 s55 (43521..45197) [1677 bp, 558 aa] {ON} YNR056C ...    66   1e-10
TDEL0G04830 Chr7 complement(891989..893620) [1632 bp, 543 aa] {O...    65   3e-10
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}               36   0.29 
KLTH0F01518g Chr6 complement(113886..115841) [1956 bp, 651 aa] {...    35   0.77 
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...    35   0.78 
CAGL0K10758g Chr11 complement(1048208..1048711) [504 bp, 167 aa]...    33   1.0  
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...    34   1.0  
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...    33   1.6  
KNAG0D04070 Chr4 (733476..735290) [1815 bp, 604 aa] {ON} Anc_4.1...    32   3.8  
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...    32   4.9  
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}       32   6.8  
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...    32   6.9  
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...    31   8.9  
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...    31   9.8  

>KLLA0E12959g Chr5 complement(1146299..1148038) [1740 bp, 579 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 579

 Score = 1140 bits (2950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/579 (96%), Positives = 560/579 (96%)

Query: 1   MGDDQESMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQ 60
           MGDDQESMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQ
Sbjct: 1   MGDDQESMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQ 60

Query: 61  VLAEIGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLI 120
           VLAEIGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLI
Sbjct: 61  VLAEIGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLI 120

Query: 121 LSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLA 180
           LSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLA
Sbjct: 121 LSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLA 180

Query: 181 QQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXX 240
           QQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFS          
Sbjct: 181 QQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSIIANVFLIIL 240

Query: 241 XXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHM 300
                    SRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHM
Sbjct: 241 FFIVLPIGVSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHM 300

Query: 301 AEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDA 360
           AEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDA
Sbjct: 301 AEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDA 360

Query: 361 LGKRWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRS 420
           LGKRWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRS
Sbjct: 361 LGKRWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRS 420

Query: 421 IWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLG 480
           IWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLG
Sbjct: 421 IWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLG 480

Query: 481 HFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRK 540
           HFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRK
Sbjct: 481 HFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRK 540

Query: 541 FYEGPKSNLTDEEFVEAVGEDAIDAMLSNYSQAHQDKLS 579
           FYEGPKSNLTDEEFVEAVGEDAIDAMLSNYSQAHQDKLS
Sbjct: 541 FYEGPKSNLTDEEFVEAVGEDAIDAMLSNYSQAHQDKLS 579

>SAKL0E14806g Chr5 (1222639..1224375) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32837 Saccharomyces cerevisiae YDL210W UGA4
           Permease that serves as a gamma-aminobutyrate (GABA)
           transport protein involved in the utilization of GABA as
           a nitrogen source catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA) localized to the
           vacuolar membrane
          Length = 578

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/572 (74%), Positives = 483/572 (84%), Gaps = 2/572 (0%)

Query: 10  KSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQVLAEIGYKE 69
            +S + + +I+   SN +IG G+V+ELR +TSAHGAPIRYIDA +ATSD QVLAEIGYKE
Sbjct: 7   STSSSTKDMISARKSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQVLAEIGYKE 66

Query: 70  ELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGE 129
           ELKRE+ST+QIFGVAFSIMGLLPSIASTMDGGL AG VGL+WGWFVAGGLIL+VGIAL E
Sbjct: 67  ELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLILTVGIALAE 126

Query: 130 LSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVV 189
           LSSSIPTAGAVYV+CYQWAP +WRK ISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVV
Sbjct: 127 LSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVV 186

Query: 190 GNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXX 249
            NPDF VTDPITYGVF AC++A+ VLTS+ S  T++LQT S                   
Sbjct: 187 SNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCFLIILFFIALPIGV 246

Query: 250 SRSDKV--SFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDA 307
           SRSDK+  SFN A +IFG  +N TDWN GWSWCINGLTPAIWTIGAYDSCLHMAEEA+DA
Sbjct: 247 SRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCLHMAEEARDA 306

Query: 308 RRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTL 367
            RAVPIGIV SI+SCWILGWLICIV+LACM+PD+N I+NSPYGQGITQVF DALGKRWTL
Sbjct: 307 VRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFYDALGKRWTL 366

Query: 368 TFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFF 427
            FLS +IICQFLMGASTV+ANSRQFWAFARDD +PFS FFKKV+    VP+R++WGSS  
Sbjct: 367 AFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPIRAVWGSSIL 426

Query: 428 SIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTAN 487
           S+ALG LCLAG+ AADALFSLSIAGMYMAL+FPI LRLTYG+KDFRPGPFY+G FWS   
Sbjct: 427 SLALGCLCLAGEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFYMGDFWSPII 486

Query: 488 GWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKS 547
            W++V FQLF ++MVMFPY +  I K+TMNYTVVIGPGFWVLSLIYY+ WQ KFYEGPKS
Sbjct: 487 NWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQSKFYEGPKS 546

Query: 548 NLTDEEFVEAVGEDAIDAMLSNYSQAHQDKLS 579
           NL+DEEF E VG+D +DA+LS+  + + D+LS
Sbjct: 547 NLSDEEFAERVGDDVLDAILSSNVEVNNDRLS 578

>Kwal_55.19721 s55 complement(95893..97626) [1734 bp, 577 aa] {ON}
           YDL210W (UGA4) - GABA-specific transport protein [contig
           159] FULL
          Length = 577

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/577 (69%), Positives = 472/577 (81%), Gaps = 4/577 (0%)

Query: 4   DQESMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQVLA 63
           D   MS SS A++ + NR  SN E+  G V ELR +TSAHGAPIR++DA SATSD QVLA
Sbjct: 2   DGNLMSASSSAMDTIKNRK-SNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQVLA 60

Query: 64  EIGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSV 123
           E+GYKEELKRE+S++QIFGVAFSIMGLLPSIAST+DGGL+AG VGL WGWF+AGGL+L++
Sbjct: 61  ELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLVLTI 120

Query: 124 GIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQI 183
           GIAL ELSSSIPTAGAVYV+CYQWAP++ RKCISYSVGFLDTLSLCASVCSIVYGLAQQI
Sbjct: 121 GIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLAQQI 180

Query: 184 LSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXX 243
           LSAV+V NP F VT+PITYGVF ACI+A+T+LTSM +K T+R+QT S             
Sbjct: 181 LSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIILFFI 240

Query: 244 XXXXXXSRSDKV--SFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMA 301
                 SRSDK+   FN   +IFG   NL+ WN GW+WCI G+ PAIWTIGAYDSCLHMA
Sbjct: 241 AVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCLHMA 300

Query: 302 EEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDAL 361
           EEA+DA RAVP GIV SIS CWI+GWLICIV+LACM+P+++ ++NS +GQG+TQ+  DAL
Sbjct: 301 EEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIYDAL 360

Query: 362 GKRWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSI 421
           GKRWTL FLS+ IICQFLMGASTV+ANSRQFWAFARDDGIPFS FFKKV   + VP+R++
Sbjct: 361 GKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPVRAV 420

Query: 422 WGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGH 481
           WGSS  S+ALG LCL G+ A+ ALFSLS+AGMYMAL+FPI LRLTYG++DFRPGPFYLG 
Sbjct: 421 WGSSALSLALGCLCLVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFYLGD 480

Query: 482 FWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKF 541
            WS    W+AVF Q F ++M+MFP D + +   TMNYTVVIGPGFWVLSLIYYFVWQRKF
Sbjct: 481 VWSPIINWIAVFAQAFMIIMMMFPSDAT-VDPSTMNYTVVIGPGFWVLSLIYYFVWQRKF 539

Query: 542 YEGPKSNLTDEEFVEAVGEDAIDAMLSNYSQAHQDKL 578
           Y+GPKSNLTDEEF E VGED IDA++SN     +D++
Sbjct: 540 YQGPKSNLTDEEFQEYVGEDVIDAIISNNVATQKDRM 576

>KLTH0E01144g Chr5 complement(113309..115027) [1719 bp, 572 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W Permease that serves as a gamma- aminobutyrate
           (GABA) transport protein involved in the utilization of
           GABA as a nitrogen source; catalyzes the transport of
           putrescine and delta-aminolevulinic acid (ALA);
           localized to the vacuolar membrane
          Length = 572

 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/570 (70%), Positives = 468/570 (82%), Gaps = 4/570 (0%)

Query: 8   MSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQVLAEIGY 67
           MS SS     + NR  S+ ++  G + EL  +TSAHGAPIR++DA SATSD QVLAE+GY
Sbjct: 1   MSASSSNKGTIKNRK-SHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQVLAELGY 59

Query: 68  KEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIAL 127
           KEELKRE+S++QIFGVAFSIMGLLPSIAST+DGGL+AG VGL WGWF+AGGLIL++GIAL
Sbjct: 60  KEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLILTIGIAL 119

Query: 128 GELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAV 187
           GELSS++PTAGAVYV+CYQWAP++ RKCISYSVGFLDTLSL ASVCSIVYGLAQQILSAV
Sbjct: 120 GELSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLAQQILSAV 179

Query: 188 VVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXX 247
           +V NPDF  TDPITYGVF ACIV + +LTS+ S+IT++LQT S                 
Sbjct: 180 LVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVLFFIAIPI 239

Query: 248 XXSRSDKV--SFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAK 305
             SRSD +  SFN   +IFG V N + WN GW+WCI GL PAIWTIGAYDSCLHMAEEA+
Sbjct: 240 GVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCLHMAEEAR 299

Query: 306 DARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRW 365
           DA RAVP GIV SI+ CWILGWL+CIVILACMNPD++++++S +GQ +TQ+  DALGKRW
Sbjct: 300 DAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIYDALGKRW 359

Query: 366 TLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSS 425
           TL FLS+ IICQFLMGASTV+ANSRQFWAFARDDG PFS FFKKVD  + VP+R++WGSS
Sbjct: 360 TLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPVRAVWGSS 419

Query: 426 FFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWST 485
             S+ALG LCL G+TA+ ALFSLS+AGMYMAL+FPI LRLTYG+KDFRPGPFYLG FWS 
Sbjct: 420 ALSLALGCLCLVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFYLGDFWSP 479

Query: 486 ANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGP 545
              W++VFFQ F ++M+MFP D S +T  TMNYTVVIGPGFWVLSLIYYFVWQRKFY+GP
Sbjct: 480 IINWISVFFQAFVIIMMMFPSD-STVTPTTMNYTVVIGPGFWVLSLIYYFVWQRKFYKGP 538

Query: 546 KSNLTDEEFVEAVGEDAIDAMLSNYSQAHQ 575
           KSNLTDEEF E VG+D IDA++SN    ++
Sbjct: 539 KSNLTDEEFQEYVGDDVIDAIMSNNEADYK 568

>ZYRO0G01474g Chr7 complement(113623..115341) [1719 bp, 572 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 572

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/549 (50%), Positives = 379/549 (69%), Gaps = 4/549 (0%)

Query: 30  FGSVSELRVVTSAHGA-PIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIM 88
           + S   +R + S  GA  + YI+A ++  D Q+LAEIGYK EL+R++ST+Q+FG+AFSIM
Sbjct: 23  YTSAGRIRSIRSRTGAGEVNYINAATSNDDNQLLAEIGYKPELERKFSTLQVFGIAFSIM 82

Query: 89  GLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWA 148
           GLLPSIAS +D GLA G V   WGWF+AG  I  VG+ + E SS+IPTAG +Y   Y +A
Sbjct: 83  GLLPSIASELDDGLAGGPVSTVWGWFIAGIFIFLVGVTMAENSSAIPTAGGLYFWTYHYA 142

Query: 149 PEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG-NPDFEVTDPITYGVFCA 207
           PE ++  IS+ +G  ++L+L A VCSI YG A+++L+AVVV  + ++++T    YGV+  
Sbjct: 143 PEGYKAAISFVIGIGNSLALAAGVCSIDYGFAEEVLAAVVVSKDGNWDITQGKLYGVYAG 202

Query: 208 CIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDV 267
           C++   ++T + S   A++Q+ S                   ++ ++  FN  S+IFG  
Sbjct: 203 CVILTIMVTCVASGWLAKMQSISIYSNLFIIVLFLIALPIG-TKVNRGGFNDGSFIFGKF 261

Query: 268 QNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGW 327
           +NL+DW+ GW + + G TP +WTI ++DSC+H AEEAKDA +AVPIGI+ SI  CWILGW
Sbjct: 262 ENLSDWSNGWQFFLAGFTPIVWTISSFDSCVHQAEEAKDASKAVPIGIMGSIFVCWILGW 321

Query: 328 LICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQFLMGASTVLA 387
           +I IV++AC++ D+N ++NSPY  G+ Q+  D+LGK WT+ FL+L+  CQFLMGAS++ A
Sbjct: 322 VINIVLMACIDKDMNRVMNSPYQLGMAQIIFDSLGKNWTIAFLALMAFCQFLMGASSMTA 381

Query: 388 NSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFS 447
            SRQ WAFARDDG+P S   KKVD + HVP  +   S   S+ LG L L  D AA+ALFS
Sbjct: 382 ASRQIWAFARDDGMPLSNILKKVDSKFHVPFYASICSGLMSLVLGLLILIDDAAAEALFS 441

Query: 448 LSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYD 507
           L+IAG Y+A V P  LRLT+GR  FRPGPFYLG FWS    W  V F  F ++MVMFP  
Sbjct: 442 LAIAGNYLAWVTPNFLRLTWGRDVFRPGPFYLGKFWSPVVNWTTVVFMAFIIIMVMFPTQ 501

Query: 508 KSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVGEDAIDAML 567
           K+GI KE MNY  VIGPG W+LSLIYY+V+++K Y GPKSNL DEE+ +AVG + +DA+L
Sbjct: 502 KNGINKENMNYACVIGPGTWLLSLIYYWVYKKKEYHGPKSNLDDEEYADAVGPEVLDAIL 561

Query: 568 S-NYSQAHQ 575
           S +YS  ++
Sbjct: 562 STDYSTGYK 570

>KLTH0G10736g Chr7 complement(902899..904605) [1707 bp, 568 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a gamma-
           aminobutyrate (GABA) transport protein involved in the
           utilization of GABA as a nitrogen source catalyzes the
           transport of putrescine and delta-aminolevulinic acid
           (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/542 (49%), Positives = 375/542 (69%), Gaps = 1/542 (0%)

Query: 29  GFGSVSELRVVTSAHGAPIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIM 88
           G      LR +TS     + +IDA  A  D+++LAEIGYK+EL R +ST+Q+FGVAFSIM
Sbjct: 23  GLHQFGSLRTITSKRAGEVNFIDAKGANGDSELLAEIGYKQELNRHFSTIQVFGVAFSIM 82

Query: 89  GLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWA 148
           GLLPSIAS +  G+  G V L WGW +AG  IL+VG  + EL+S+IPT+G +Y   Y ++
Sbjct: 83  GLLPSIASVLAIGMPGGMVSLMWGWLIAGIFILAVGCGMAELASAIPTSGGLYYYTYYYS 142

Query: 149 PEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG-NPDFEVTDPITYGVFCA 207
           PEK++  +S+ +G  ++L+L A +CSI YGLAQ+ILS VVV  + DF +T   TYGVF A
Sbjct: 143 PEKYKAFLSFVIGNTNSLALVAGLCSITYGLAQEILSIVVVAKDGDFNITSGKTYGVFVA 202

Query: 208 CIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDV 267
            I A T +TS+ +   ++LQT S                   + +  ++FN  S+IFG  
Sbjct: 203 GIAATTAVTSLATVAVSKLQTVSILANVGLIVLFFIVLPIGVANTKGLNFNDGSFIFGKW 262

Query: 268 QNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGW 327
           QN T W  GW + + GL PAIWTIGA+DSC+HM+EEAK+A +AVP+GI++SI  CWILG+
Sbjct: 263 QNETSWPDGWQFMMAGLQPAIWTIGAFDSCIHMSEEAKNATKAVPVGIISSIGVCWILGF 322

Query: 328 LICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQFLMGASTVLA 387
           ++CIVI ACM P+++AI+ S YG  + Q+  +ALGK+WT+ F++LI  CQFLMG S + A
Sbjct: 323 IVCIVIAACMGPNIDAILESSYGSPLPQILFNALGKKWTIAFMTLIAACQFLMGCSILTA 382

Query: 388 NSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFS 447
            SRQ WAFARDDG+ FS++ K V+++   P+R+ W  +  ++ +G LCL G TA++ALFS
Sbjct: 383 ISRQIWAFARDDGLMFSRYIKVVNKKLSSPLRATWFGALCALVIGLLCLIGSTASNALFS 442

Query: 448 LSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYD 507
           L+I G Y+A + P  LR+T G+  FRPG F++G  WS    W+A+ FQ F ++M+MFP D
Sbjct: 443 LAIGGNYVAWMTPNLLRMTVGKDLFRPGAFFMGKLWSPIVNWIAIIFQTFILIMIMFPAD 502

Query: 508 KSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVGEDAIDAML 567
              IT +TMNYTVVI  G W+ S++Y+ V+++K + GPKSNL+DEE+ +AVG+D ID +L
Sbjct: 503 SKDITPDTMNYTVVICGGVWIGSIVYFLVYKKKAFHGPKSNLSDEEYADAVGQDVIDQIL 562

Query: 568 SN 569
           S+
Sbjct: 563 SH 564

>KLLA0E14675g Chr5 (1312581..1314302) [1722 bp, 573 aa] {ON} similar
           to uniprot|P32837 Saccharomyces cerevisiae YDL210W UGA4
           Permease that serves as a gamma-aminobutyrate (GABA)
           transport protein involved in the utilization of GABA as
           a nitrogen source catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA) localized to the
           vacuolar membrane
          Length = 573

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/564 (48%), Positives = 383/564 (67%), Gaps = 6/564 (1%)

Query: 12  SGAVEHLINRNN---SNDEIG--FGSVSELRVVTSAHGAPIRYIDALSATSDTQVLAEIG 66
           S +V  L ++NN   ++ E+      V+ LR +TS     + YI+A +A  DT++LAEIG
Sbjct: 2   SDSVSSLSDKNNFVITSQEVKNRVDVVTSLRTITSRRVGDVNYINAKTAHDDTELLAEIG 61

Query: 67  YKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIA 126
           YK+EL+R +S  Q+FGVAFSIMGLLPSIAS +   L  G+V L WGW ++G  +L+ G+A
Sbjct: 62  YKQELQRHFSKTQVFGVAFSIMGLLPSIASILGVALPGGSVSLVWGWAISGAFVLANGLA 121

Query: 127 LGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSA 186
           + EL+S+IPT+G +Y   + +AP K +  +S+ VG  ++L+L + +CSI YGLA +ILS 
Sbjct: 122 MSELASAIPTSGGLYYYTHYYAPPKVKNFLSFIVGNCNSLALISCLCSINYGLAGEILSI 181

Query: 187 VVVG-NPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXX 245
           VVVG N +F +T+  TYGV+ ACI+A  V+TS+ +   +RLQTFS               
Sbjct: 182 VVVGSNGNFNITNANTYGVYAACIIATAVVTSVATTAVSRLQTFSIVSNLLLICIFFVVL 241

Query: 246 XXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAK 305
               +RS  + FN A+YIFGD +NL+DWN GW + + G  P IW IG +DSCLHM+EEAK
Sbjct: 242 PVGVARSKDMEFNDAAYIFGDFENLSDWNNGWQFMLAGFQPLIWVIGGFDSCLHMSEEAK 301

Query: 306 DARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRW 365
           +A  +VP GI+ SIS CW LG+ ICIVI AC + DV A+VN+ + Q + QV  DALGK+W
Sbjct: 302 NATASVPFGIIGSISVCWFLGFFICIVIAACSSQDVAALVNTKFHQPLAQVLFDALGKKW 361

Query: 366 TLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSS 425
           T+  ++LI  CQFLM AS++ A SRQ WAFARDDG+PFS + K V+ +   P+R+ W  +
Sbjct: 362 TIAIMTLIAFCQFLMAASSLTAISRQIWAFARDDGLPFSSWIKVVNVKLSSPLRATWVGA 421

Query: 426 FFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWST 485
             ++A+G LCL G  A+ ALFSL I+  Y + + P  LR+TYG+  F PG F++G + S 
Sbjct: 422 GVALAIGCLCLIGPVASSALFSLYISANYFSWMLPNLLRMTYGKDVFTPGAFFMGKYLSP 481

Query: 486 ANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGP 545
              W+++ F+LF +L+V FP ++ GIT +TMNY+VV     W L+ IYYF+++ KFY+GP
Sbjct: 482 VVNWISIIFELFMILLVFFPTEQHGITPDTMNYSVVFIGAVWFLATIYYFIYKHKFYKGP 541

Query: 546 KSNLTDEEFVEAVGEDAIDAMLSN 569
           KSNLTDEE+ E VG+D +DA+LS 
Sbjct: 542 KSNLTDEEYEENVGQDVLDAILSK 565

>KLTH0B08140g Chr2 complement(659691..661397) [1707 bp, 568 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a gamma-
           aminobutyrate (GABA) transport protein involved in the
           utilization of GABA as a nitrogen source catalyzes the
           transport of putrescine and delta-aminolevulinic acid
           (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/538 (50%), Positives = 376/538 (69%), Gaps = 1/538 (0%)

Query: 33  VSELRVVTSAHGAPIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIMGLLP 92
           +  LR +TS     + +IDA  A  D ++LAEIGYK+EL R +STVQ+FGVAFSIMGLLP
Sbjct: 27  IGSLRTITSKRAGEVNFIDAKRAHGDAELLAEIGYKQELNRHFSTVQVFGVAFSIMGLLP 86

Query: 93  SIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKW 152
           SIAS +  G+  G V L WGWF+AG  IL+VG  + EL+S+IPT+G +Y   Y +AP+K+
Sbjct: 87  SIASVLAIGMPGGMVSLVWGWFIAGIFILAVGCGMSELASAIPTSGGLYYYTYYYAPQKY 146

Query: 153 RKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG-NPDFEVTDPITYGVFCACIVA 211
           +   S+ +G+ ++L+L + +CSI YGLA++ILS VVV  + DF +T+  TYGVF A I A
Sbjct: 147 KAFFSFVIGYSNSLALVSGLCSITYGLAEEILSIVVVSKDGDFTITNGKTYGVFVAGIAA 206

Query: 212 ITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLT 271
            TV+TS+ +   ++LQT S                   + +  + FN  S+IFG   N T
Sbjct: 207 TTVVTSIATVAVSKLQTVSILANVGLIVLFFIVLPIGVANTKGLDFNDGSFIFGKWLNET 266

Query: 272 DWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICI 331
            W  GW + + GL PAIWTIGA+DSC+HM+EEAK+A +AVP+GI++SIS CWILG+LICI
Sbjct: 267 TWPDGWQFMLAGLQPAIWTIGAFDSCIHMSEEAKNATKAVPLGIISSISVCWILGFLICI 326

Query: 332 VILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQFLMGASTVLANSRQ 391
           V+ ACM PD++AI+ S +G  + Q+  +ALGK+WT+  ++LI  CQFLMG S + A SRQ
Sbjct: 327 VMAACMGPDIDAILGSSFGSPLPQILYNALGKKWTIAIMTLIAACQFLMGCSILTAISRQ 386

Query: 392 FWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIA 451
            WAFARDDG+ FSK+ K V+++   P+R+ W  +  ++ +G LCL G TA++ALFSL I 
Sbjct: 387 IWAFARDDGLMFSKYIKVVNKKLSSPLRATWFGAVCALVIGLLCLIGGTASNALFSLGIG 446

Query: 452 GMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGI 511
           G Y+A + P  LR+T G+  FRPG FY+G  WS    W A+ FQ+F ++M+MFP +  GI
Sbjct: 447 GNYLAWMAPNLLRMTTGKDLFRPGAFYMGKTWSPIVNWTAIVFQIFILIMIMFPAESKGI 506

Query: 512 TKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVGEDAIDAMLSN 569
           T + MNYTVVI  G W+ S+IY+FV+++K + GPKSNL+D+E+V+AVG+D ID +LS+
Sbjct: 507 TPDAMNYTVVICGGVWIGSMIYFFVYKKKAFNGPKSNLSDDEYVDAVGQDVIDQILSH 564

>SAKL0G15136g Chr7 complement(1303874..1305583) [1710 bp, 569 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 569

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/551 (51%), Positives = 384/551 (69%), Gaps = 4/551 (0%)

Query: 20  NRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQVLAEIGYKEELKREYSTVQ 79
           ++  ++D     SV  +R  T A    + YI+A +A  D Q+LAEIGYK+ELKR++ST+Q
Sbjct: 17  DKGTTSDLQNLHSVRSVRSRTGA--GEVNYINAATANDDNQLLAEIGYKQELKRQFSTLQ 74

Query: 80  IFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGA 139
           +FG+AFSIMGLLPSIAS M GGL+ G V L WGWF+AG  IL +G+++ E +S+IPTAG 
Sbjct: 75  VFGIAFSIMGLLPSIASVMAGGLSGGPVTLVWGWFIAGFFILLIGLSMAENASAIPTAGG 134

Query: 140 VYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG-NPDFEVTD 198
           +Y   + +APE ++  IS+ +G  ++L+L + VCSI YGLA++IL+AVV+  + DFEVT 
Sbjct: 135 LYYWTHYYAPEGYKNVISFVIGCSNSLALVSGVCSIDYGLAEEILAAVVISKDGDFEVTS 194

Query: 199 PITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFN 258
             TYGVF A + A+ + T + S   +RLQT S                    R +   FN
Sbjct: 195 GKTYGVFVAAVFAMILCTCLASSAISRLQTTSIVANCFIIILLFIALPIGTKR-NMGGFN 253

Query: 259 KASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVAS 318
            ASYIFG  +N +DWN GW +C+ G    +WTIGA+DSC+H +EEAKDA++AVPIGI+ S
Sbjct: 254 DASYIFGKFENFSDWNNGWQFCLQGFMTCVWTIGAFDSCVHQSEEAKDAKKAVPIGIIGS 313

Query: 319 ISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQF 378
           I+ CWILGWLI IV++AC++PD+  ++++PYG  + Q+  ++LGK W + F+SLI  CQF
Sbjct: 314 ITVCWILGWLILIVLMACVDPDLEKVLDNPYGFVLAQIVYESLGKSWAIAFMSLIAACQF 373

Query: 379 LMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAG 438
           LMGAS + A SRQ WAFARDDG+P SK+ K V+ER  VP+ ++W     S+ LG LCL  
Sbjct: 374 LMGASILTAVSRQIWAFARDDGLPLSKYIKMVNERLSVPIVAVWAGGLASVVLGLLCLID 433

Query: 439 DTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFA 498
             AA ALFSL++AG Y++   P  LRLT+GR  FRPGPFYLG FWS    W +V FQ F 
Sbjct: 434 SAAASALFSLAVAGNYLSWGTPTLLRLTFGRDIFRPGPFYLGKFWSPIVNWTSVLFQAFI 493

Query: 499 VLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAV 558
           +++VMFP  + GITK TMNY  VIGPG W+L+ +YY V+++K+Y GPKSNLTDEE+V+AV
Sbjct: 494 IVVVMFPASQHGITKSTMNYACVIGPGIWILAWVYYMVYKKKYYHGPKSNLTDEEYVDAV 553

Query: 559 GEDAIDAMLSN 569
           G   ID MLSN
Sbjct: 554 GSIVIDEMLSN 564

>Kwal_23.4458 s23 (729606..731303) [1698 bp, 565 aa] {ON} YDL210W
           (UGA4) - 1:1 [contig 2] FULL
          Length = 565

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/555 (49%), Positives = 379/555 (68%), Gaps = 4/555 (0%)

Query: 19  INRNNSNDEIGFGSVSE---LRVVTSAHGAPIRYIDALSATSDTQVLAEIGYKEELKREY 75
           +N +  + + G G + +   LR +TS     + +IDA  A  D ++LAEIGYK+EL R +
Sbjct: 7   VNVSEGSAQSGLGEIRQIGSLRTITSKRAGEVNFIDAKGARDDKELLAEIGYKQELNRHF 66

Query: 76  STVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIP 135
           STVQ+FGVAFSIMGLLPSIAS +  G A GAV L WGW +AG  I+++G+++ EL+S+IP
Sbjct: 67  STVQVFGVAFSIMGLLPSIASVLSIGFAGGAVALVWGWLIAGFFIMTIGLSMAELASAIP 126

Query: 136 TAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG-NPDF 194
           T+G +Y   Y +AP++++  +S+ +G  ++L+L A +CSI YGLA +ILS VVV  + +F
Sbjct: 127 TSGGLYYYTYYYAPQRFKSFLSFVIGNSNSLALTAGLCSITYGLALEILSIVVVSKDGNF 186

Query: 195 EVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDK 254
           E+T+  TYGV+   I A  V+TS+ +   +++QT S                   S +  
Sbjct: 187 EITNGKTYGVYVGGIAATAVVTSVATVAVSKMQTLSIISNVALIAFFLIVLPIGVSNTKG 246

Query: 255 VSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIG 314
           + FN  S+IFG   N T W  GW + + GL PAIWTIGA+DSC+HM+EEAK+A +AVPIG
Sbjct: 247 LEFNDGSFIFGKFMNETSWPDGWQFLMAGLQPAIWTIGAFDSCIHMSEEAKNATKAVPIG 306

Query: 315 IVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLII 374
           I++SI  CW+LG+ ICI I ACM PD++AI+ S +G  + Q+  +ALGK+WT+TF+SLI 
Sbjct: 307 IISSIFVCWVLGFFICIAIAACMGPDIDAILGSSFGSPLAQILYNALGKKWTITFMSLIA 366

Query: 375 ICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGAL 434
            CQF MG S + A SRQ WAFARDDG+ F K+FK V+++   P+R+ W  +  ++ +G L
Sbjct: 367 FCQFAMGCSILTAISRQIWAFARDDGLMFPKYFKVVNKKLSSPIRATWFGAACALVIGLL 426

Query: 435 CLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFF 494
           CL G TAA+ALFSL I G Y+A + P  LR+T G+  FRPG F++G FWS    W ++ F
Sbjct: 427 CLIGGTAANALFSLGIGGNYLAWMTPNLLRMTVGKDLFRPGQFHMGEFWSPIVNWTSIVF 486

Query: 495 QLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEF 554
           Q+F + M+MFP +K GIT +TMNYTVVI  G W  S+IYY V++ K + GPKSNLTDEEF
Sbjct: 487 QIFIIFMIMFPAEKVGITPDTMNYTVVICGGVWFGSMIYYAVYKYKVFHGPKSNLTDEEF 546

Query: 555 VEAVGEDAIDAMLSN 569
            E VG+D ID +LS+
Sbjct: 547 SEVVGQDVIDQILSH 561

>NCAS0D01600 Chr4 (299803..301533) [1731 bp, 576 aa] {ON} Anc_5.112
          Length = 576

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/536 (48%), Positives = 370/536 (69%), Gaps = 3/536 (0%)

Query: 34  SELRVVTSAHGA-PIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIMGLLP 92
           S +R + S  GA  + YI++ ++ +D Q+LAEIGYK+ELKR++ST Q+FG+AFSIMGLLP
Sbjct: 37  SHIRSIRSKTGAGEVNYINSATSVTDNQLLAEIGYKQELKRQFSTFQVFGIAFSIMGLLP 96

Query: 93  SIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKW 152
           SIAS M  G++ G     WGWF+A    + +GI++ E +S+IPTAG +Y   Y +APE +
Sbjct: 97  SIASVMGTGISGGPTTFVWGWFIASIFTIFIGISMAENASAIPTAGGLYYWTYYYAPEGF 156

Query: 153 RKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG-NPDFEVTDPITYGVFCACIVA 211
           +K IS+ +G  ++L+L A +CSI YGLA++I++AVV+  + DF+VT    YG+F A +V 
Sbjct: 157 KKVISFVIGCSNSLALAAGLCSIDYGLAEEIMAAVVLTFDGDFDVTSGKLYGIFAAAVVV 216

Query: 212 ITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLT 271
           + + T ++S   AR+Q+FS                    R ++  FN A +IFG  +N +
Sbjct: 217 MGICTCISSGAIARMQSFSIASNLFIIVLLFIALPIGTKR-NRGEFNDAKFIFGKFENFS 275

Query: 272 DWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICI 331
           DWN+GW +C+ G  PA+WTIG++DSC+H +EEAKDA+++VPIGI+ASI++CWILGWLI I
Sbjct: 276 DWNSGWQFCMAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIIASIAACWILGWLIII 335

Query: 332 VILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQFLMGASTVLANSRQ 391
           V++AC++P++  +V++ YG  + Q+  D+LGKRW +TF+SL+  CQFLMG S   A SRQ
Sbjct: 336 VLMACIDPNLENVVDTKYGFPMAQLIYDSLGKRWAITFMSLMAFCQFLMGCSICTAISRQ 395

Query: 392 FWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIA 451
            WAF+RDDG+P SK+ K VD+R  VP  +I  +    + LG LCL   TAA+ALFSL++A
Sbjct: 396 IWAFSRDDGLPLSKYIKIVDKRYSVPFNAIIAACVTCLVLGLLCLIDSTAANALFSLAVA 455

Query: 452 GMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGI 511
           G Y+A   P  LR T GR  FRPGPFYLG   S   GW  + ++ F ++MVMFP  K+GI
Sbjct: 456 GNYLAWSIPTLLRFTTGRDLFRPGPFYLGKPLSAIVGWTGICYEFFIIIMVMFPTQKNGI 515

Query: 512 TKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVGEDAIDAML 567
            K  MNY  VIGPG W LS IYY  +++K++ GPK+NL+++++ E V  D ID ++
Sbjct: 516 NKTNMNYACVIGPGIWFLSWIYYIAYKKKYFRGPKTNLSEDDYEEMVAIDNIDEIM 571

>Suva_4.38 Chr4 (72470..74185) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/538 (50%), Positives = 370/538 (68%), Gaps = 3/538 (0%)

Query: 34  SELRVVTSAHGA-PIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIMGLLP 92
           S LR + S  GA  + YI+A  + +D Q+LAEIGYK+ELKR++ST+Q+FG+AFSIMGLLP
Sbjct: 32  SNLRSIRSKTGAGEVNYINASKSVNDHQLLAEIGYKQELKRQFSTLQVFGIAFSIMGLLP 91

Query: 93  SIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKW 152
           SIAS M GGL  G   L WGWFVAG  +L VG+++ E +S+IPTAG +Y   Y +APE +
Sbjct: 92  SIASVMGGGLDGGPASLLWGWFVAGFFLLLVGMSMAEHASAIPTAGGLYYWTYYYAPEGY 151

Query: 153 RKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVV-GNPDFEVTDPITYGVFCACIVA 211
           ++ IS+ +G  ++L+L A VCSI YGLA++I +AV +  + +F+VT  + YG+F   +V 
Sbjct: 152 KEIISFIIGCSNSLALTAGVCSINYGLAEEIAAAVTLTKDGNFDVTRGMLYGIFAGAVVL 211

Query: 212 ITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLT 271
           + + T + S   ARLQT S                    R +   FN   +IFG  +N +
Sbjct: 212 MGLCTCIASGGIARLQTLSIASNVFIIILLFIALPIGTKR-NMGGFNNGDFIFGKFENFS 270

Query: 272 DWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICI 331
           DWN GW +C+ G  PA+WTI ++DSC+H +EEAKDA+++VPIGI+ SI  CWILGW I I
Sbjct: 271 DWNNGWQFCLAGFMPAVWTINSFDSCVHQSEEAKDAKKSVPIGIILSILVCWILGWFIII 330

Query: 332 VILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQFLMGASTVLANSRQ 391
            +LAC+NPD+ ++++S YG  + Q+  D+LGK+W + F+SLI  CQFLMGAS   A SRQ
Sbjct: 331 CLLACINPDLASVLDSKYGFALAQIIYDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQ 390

Query: 392 FWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIA 451
            WAF+RD+G+P SK+ KKVD +  VP  +I  +   S+ LG LCL    A +ALFSL++A
Sbjct: 391 VWAFSRDNGLPLSKYIKKVDSKYSVPFYAILAACVCSLVLGLLCLIDQAATNALFSLAVA 450

Query: 452 GMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGI 511
           G  +A   P  LRLT G+  FRPGPFYLG FWS    W+ V FQ+F ++MVMFP  + GI
Sbjct: 451 GNNLAWSTPTVLRLTSGKDLFRPGPFYLGKFWSPIVAWVGVAFQVFIIVMVMFPAQQKGI 510

Query: 512 TKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVGEDAIDAMLSN 569
           TK TMNYT VIGPG W+L+ IYY V+++K+Y GP +NL+DE++V+AVG D ID ++S 
Sbjct: 511 TKATMNYTCVIGPGIWILAGIYYKVYKKKYYHGPATNLSDEDYVDAVGVDVIDTIISK 568

>SAKL0G14762g Chr7 complement(1265378..1267075) [1698 bp, 565 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 565

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/553 (50%), Positives = 385/553 (69%), Gaps = 3/553 (0%)

Query: 26  DEIGFGSVSELRVVTSAHGA-PIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVA 84
           + +    ++ LR V S  GA  + YI+A +A  D Q+LAEIGYK+ELKR++ST+Q+FG+A
Sbjct: 8   NSLSIQEIAALRSVRSRTGAGEVNYINAATANDDNQLLAEIGYKQELKRQFSTLQVFGIA 67

Query: 85  FSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVAC 144
           FSIMGLLPSIAS M GGL+ G V L WGWF+AG  IL +G+++ E +S+IPTAG ++   
Sbjct: 68  FSIMGLLPSIASVMAGGLSGGPVTLVWGWFIAGFFILLIGLSMAESASAIPTAGGLFYWT 127

Query: 145 YQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG-NPDFEVTDPITYG 203
           + +APE ++  IS+ +G  ++L+L + +CSI YGLAQ+IL+AVV+  + DFEVT   TYG
Sbjct: 128 HYYAPEGYKNVISFIIGCSNSLALVSGLCSIDYGLAQEILAAVVISKDGDFEVTSGKTYG 187

Query: 204 VFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYI 263
           VF A +V   + T + S   +RLQT S                    R +   FN ASYI
Sbjct: 188 VFAAAVVVTVLCTCLASSAISRLQTASIVANCFIIILLFIALPIGTKR-NMGGFNDASYI 246

Query: 264 FGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCW 323
           FG  +N +DWN GWS+C+ G  P IWTIGA+DSC+H +EEAKDA++AVPIGI+ SI+ CW
Sbjct: 247 FGKFENFSDWNDGWSFCLQGFMPVIWTIGAFDSCVHQSEEAKDAKKAVPIGIIGSITVCW 306

Query: 324 ILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQFLMGAS 383
           ILGWLI IV++AC++PD+  ++++PYG  + Q+  ++LGK W + F+SLI +CQFLMGAS
Sbjct: 307 ILGWLILIVLMACVDPDLEKVLDNPYGFVLAQIVYESLGKSWAIAFMSLIAVCQFLMGAS 366

Query: 384 TVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAAD 443
            + A SRQ WAFARDDG+P SK+ K V     VP+ ++W +    + LG LCL    AA 
Sbjct: 367 VLTALSRQVWAFARDDGLPLSKYIKMVHTNWSVPIVAVWVAGCAGLVLGLLCLIDAAAAS 426

Query: 444 ALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVM 503
           ALFSL++AG Y++   P  LRLT+G+  FRPGPFYLG FWS    W +V FQ F +++VM
Sbjct: 427 ALFSLAVAGNYLSWGTPTLLRLTFGKDIFRPGPFYLGKFWSPIINWTSVIFQAFIIILVM 486

Query: 504 FPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVGEDAI 563
           FP  + G+ K TMNY  VIGPG W+L+ IYY ++++K+Y GPKSNLTDEE+VEAVG + I
Sbjct: 487 FPASQHGVDKSTMNYACVIGPGIWILAWIYYMIYKKKYYHGPKSNLTDEEYVEAVGSNVI 546

Query: 564 DAMLSNYSQAHQD 576
           D +LSN  +  +D
Sbjct: 547 DEILSNTERTSKD 559

>SAKL0D01232g Chr4 complement(90918..92642) [1725 bp, 574 aa] {ON}
           similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 574

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/566 (47%), Positives = 388/566 (68%), Gaps = 3/566 (0%)

Query: 5   QESMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQVLAE 64
           +++  K+S    H I   N+N E+    ++ LR +TS     + YI+A +A  DT++LAE
Sbjct: 9   EKNQIKTSARELHPIVSANANGEVQ--QITSLRTITSKRAGEVNYINAKAAHDDTELLAE 66

Query: 65  IGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVG 124
           IGYK+EL R +ST+Q+FG+AFSIMGLLPSIAS +    A GA+ L WGW ++G  ILSVG
Sbjct: 67  IGYKQELNRHFSTIQVFGIAFSIMGLLPSIASILGMAFAGGAISLVWGWLISGAFILSVG 126

Query: 125 IALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQIL 184
             + EL+S+IPT+G +Y   Y +AP K++K +S+ +G  ++L+L A +CSI YGLAQ+IL
Sbjct: 127 AGMAELASAIPTSGGLYYYTYYYAPPKFKKVLSFLIGNSNSLALIACLCSIDYGLAQEIL 186

Query: 185 SAVVVG-NPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXX 243
           S VV+  + DFE+T+  TYGV+  CI+A T+LTS+ +   ++LQTFS             
Sbjct: 187 SIVVISKDGDFEITNAKTYGVYAGCIIATTLLTSVATVAVSKLQTFSIVSNVLLIIFFLI 246

Query: 244 XXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEE 303
                 S+SD V+FN   +IFG+ +N  DW  GW + + G  P +W IGA+DSC+HM+EE
Sbjct: 247 VLPIGVSQSDDVTFNGGKFIFGNFENFGDWADGWEFMVAGFQPCVWVIGAFDSCIHMSEE 306

Query: 304 AKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGK 363
           AK+A +AVPIGI+ SIS CWI+G+ I I I+ACM  +++AI+++ YGQ + Q+  +ALGK
Sbjct: 307 AKNATKAVPIGILTSISVCWIVGFFISIAIVACMGSNISAILDTVYGQPLAQILYNALGK 366

Query: 364 RWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWG 423
           +W +TF++LI  CQF+MGAST+ A SRQ WAFARDDG+PFS + KKV+ +   P+R+ W 
Sbjct: 367 KWAMTFMTLIAFCQFIMGASTLTAISRQIWAFARDDGLPFSWWIKKVNTKLSSPLRATWF 426

Query: 424 SSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFW 483
               ++ +G LCL G TA+ ALFS+ IA  Y A + P  LR+T G++ F PG FY+G+FW
Sbjct: 427 GGAGALCIGLLCLIGSTASAALFSMYIAANYFAWMTPNLLRMTTGKEIFSPGAFYMGNFW 486

Query: 484 STANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYE 543
           S    W ++ F++F ++M+MFP  +  IT +TMNYT V     W  S+ YY+ ++ + + 
Sbjct: 487 SPVINWTSIIFEIFIIIMMMFPSSQHNITADTMNYTCVFVGFVWFGSIAYYYFYKHRTFH 546

Query: 544 GPKSNLTDEEFVEAVGEDAIDAMLSN 569
           GPKSNLTD+EFV+AVG+D ID +LSN
Sbjct: 547 GPKSNLTDDEFVDAVGQDVIDEILSN 572

>KNAG0K01030 Chr11 (202385..204130) [1746 bp, 581 aa] {ON} Anc_8.468
           YDL210W
          Length = 581

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/508 (51%), Positives = 354/508 (69%), Gaps = 3/508 (0%)

Query: 34  SELRVVTSAHGA-PIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIMGLLP 92
           S +R V S  GA  + +IDA +  SD Q+LAEIGYK+EL R++ST+Q+FG+AFSIMGLLP
Sbjct: 33  SNIRSVRSQTGAGEVNFIDAGATVSDHQLLAEIGYKQELNRQFSTIQVFGIAFSIMGLLP 92

Query: 93  SIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKW 152
           SIAS M GGLA G   L WGWF+AG  IL+VGIA+ E +S+IPTAG +Y   Y +AP+ +
Sbjct: 93  SIASVMGGGLAGGPTTLVWGWFIAGCFILTVGIAMAENASAIPTAGGLYYWTYYYAPKGY 152

Query: 153 RKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG-NPDFEVTDPITYGVFCACIVA 211
           ++ IS+ +G  ++L+L A VCSI YG A+++L+AVV+  + +FE+T   TYGVF A +VA
Sbjct: 153 KEVISFVIGCSNSLALAAGVCSIDYGFAEEVLAAVVIAKDGNFEITPGKTYGVFAAAVVA 212

Query: 212 ITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLT 271
           + + T M SK  ARLQT S                   ++ +   FN  S+IFG  +NL+
Sbjct: 213 MGICTCMASKAIARLQTISIVSNLFIIVLLFIALPIG-TKINMGGFNDGSFIFGKFKNLS 271

Query: 272 DWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICI 331
           DWN GW + + G  P +WTIGA+DSC+H +EEAKDA+++VPIGI+ SIS CW+LGWLI I
Sbjct: 272 DWNNGWQFFLAGFMPVVWTIGAFDSCVHQSEEAKDAKKSVPIGIIGSISVCWVLGWLILI 331

Query: 332 VILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQFLMGASTVLANSRQ 391
            ++ACM+PD+  IV++ YG  + Q+  D+LGK+W + F+SLI  CQFLMG+S V A SRQ
Sbjct: 332 CLMACMSPDIEGIVDNKYGFAMAQIIYDSLGKKWAVAFMSLIAFCQFLMGSSVVTAISRQ 391

Query: 392 FWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIA 451
            WAFARDDG+P S + K VD++  VP  +I  +   S+ LG LCL    A  ALFSL++A
Sbjct: 392 IWAFARDDGLPLSDYIKMVDKKYKVPFNAIIFACCGSLILGLLCLIDAAATSALFSLAVA 451

Query: 452 GMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGI 511
           G  +A   P  LRLT GR  FRPGPFYLG  WS  NGW+++ F+ F +++VMFP +K GI
Sbjct: 452 GNNLAWSTPTLLRLTSGRDLFRPGPFYLGPVWSKVNGWISIIFEAFIIIVVMFPSEKHGI 511

Query: 512 TKETMNYTVVIGPGFWVLSLIYYFVWQR 539
           TK TMNYT VIGPG W LS +YY V+++
Sbjct: 512 TKSTMNYTCVIGPGIWFLSWVYYSVYKK 539

>YDL210W Chr4 (84270..85985) [1716 bp, 571 aa] {ON}  UGA4Permease
           that serves as a gamma-aminobutyrate (GABA) transport
           protein involved in the utilization of GABA as a
           nitrogen source; catalyzes the transport of putrescine
           and delta-aminolevulinic acid (ALA); localized to the
           vacuolar membrane
          Length = 571

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/538 (50%), Positives = 369/538 (68%), Gaps = 3/538 (0%)

Query: 34  SELRVVTSAHGA-PIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIMGLLP 92
           S LR + S  GA  + YIDA  + +D Q+LAEIGYK+ELKR++ST+Q+FG+AFSIMGLLP
Sbjct: 32  SNLRSIRSKTGAGEVNYIDAAKSVNDNQLLAEIGYKQELKRQFSTLQVFGIAFSIMGLLP 91

Query: 93  SIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKW 152
           SIAS M GGL  G   L WGWFVA   IL VGI + E +SSIPTAG +Y   Y +APE +
Sbjct: 92  SIASVMGGGLGGGPATLVWGWFVAAFFILLVGITMAEHASSIPTAGGLYYWTYYYAPEGY 151

Query: 153 RKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVV-GNPDFEVTDPITYGVFCACIVA 211
           ++ IS+ +G  ++L+L A VCSI YGLA++I +AV +  + +FEVT    YG+F   +V 
Sbjct: 152 KEIISFIIGCSNSLALAAGVCSIDYGLAEEIAAAVTLTKDGNFEVTSGKLYGIFAGAVVV 211

Query: 212 ITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLT 271
           + + T + S   ARLQT S                   ++     FN   +IFG  +NL+
Sbjct: 212 MCICTCVASGAIARLQTLSIFANLFIIVLLFIALPIG-TKHRMGGFNDGDFIFGKYENLS 270

Query: 272 DWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICI 331
           DWN GW +C+ G  PA+WTIG++DSC+H +EEAKDA+++VPIGI++SI+ CWILGWLI I
Sbjct: 271 DWNNGWQFCLAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIISSIAVCWILGWLIII 330

Query: 332 VILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQFLMGASTVLANSRQ 391
            ++AC+NPD++++++S YG  + Q+  D+LGK+W + F+SLI  CQFLMGAS   A SRQ
Sbjct: 331 CLMACINPDIDSVLDSKYGFALAQIIYDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQ 390

Query: 392 FWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIA 451
            WAF+RD+G+P SK+ K+VD +  VP  +I  +   S+ LG LCL  D A DALFSL++A
Sbjct: 391 VWAFSRDNGLPLSKYIKRVDSKYSVPFFAILAACVGSLILGLLCLIDDAATDALFSLAVA 450

Query: 452 GMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGI 511
           G  +A   P   RLT GR  FRPGPFYLG  WS    W  V FQLF +++VMFP  + GI
Sbjct: 451 GNNLAWSTPTVFRLTSGRDLFRPGPFYLGKIWSPIVAWTGVAFQLFIIILVMFPSQQHGI 510

Query: 512 TKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVGEDAIDAMLSN 569
           TK TMNY  VIGPG W+L+ IYY V+++K+Y GP +NL+D+++ EAVG D ID ++S 
Sbjct: 511 TKSTMNYACVIGPGIWILAGIYYKVYKKKYYHGPATNLSDDDYTEAVGADVIDTIMSK 568

>KLLA0E24993g Chr5 complement(2214864..2216570) [1707 bp, 568 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 568

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/571 (47%), Positives = 381/571 (66%), Gaps = 7/571 (1%)

Query: 7   SMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQVLAEIG 66
           S+S  S    ++I      +++    V+ LR +TS     + YI+A +A  DT++LAEIG
Sbjct: 4   SVSSGSEKNNYIIGAQEVKNKVDV--VTSLRTITSRRVGDVNYINAKAAHDDTELLAEIG 61

Query: 67  YKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIA 126
           YK+EL+R +S +Q+FGVAFSIMGLLPSIAS +   L  G+V L WGW +AG  +L+ G+A
Sbjct: 62  YKQELQRHFSKIQVFGVAFSIMGLLPSIASVLSLALPGGSVSLVWGWGIAGAFVLTNGLA 121

Query: 127 LGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSA 186
           + EL+S+IPT+G +Y   Y +AP K +  +S+ VG  ++L+L A +CSI YGLA +ILS 
Sbjct: 122 MSELASAIPTSGGLYYYTYYYAPPKVKNLLSFVVGNSNSLALIAGLCSINYGLAGEILSI 181

Query: 187 VVVG-NPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXX 245
           VVVG + +F +T+  TYGV+ ACIVA  V+TS+ +   ++LQTFS               
Sbjct: 182 VVVGSDGNFNITNASTYGVYAACIVATAVVTSVATVAVSKLQTFSIVSNLLLICIFFVAL 241

Query: 246 XXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAK 305
               +RS+ + FN A YIFG+ QNL+DWN GW +   G  P IW IG +DSC+HM+EEAK
Sbjct: 242 PVGVARSNHMEFNDAKYIFGNFQNLSDWNDGWQFMSAGFQPLIWVIGGFDSCIHMSEEAK 301

Query: 306 DARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRW 365
           +A  +VP GI+ SIS CW+LG+ ICIVI AC + DV AIV + + Q + Q+  DALGKRW
Sbjct: 302 NATASVPFGIIGSISVCWVLGFFICIVIAACSSQDVAAIVETKFHQPLAQILFDALGKRW 361

Query: 366 TLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSS 425
           T+  + LI  CQFLM AS + A SRQ WAFARDDG+PFS + K V+ +   P+R+ W  +
Sbjct: 362 TIAIMVLIAFCQFLMAASILTAISRQIWAFARDDGLPFSSWIKVVNIKLSSPLRATWVGA 421

Query: 426 FFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWST 485
             ++A+G LCL G  A+ ALFSL+++  Y + + P  LR+TYG+  F PG F++G + S 
Sbjct: 422 GAALAIGCLCLIGPVASSALFSLAVSANYFSWMVPNLLRMTYGKDVFTPGAFFMGKYLSP 481

Query: 486 ANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGP 545
              W+++ F++F +L+V FP D+ GIT +TMNY+VV     WVL  IYY V++ KFY GP
Sbjct: 482 VVNWISIVFEIFMILLVFFPADQHGITPDTMNYSVVFIGAVWVLPTIYYLVYKYKFYSGP 541

Query: 546 KSNLTDEEFVEAVGEDAIDAMLSNYSQAHQD 576
           KSNLTDEE+ E VG+D +DA+LS     HQD
Sbjct: 542 KSNLTDEEYEEKVGQDVLDAILSK----HQD 568

>Smik_4.30 Chr4 (62468..64183) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/538 (50%), Positives = 371/538 (68%), Gaps = 3/538 (0%)

Query: 34  SELRVVTSAHGA-PIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIMGLLP 92
           S LR + S  GA  + YIDA  + +D Q+LAEIGYK+ELKR++ST+Q+FG+AFSIMGLLP
Sbjct: 32  SNLRSIRSKTGAGEVNYIDAAKSVNDNQLLAEIGYKQELKRQFSTIQVFGIAFSIMGLLP 91

Query: 93  SIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKW 152
           SIAS M GGL  G   L WGWF+A   IL VGI + E +SSIPTAG +Y   Y +APE +
Sbjct: 92  SIASVMGGGLGGGPATLVWGWFIAAFFILLVGITMAEHASSIPTAGGLYYWTYYYAPEGY 151

Query: 153 RKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVV-GNPDFEVTDPITYGVFCACIVA 211
           ++ IS+ +G  ++L+L A VCSI YGLA++I +A+ +  + +F+VT    YG+F   +V 
Sbjct: 152 KEIISFIIGCSNSLALAAGVCSIDYGLAEEIAAAITLTKDGNFDVTSGKLYGIFAGAVVV 211

Query: 212 ITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLT 271
           + + T + S   ARLQT S                   ++ +   FN   +IFG  +NL+
Sbjct: 212 MGICTCIASGAIARLQTLSIFANLFIIVLLFIALPIG-TKHNIGGFNNGDFIFGKYENLS 270

Query: 272 DWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICI 331
           DWN GW +C+ G  PA+WTIG++DSC+H +EEAKDA+++VPIGI++SI+ CWILGWLI I
Sbjct: 271 DWNKGWQFCLAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIISSITVCWILGWLIII 330

Query: 332 VILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQFLMGASTVLANSRQ 391
            ++AC+NPD++++++S YG  + Q+  D+LGK+W + F+SLI  CQFLMGAS   A SRQ
Sbjct: 331 CLMACINPDIDSVLDSKYGFALAQIIYDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQ 390

Query: 392 FWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIA 451
            WAF+RD+G+P SK+ K+VD +  VP  +I  +   S+ LG LCL  D A DALFSL++A
Sbjct: 391 VWAFSRDNGLPLSKYIKRVDSKYSVPFFAILAACAGSLILGLLCLIDDAATDALFSLAVA 450

Query: 452 GMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGI 511
           G  +A   P  LRLT GR  FRPGPFYLG  WS    W+ V FQ+F +++VMFP  + GI
Sbjct: 451 GNNLAWSTPTVLRLTSGRDLFRPGPFYLGKIWSPIVAWIGVAFQVFIIILVMFPAQQHGI 510

Query: 512 TKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVGEDAIDAMLSN 569
           TK TMNY  VIGPG W L+ +YY V+++K+Y GP +NL+D+++ EAVG D ID ++S 
Sbjct: 511 TKSTMNYACVIGPGIWFLAGVYYKVYKKKYYHGPATNLSDDDYAEAVGIDVIDTIISK 568

>Kwal_0.16 s0 complement(7307..9001) [1695 bp, 564 aa] {ON} YDL210W
           (UGA4) - GABA-specific transport protein [contig 75]
           FULL
          Length = 564

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/553 (45%), Positives = 375/553 (67%), Gaps = 2/553 (0%)

Query: 19  INRNNSNDEIG-FGSVSELRVVTSAHGAPIRYIDALSATSDTQVLAEIGYKEELKREYST 77
           I R  S + +G       LR +TS     + YI+A +A  DT++LAEIGYK+EL R +ST
Sbjct: 11  ITREFSPNAVGEIHEYRSLRTITSKRAGEVNYINAKTAHDDTELLAEIGYKQELSRHFST 70

Query: 78  VQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTA 137
           +Q+FG+AFSIMGLLPSIAS +      G V   WGW ++G  +L +G ++ EL+S+IPT+
Sbjct: 71  LQVFGIAFSIMGLLPSIASVLLMAFPGGMVSFVWGWLISGFFVLLIGCSMSELASAIPTS 130

Query: 138 GAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG-NPDFEV 196
           G +Y   Y +AP++++  +S+ +G  +TL+L A +CS+ YG AQ++L+ VV+  + +FE+
Sbjct: 131 GGLYYYTYYYAPKRFKSLLSFLIGNSNTLALTAGLCSVTYGFAQEVLAIVVISKDGNFEL 190

Query: 197 TDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVS 256
           T+ + YGV+ A IVA  ++TS+ +   +RLQT S                   S++  + 
Sbjct: 191 TNGMIYGVYAAGIVATMMVTSVATVAVSRLQTVSIVSNLALIAFFLIVLPIGVSKTKWLD 250

Query: 257 FNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIV 316
           FN  S+IFG+  N T W  GW + + G  PA+WTIGA+DSC+HM+EEAK+A +AVP GI+
Sbjct: 251 FNDGSFIFGNWTNETTWPDGWQFMMTGFQPAVWTIGAFDSCIHMSEEAKNATKAVPAGIL 310

Query: 317 ASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIIC 376
            SIS CW++G+ ICI I ACM PD++AI++S YG  + Q+  +ALGK+WT+ F++LI  C
Sbjct: 311 GSISVCWVVGFFICIAIAACMGPDIDAILDSAYGSPLAQILYNALGKKWTMAFMTLIAFC 370

Query: 377 QFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCL 436
           QF+MG S + A SRQ WAFARDDG+ FSK  K V+++   P+R+ W  +  ++ +G LCL
Sbjct: 371 QFVMGCSILTAISRQIWAFARDDGLMFSKHIKVVNKKLSSPLRATWFGAAGALVIGLLCL 430

Query: 437 AGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQL 496
            G TA++ALFS+ IA  Y++ + P  LR+T G+  F+PG FY+G FWS    W ++ F+L
Sbjct: 431 IGGTASNALFSMYIAANYLSWMMPNLLRMTTGKDVFKPGAFYMGDFWSPIVNWTSIAFEL 490

Query: 497 FAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVE 556
           F ++M+MFP +K+GIT +TMNYT+VI    W+ SL Y+  ++ K++ GPKSNL+D EF +
Sbjct: 491 FIIVMMMFPTEKTGITPDTMNYTIVICGAVWLGSLAYFLTYKHKYFHGPKSNLSDAEFDK 550

Query: 557 AVGEDAIDAMLSN 569
           AVG+D ID +LS+
Sbjct: 551 AVGQDVIDQILSH 563

>NDAI0C03150 Chr3 complement(717726..719450) [1725 bp, 574 aa] {ON}
           Anc_5.112
          Length = 574

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/538 (48%), Positives = 371/538 (68%), Gaps = 5/538 (0%)

Query: 34  SELRVVTSAHGA-PIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIMGLLP 92
           S LR + S  GA  + YI+A  + +D Q+LAEIGYK+ELKR++ST+Q+FG+AFSIMGLLP
Sbjct: 37  SNLRSIISKTGAGEVNYINASKSVNDNQLLAEIGYKQELKRQFSTLQVFGIAFSIMGLLP 96

Query: 93  SIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKW 152
           SIAS M  G++ G+V   WGWF+A   IL VGI++ E +S+IPTAG +Y   Y +AP+ +
Sbjct: 97  SIASVMGTGISGGSVSFVWGWFIASFFILLVGISMAENASAIPTAGGLYYWTYYYAPKGY 156

Query: 153 RKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG-NPDFEVTDPITYGVFCACIVA 211
           ++  S+ +G  ++L+L A +CSI YGLA++I++AVVV  + DF +TD   Y VF A ++ 
Sbjct: 157 KEVFSFIIGCSNSLALVAGLCSIDYGLAEEIMAAVVVTYDGDFNITDGRLYAVFLASVIV 216

Query: 212 ITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLT 271
           + + TSM S + ARLQ  S                   ++  + +FN AS+IFG  +N +
Sbjct: 217 MALCTSMASGVIARLQNISIVSNLFIIVLLFIALPVG-TKHKRGTFNDASFIFGGFENFS 275

Query: 272 DWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICI 331
           DWN GW +C+ G  PA+WTIG++DSC+H +EEAKDA+++VP+GI+ SIS+CWILGWLI I
Sbjct: 276 DWNGGWQFCLTGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPVGIIGSISACWILGWLIII 335

Query: 332 VILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQFLMGASTVLANSRQ 391
            ++AC++P +  ++++ YG  + Q+  D+LGK+WT+ FLSL+  CQFLMG S   A SRQ
Sbjct: 336 CLMACIDPQLENVLDTQYGFPMAQLIYDSLGKKWTIAFLSLMAFCQFLMGCSICTAISRQ 395

Query: 392 FWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIA 451
            WAF+RDDG+PFSK+ K+V   + VP  +I  +   S+ LG LCL   TAA+ALFSL++A
Sbjct: 396 IWAFSRDDGLPFSKYIKQV--HNSVPFFAILAACVSSLVLGLLCLIDATAANALFSLAVA 453

Query: 452 GMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGI 511
           G Y+A   P  LRLT GR  FRPGPFYLG   S    W+ V +++F ++M MFP  + GI
Sbjct: 454 GNYLAWCTPTLLRLTSGRDIFRPGPFYLGKVLSPIVSWIGVLYEVFIIIMEMFPSQQHGI 513

Query: 512 TKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVGEDAIDAMLSN 569
            K  MNY  VIGPG W L+ IYY ++++K+Y GPK+NL+DEE+ + VG D ID +L  
Sbjct: 514 NKTNMNYACVIGPGIWFLAWIYYLLYKKKYYHGPKTNLSDEEYSDMVGIDVIDGILEQ 571

>ZYRO0B15048g Chr2 complement(1226178..1227926) [1749 bp, 582 aa]
           {ON} similar to uniprot|P32837 Saccharomyces cerevisiae
           YDL210W UGA4 Permease that serves as a
           gamma-aminobutyrate (GABA) transport protein involved in
           the utilization of GABA as a nitrogen source catalyzes
           the transport of putrescine and delta-aminolevulinic
           acid (ALA) localized to the vacuolar membrane
          Length = 582

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/567 (47%), Positives = 381/567 (67%), Gaps = 4/567 (0%)

Query: 11  SSGAVEHLINRNNSNDEIGF-GSVSELRVVTSAHGAPIRYIDALSATSDTQVLAEIGYKE 69
           S+ +   L    N    + F G  S +R V S     + YI++ ++ +D  +LAEIGYK+
Sbjct: 16  STTSAAELDGEKNEGTLLEFRGLKSHIRSVRSPVAGEVNYINSATSNTDKGLLAEIGYKQ 75

Query: 70  ELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGE 129
           EL+R++ST+Q+FGVAFSIMGLLPSI + +  GLA G V   WGW +AG  IL +G+A+ E
Sbjct: 76  ELERKFSTIQVFGVAFSIMGLLPSIGTLLSDGLAGGPVSTIWGWLIAGFFILVLGLAMAE 135

Query: 130 LSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVV 189
            +S+IPTAG +Y   Y +AP+ ++  +S+ +G  ++L+L A+ CSI YG A+++L+AVV+
Sbjct: 136 NASAIPTAGGLYYWTYYYAPKGYKAVMSFIIGCSNSLALTAACCSITYGFAEEVLAAVVL 195

Query: 190 -GNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXX 248
             + +F+VT+   YG+F    + + V TS+ S   A+LQT S                  
Sbjct: 196 TKDGNFDVTNGKLYGIFAGAAIMMGVCTSVASGFVAKLQTLSIICNLFIIVLFFIAVPIG 255

Query: 249 XSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDAR 308
            ++ ++  FN   +IF + QN +DWN GW +C+ G  PAIWTIG +DSC+H +EEAKDA+
Sbjct: 256 -AKVNRGKFNHGHFIFANYQNSSDWNNGWQFCLAGFMPAIWTIGGFDSCVHQSEEAKDAK 314

Query: 309 RAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLT 368
           ++V +GIV SIS CWILGW I IV+LACM+PDV+  +N+ Y   I Q+  D LGK W + 
Sbjct: 315 KSVALGIVGSISVCWILGWFILIVLLACMDPDVSKTMNTKYVLSIAQIIYDCLGKNWAIA 374

Query: 369 FLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFS 428
           F+SLI  CQFLMGAST+ A SRQ WAF+RD+G+PFSK+ KKV++   +P  +I  +   +
Sbjct: 375 FMSLIAFCQFLMGASTITAVSRQIWAFSRDNGLPFSKYIKKVNKTYSIPFVAIIAACCGT 434

Query: 429 IALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANG 488
           + LG LCL  D AA+ALFSLS+AG  ++   P  LRLT+G+  FRPGPFYLG F ST NG
Sbjct: 435 LVLGLLCLQ-DEAANALFSLSVAGNNLSWGTPTFLRLTFGKDLFRPGPFYLGKFLSTVNG 493

Query: 489 WLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSN 548
           W++VF+ LF +++VMFP  +  +T ++MNY  VIGPG W+LS IYY  +++K+Y GP SN
Sbjct: 494 WISVFWGLFVIILVMFPTSQHNVTPQSMNYACVIGPGVWILSFIYYITYKKKYYHGPASN 553

Query: 549 LTDEEFVEAVGEDAIDAMLSNYSQAHQ 575
           LT+EE+V AVGED +D + +  SQ  +
Sbjct: 554 LTEEEYVNAVGEDVLDNIDNVLSQPEK 580

>TDEL0G01370 Chr7 (274664..276373) [1710 bp, 569 aa] {ON} Anc_5.112
          Length = 569

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/574 (48%), Positives = 389/574 (67%), Gaps = 7/574 (1%)

Query: 1   MGDDQESMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGA-PIRYIDALSATSDT 59
           M DD +S  +S      L     S  E+   S S++R V S  GA  + YI++ ++ +D 
Sbjct: 1   MTDDIKSAIRSG---PRLSTSEGSAFELHQLSSSDVRYVRSKTGAGEVNYINSATSVNDG 57

Query: 60  QVLAEIGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGL 119
           Q+LAEIGYK+ELKR++ST+Q+FGVAFSIMGLLPSIAS M GGL  G V L WGWF+A   
Sbjct: 58  QLLAEIGYKQELKRQFSTLQVFGVAFSIMGLLPSIASVMGGGLTGGPVTLVWGWFIAAFF 117

Query: 120 ILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGL 179
           IL VGI + E +S+IPTAG +Y   Y +AP+ +++ +S+ +G  ++L+L A VCSI YG 
Sbjct: 118 ILLVGITMAENASAIPTAGGLYYWTYYYAPKGYKEIVSFVIGCSNSLALSAGVCSISYGF 177

Query: 180 AQQILSAVVVG-NPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXX 238
           A ++L+AVV+  + DFEVT   TYG+F A +VA  V+T ++S + ARLQT S        
Sbjct: 178 ALEVLAAVVISRDGDFEVTTGKTYGIFAAVVVAQGVVTCLSSGLVARLQTLSIVSNVFIM 237

Query: 239 XXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCL 298
                      ++ ++  FN   +IFG  QN +DWN+GW +C+ G  PA+WTIG++DSC+
Sbjct: 238 ILLFIALPIG-AKVNRGGFNNGEFIFGTYQNFSDWNSGWQFCLAGFMPAVWTIGSFDSCV 296

Query: 299 HMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQ 358
           H +EEAKDA+++VPIGI+ SI++CWILGWLI I ++ACM+ D++ ++++ Y   + Q+  
Sbjct: 297 HQSEEAKDAKKSVPIGIIGSIAACWILGWLIIICLMACMDSDISKVLDTDYEIILAQIVY 356

Query: 359 DALGKRWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPM 418
           D LGK W + F++LI  CQFLMGAS V A SRQ WAFARDDG+P SK+ KKVD++  VP 
Sbjct: 357 DCLGKNWAIAFMALIAFCQFLMGASIVTAASRQIWAFARDDGLPLSKYIKKVDKKYSVPF 416

Query: 419 RSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFY 478
            +I  +   S+ L  L      AA ALFSL++AG  +A   P  LRLT+GR  FRPGPFY
Sbjct: 417 VAIIAACVASLLL-GLLCLDAAAAAALFSLAVAGNNLAWSTPTFLRLTWGRDLFRPGPFY 475

Query: 479 LGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQ 538
           LG  WS    W+ V +Q F +++VMFP  + G+T +TMNY  VIGPG W+LS IYY V++
Sbjct: 476 LGKLWSPIIAWIGVVYQAFIIILVMFPSARHGLTPQTMNYACVIGPGLWILSWIYYMVYR 535

Query: 539 RKFYEGPKSNLTDEEFVEAVGEDAIDAMLSNYSQ 572
           +K++ GPKSNL+DE++ EAVGED I+ +LS   +
Sbjct: 536 KKYFHGPKSNLSDEDYNEAVGEDLIEEILSRKGE 569

>Skud_4.46 Chr4 (81451..83166) [1716 bp, 571 aa] {ON} YDL210W (REAL)
          Length = 571

 Score =  509 bits (1312), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 267/538 (49%), Positives = 370/538 (68%), Gaps = 3/538 (0%)

Query: 34  SELRVVTSAHGA-PIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIMGLLP 92
           S LR + S  GA  + YI+A  + +D Q+LAEIGYK+ELKR++STVQ+FG+AFSIMGLLP
Sbjct: 32  SNLRSIRSKTGAGEVNYINAAKSVNDNQLLAEIGYKQELKRQFSTVQVFGIAFSIMGLLP 91

Query: 93  SIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKW 152
           SIAS M GGL  G   L WGWFVA   IL VGI + E +S+IPTAG +Y   Y +APE +
Sbjct: 92  SIASVMGGGLGGGPATLLWGWFVAAFFILLVGITMAEHASAIPTAGGLYYWTYHYAPEGY 151

Query: 153 RKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG-NPDFEVTDPITYGVFCACIVA 211
           ++ IS+ +G  ++L+L A VCSI YGLA++I +AV +  + +F+ T    YG+F   +V 
Sbjct: 152 KEIISFIIGCSNSLALAAGVCSIDYGLAEEIAAAVTLTRDGNFDATSGKLYGIFAGAVVL 211

Query: 212 ITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLT 271
           + + T + S   ARLQT S                   ++ +   FN   +IFG  +N++
Sbjct: 212 MGICTCIASGAIARLQTVSIVANLFIIVLLFIALPIG-TKHNMGGFNNGEFIFGKFENMS 270

Query: 272 DWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICI 331
           DWN GW +C+ G  PA+WTIG++DSC+H +EEAKDA+++VPIGI++SI+ CW+LG LI I
Sbjct: 271 DWNNGWQFCLAGFMPAVWTIGSFDSCVHQSEEAKDAKKSVPIGIISSIAVCWVLGLLIII 330

Query: 332 VILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQFLMGASTVLANSRQ 391
            +LAC+NPD+++++NS YG  + Q+  D+LGK+W + F+SLI  CQFLMGAS   A SRQ
Sbjct: 331 CLLACINPDIDSVLNSKYGFALAQIIYDSLGKKWAIAFMSLIAFCQFLMGASITTAVSRQ 390

Query: 392 FWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIA 451
            WAF+RD+G+P SK+ K+VD +  VP  +I  +   S+ LG LCL  + A  ALFSL++A
Sbjct: 391 VWAFSRDNGLPLSKYIKRVDSKYSVPFYAILAACVGSLILGLLCLIDEAATSALFSLAVA 450

Query: 452 GMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGI 511
           G  +A   P  LRLT GR  FRPGPFYLG FWS    W+ V FQ+F +++VMFP  + GI
Sbjct: 451 GNNLAWSTPTVLRLTSGRDLFRPGPFYLGKFWSPIIAWIGVAFQVFIIILVMFPSQQHGI 510

Query: 512 TKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVGEDAIDAMLSN 569
           TK TMNY  VIGPG W L+ +YY V+++K+Y GP +NL+D+++ +AVG D IDA++S 
Sbjct: 511 TKSTMNYACVIGPGIWFLAGVYYKVYKKKYYHGPATNLSDDDYADAVGVDVIDAIISK 568

>KNAG0E00820 Chr5 (152560..154275) [1716 bp, 571 aa] {ON} Anc_5.112
          Length = 571

 Score =  505 bits (1301), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 266/551 (48%), Positives = 366/551 (66%), Gaps = 5/551 (0%)

Query: 19  INRNNSNDEIGFGSVSELRVVTSAHGA-PIRYIDALSATSDTQVLAEIGYKEELKREYST 77
           I+  +S+D   +   S +R V S  GA  + YI+++ + SD Q+LAEIGYK ELKR++ST
Sbjct: 19  ISEGHSDDL--YNLASRVRTVRSHTGAGEVNYINSVQSVSDNQLLAEIGYKPELKRQFST 76

Query: 78  VQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTA 137
           +Q+FG+AFSIMGLLPSIAS M GGLA G V L WGWF +   IL VGI + E +S+IPTA
Sbjct: 77  LQVFGIAFSIMGLLPSIASVMAGGLAGGPVSLVWGWFSSCIGILIVGITMAENASAIPTA 136

Query: 138 GAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG-NPDFEV 196
           G +Y   Y +AP+K++  +S+ VG  ++L+L AS CSI YG A+++++AV +  +    V
Sbjct: 137 GGMYYWTYYYAPKKYKAVLSFVVGCSNSLALVASCCSINYGFAEEVMAAVFLTYDGAVTV 196

Query: 197 TDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVS 256
           T    YG+F    V + + T + S   ARLQT S                   ++++   
Sbjct: 197 TSGKLYGIFAGATVVMAMCTCVASGAIARLQTVSIVSNIFIIILFVIAVPIG-TKANIGH 255

Query: 257 FNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIV 316
           FN   YIFG  +NL+DWN G+ + + G  PA WTI ++DSC+H +EEAKDA+++VPIGI+
Sbjct: 256 FNDGKYIFGHFENLSDWNNGFLFFLAGFMPAAWTISSFDSCVHQSEEAKDAKKSVPIGII 315

Query: 317 ASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIIC 376
            SI++CWILG+LI I + ACM+ D++ +VNS  G  + Q+  D+LGKRW + F++LI  C
Sbjct: 316 GSITACWILGFLIIICLCACMDTDLDRLVNSDTGFAMAQIIFDSLGKRWAIAFMALIAFC 375

Query: 377 QFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCL 436
           QFLMGAS V A SRQ WAFARDDG+PFS   K VD+R  VP  S+  ++  S+ LG LCL
Sbjct: 376 QFLMGASIVTAISRQIWAFARDDGLPFSNLIKYVDKRYQVPFNSVIAAAITSLLLGLLCL 435

Query: 437 AGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQL 496
               A  ALFSLS+AG Y+A + P  LRLT GR  FRPGPFYLG FWS    W +V F++
Sbjct: 436 INSQATAALFSLSVAGGYIAYLIPTVLRLTVGRDVFRPGPFYLGKFWSPIVAWSSVVFEI 495

Query: 497 FAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVE 556
           + +L+ MFP  +  I K TMNY+ VIGPG  +L+ IYY VW+ + Y GPKSNL+DE++ E
Sbjct: 496 WIILLEMFPAQQHHIDKSTMNYSCVIGPGTCLLAWIYYRVWKHREYIGPKSNLSDEDYKE 555

Query: 557 AVGEDAIDAML 567
           A+G   +D ++
Sbjct: 556 ALGPAVLDDII 566

>ABL116C Chr2 complement(181138..181889,181944..182826) [1635 bp,
           544 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDL210W (UGA4); 1-intron
          Length = 544

 Score =  467 bits (1201), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 230/550 (41%), Positives = 352/550 (64%), Gaps = 9/550 (1%)

Query: 1   MGDDQESMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQ 60
           MG        S+ AV  +   +N     G        ++  ++  P+ YIDA +   D +
Sbjct: 1   MGAQDLDKQSSNSAVAEIYYESNKYGHKG-------DLIECSNKGPMNYIDAKNVHDDVE 53

Query: 61  VLAEIGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLI 120
           +LAEIGYK+ELKR +ST+QIFG+AFSIMGLLPSIAS +   L  G+V + WGWF+ G  I
Sbjct: 54  LLAEIGYKQELKRHFSTLQIFGIAFSIMGLLPSIASVLPVALPGGSVSMVWGWFIFGAFI 113

Query: 121 LSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLA 180
           L+VG A+ EL+S+ PT+G +Y   Y +AP + + C+S+ +G  ++L+L A +CSI YGLA
Sbjct: 114 LAVGAAMAELASAFPTSGGLYYYTYYYAPPRLKACLSFLIGNGNSLALIAGLCSIEYGLA 173

Query: 181 QQILSAVVVGNPDFEVTDP-ITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXX 239
           +QILS + + +  + V+   + YG++C  ++A  +L S+ +   + LQT S         
Sbjct: 174 EQILSIIAISSNSYLVSSRWLLYGIYCMGLLATVLLASIATFSVSLLQTASIVMNLALVA 233

Query: 240 XXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLH 299
                     + + +  FN A ++F + +N T W   + + + G  P +W IGA+DS +H
Sbjct: 234 LFIIVLPVGVAHNGR-GFNSAKFMFTNFENHTGWPDWFQFFLCGSLPIVWVIGAFDSTVH 292

Query: 300 MAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQD 359
           M+EEAK+A R+VPIGI++SIS+CW LG+ I +VI ACM PD++AI+N  +   + Q+  +
Sbjct: 293 MSEEAKNATRSVPIGILSSISTCWALGFAIVVVIAACMGPDIDAILNGEFNHPLAQILYN 352

Query: 360 ALGKRWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMR 419
           ALGK W L+ +  I++CQ+LMGAS + A+SRQ WAFARDDG+PFS + K V+ +   P+R
Sbjct: 353 ALGKGWALSVMVFIVVCQYLMGASILTASSRQIWAFARDDGLPFSSWIKVVNTKLSSPLR 412

Query: 420 SIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYL 479
           + W S+F ++ +G L LAG TA+ ALFS+++A  Y+A + P  LR+ +G++ +RPG FY+
Sbjct: 413 ATWASAFVALVIGLLTLAGPTASSALFSMAVAANYLAWMTPNLLRMLFGKEIYRPGSFYM 472

Query: 480 GHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQR 539
           G FWS    W A+ FQ+F +L++MFP D +G+   TMNYT +I    W+ S+ Y+  ++ 
Sbjct: 473 GKFWSPVINWTAILFQVFIILVMMFPSDTAGLRASTMNYTAIITGFVWIGSIFYFLAYKH 532

Query: 540 KFYEGPKSNL 549
           + + GPKSNL
Sbjct: 533 RTFIGPKSNL 542

>Ecym_4621 Chr4 complement(1216034..1217752) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii ABL116C
          Length = 572

 Score =  459 bits (1181), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 224/533 (42%), Positives = 342/533 (64%), Gaps = 2/533 (0%)

Query: 23  NSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFG 82
            +N  +    +S ++   S     + YI+A +A  D ++LAEIGYK+EL R +ST+Q+FG
Sbjct: 23  TNNTSVRVQQISSIKTSRSKTVDQVNYINAKTAYDDVELLAEIGYKQELSRHFSTIQVFG 82

Query: 83  VAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYV 142
           +AFSIMGLLPSIAS +   L  G V   WGW + G  ILS+G A+ EL+S+IPT+G +Y 
Sbjct: 83  IAFSIMGLLPSIASILTIALPGGMVSFVWGWLIFGVFILSIGAAMSELASAIPTSGGLYY 142

Query: 143 ACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVV-GNPDFEVTDPIT 201
             Y +AP K++  +S+ +G  ++L+L A +CS+ YGLAQ++LS V +  + DFE++   T
Sbjct: 143 YTYYYAPPKFKAILSFLIGNSNSLALVAGLCSVEYGLAQEVLSIVAIWKDGDFELSSSKT 202

Query: 202 YGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKAS 261
           + V+CA I+A  +LTSM +   + LQT S                   + +D ++FN   
Sbjct: 203 FAVYCAAILATVILTSMATAAVSVLQTVSIVINLSLVAFLIVLPIGV-ANNDSMTFNGPG 261

Query: 262 YIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISS 321
           +IF + QN + W     + + G  P +W IGA+DS +HM+EEAK+A +AVP+ I+ SI+ 
Sbjct: 262 FIFANFQNNSSWPDCIQFFLCGSLPIVWVIGAFDSTIHMSEEAKNASKAVPVDILTSITV 321

Query: 322 CWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQFLMG 381
           CW+LG+ I + I ACM PD+N ++++ +GQ + Q+  + LGK+W + F+SLI +CQ++MG
Sbjct: 322 CWLLGFCIVVTIAACMGPDINGLLDTAFGQPLAQLLFNVLGKQWAIAFMSLIAVCQYVMG 381

Query: 382 ASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTA 441
           AS + A SRQ WAFARDDG+PFS + KKV++    P+R+ W  +F +I +G L LAG  A
Sbjct: 382 ASILTAISRQIWAFARDDGLPFSFWIKKVNKSLSSPIRATWVGAFAAIMIGLLTLAGPVA 441

Query: 442 ADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLM 501
           + ALFS+ +   Y+A + P  LR+ +G+  F PG FY+G FWS    W+++ FQL  +++
Sbjct: 442 SSALFSMYVGANYLAWMMPNLLRMLFGKNIFNPGVFYMGKFWSPIINWVSIIFQLLCIVL 501

Query: 502 VMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEF 554
           +M P +   IT  +MNYT +     W  S+IY+ +++ K +EGPKSNLTD + 
Sbjct: 502 MMLPTNPINITGSSMNYTFLFTGFVWFGSIIYFVLYKHKTFEGPKSNLTDSDL 554

>Skud_7.205 Chr7 complement(365478..367166) [1689 bp, 562 aa] {ON}
           YGL077C (REAL)
          Length = 562

 Score =  152 bits (383), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 135/547 (24%), Positives = 245/547 (44%), Gaps = 28/547 (5%)

Query: 18  LINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQ---VLAEIGYKEELKRE 74
           ++N N S D +      E    T  H   +R  + +  + D     V+A  G +  L++ 
Sbjct: 3   ILNDNPSGDYME----PEQSSNTHIHKRDVRVEEEIKPSDDMDGKGVVAADG-EVHLRKS 57

Query: 75  YSTVQIFGVAFSIMGLLPSIASTMDGGLAAGA-VGLNWGWFVAGGLILSVGIALGELSSS 133
           +S   I GV F +      I+++M  G+++G  + + +G  +   + + +G +LGELSS+
Sbjct: 58  FSLWSILGVGFGLTNSWFGISTSMVAGISSGGPMMIIYGIIIVALISICIGTSLGELSSA 117

Query: 134 IPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPD 193
            P AG  +    + AP K+++  +Y  G         +  S    +A +++    + +P+
Sbjct: 118 YPHAGGQFWWSLKLAPPKYKRFAAYMCGSFAFAGSVFTSASTTLSVATEVVGMYALMHPE 177

Query: 194 FEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSD 253
           F    P  + +F    +    L   N    +     S                       
Sbjct: 178 F---TPKRWHIFVCFELLHLFLMLFNCYGKSLPIISSSSLYISLFSFFTITITVLACSHG 234

Query: 254 KVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPI 313
           K  FN A ++F    N T W  G    I GL    W+    D   HMA E +   R +PI
Sbjct: 235 K--FNDAKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPI 292

Query: 314 GIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLS-L 372
            I+ +++  ++  +   I +   +  D++A+++S  G  I  ++  ALG +    FL  L
Sbjct: 293 AIMGTVAIGFVTSFCYVIAMFFSIK-DLSAVLSSTTGAPILDIYNQALGNKSGAIFLGCL 351

Query: 373 IIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALG 432
           I++  F    +     +R  W+FARD+G+P S+++ +V+    VP+ +   S  +   +G
Sbjct: 352 ILLTSFGCVIACHTWQARLCWSFARDNGLPLSRYWAQVNPHIGVPLNAHLMSCAWISLIG 411

Query: 433 ALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTAN----G 488
            L LA  TA  +L +  IA + ++ + P+   L   ++D   GPF+LG F   +N    G
Sbjct: 412 LLYLASSTAFQSLITGCIAFLLLSYIIPVVCLLA-KKRDIAHGPFWLGKFGFFSNIVLLG 470

Query: 489 WLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIY-YFVWQRKFYEGPKS 547
           W      +F+V+   FP     +TK+ MNY  V+  G+   SL+Y +F  +++F+   +S
Sbjct: 471 W-----TIFSVVFFSFP-PVLPVTKDNMNYVCVVIVGYTAYSLLYWHFKGKKEFHAVEES 524

Query: 548 NLTDEEF 554
                +F
Sbjct: 525 EDEQADF 531

>Suva_7.193 Chr7 complement(355063..356754) [1692 bp, 563 aa] {ON}
           YGL077C (REAL)
          Length = 563

 Score =  152 bits (383), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 134/542 (24%), Positives = 244/542 (45%), Gaps = 28/542 (5%)

Query: 40  TSAHGAPIRYIDALSATSDTQ---VLAEIGYKEELKREYSTVQIFGVAFSIMGLLPSIAS 96
           T  H   +R  +    + D     V+A  G +  L++ +S   I GV F +      I++
Sbjct: 21  TDVHKRDVRVAEEFEPSDDADGKGVVAADG-EVHLRKSFSLWSILGVGFGLTNSWFGISA 79

Query: 97  TMDGGLAAGA-VGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKC 155
           +M  G+++G  + + +G  +   + + +G +LGELSS+ P AG  +    + AP K+++ 
Sbjct: 80  SMVAGISSGGPMMIVYGIIIVALISVCIGTSLGELSSAYPHAGGQFWWSLKLAPPKYKRF 139

Query: 156 ISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVL 215
            +Y  G         +  S    +A +++    + NP+F    P  + +F    +    L
Sbjct: 140 AAYMCGSFAYAGSVFTSASTTLSVATEVVGMYALMNPNF---IPKRWHIFVCFELLHLFL 196

Query: 216 TSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNT 275
              N    +     S                       K  FN A ++F    N T W  
Sbjct: 197 MLFNCYGKSLPLISSSSLYISLLSFFTITITVLACSHGK--FNDAKFVFATFYNETGWKN 254

Query: 276 GWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILA 335
           G    I GL    W+    D   HMA E +   R +PI I+ +++  ++    +C VI  
Sbjct: 255 GGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIMGTVAIGFVTS--LCYVIAM 312

Query: 336 CMN-PDVNAIVNSPYGQGITQVFQDALGKRWTLTFLS-LIIICQFLMGASTVLANSRQFW 393
             +  D++A+++S  G  I  ++  ALG +    FL  L++   F    +     +R  W
Sbjct: 313 FFSIKDLDAVLSSTTGAPILDIYNQALGNKSGAIFLGCLVLFTSFGCVIACHTWQARLCW 372

Query: 394 AFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGM 453
           +FARD+G+P S+F+ +V+  + VP+ +   S  +   +G L LA  TA  +L +  IA +
Sbjct: 373 SFARDNGLPLSRFWSQVNPHTGVPLNAHLMSCAWISLIGLLYLASSTAFQSLITGCIAFL 432

Query: 454 YMALVFPIALRLTYGRKDFRPGPFYLGHFWSTAN----GWLAVFFQLFAVLMVMFPYDKS 509
            ++ + P+   L   ++D   GPF+LG F   +N    GW      +F+++   FP    
Sbjct: 433 LLSYIIPVICLLA-KKRDIAHGPFWLGKFGLFSNIVLLGW-----TVFSIVFFSFP-PVL 485

Query: 510 GITKETMNYTVVIGPGFWVLSLIYY-FVWQRKFYEGPKSNLTDEEFVEAVG--EDAIDAM 566
            +TK+ MNY  V+  G+   S++Y+ +  +++F+   +S    ++F       ED+ D  
Sbjct: 486 PVTKDNMNYVCVVIVGYTAYSILYWRYKGKKEFHAVEESEHEQDDFANNFETIEDSRDHS 545

Query: 567 LS 568
           L+
Sbjct: 546 LA 547

>SAKL0A04730g Chr1 (432222..433847) [1626 bp, 541 aa] {ON} similar
           to uniprot|P19807 Saccharomyces cerevisiae YGL077C HNM1
           Choline transporter (permease) that also controls the
           uptake of nitrogen mustard expression is co- regulated
           with phospholipid biosynthetic genes and negatively
           regulated by choline and myo-inositol
          Length = 541

 Score =  150 bits (379), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 130/509 (25%), Positives = 246/509 (48%), Gaps = 17/509 (3%)

Query: 51  DALSATSDTQVLAEIGYK-EELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGA-VG 108
           D L  T+  +     G +  EL++ +S   I GV F +      I+++M  G+++G  + 
Sbjct: 26  DQLQHTNTVKSCTLEGERGAELRKSFSLWSILGVGFGLTNSWFGISASMVTGISSGGPMM 85

Query: 109 LNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSL 168
           + +G  +   + + +GI+LGELSS+ P AG  +    + AP K+R+  +Y  G       
Sbjct: 86  IVYGIIIIALVSVCIGISLGELSSAYPHAGGQFWWSLKLAPPKYRRFAAYMCGSFAWAGS 145

Query: 169 CASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVF-CACIVAITVLTSMNSKITARLQ 227
             +  S    +A +++    + +PDFEV     + +F C  ++ + ++    S  +  L 
Sbjct: 146 VFTSASTTLSVATELVGMYALTHPDFEVKR---WHIFVCFELLHLFLMIFNCSGKSLPLI 202

Query: 228 TFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDW-NTGWSWCINGLTP 286
           + S                   S      +N A ++F    N T W N+G ++ +  + P
Sbjct: 203 SSSALYISLFSFITITITVLACSHGQ---YNDAKFVFATFYNETGWKNSGIAFIVGLINP 259

Query: 287 AIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVN 346
           A W+    D   HMA E +   R +PI I+ +++  +I  +   I +   ++ +++ I++
Sbjct: 260 A-WSFSCLDCATHMAFEVEKPERVIPISIMGTVAIGFITSFCYVIAMFFSLH-NLDEIMS 317

Query: 347 SPYGQGITQVFQDAL-GKRWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSK 405
           S  G  I  ++  AL  K   +    LI+   F    +     +R  W+FARD+G+P+S+
Sbjct: 318 SNTGAPILDIYYQALQSKAGAIVLGCLILFTSFGCVIACHTWQARLCWSFARDNGLPYSR 377

Query: 406 FFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRL 465
           ++ KV+    VP+ +   S  + + LG L LA  TA ++L +  IA + ++ V P+ + L
Sbjct: 378 YWSKVNPELGVPLNAHLMSCAWIVLLGVLYLASSTAFNSLITGCIAFLLLSYVVPV-ICL 436

Query: 466 TYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPG 525
            + ++  + GPF+LG     +N ++ + + +FA++   FP     +TK+ MNY  V+  G
Sbjct: 437 LWRKRQIQHGPFWLGKIGLFSN-YVLLGWTVFALVFFCFP-AVMPVTKDNMNYASVVIVG 494

Query: 526 FWVLSLIYY-FVWQRKFYEGPKSNLTDEE 553
           + + SL+Y+ F  +  FY   +   T E 
Sbjct: 495 YLLYSLLYWRFRGRYTFYVVEEDEYTGEN 523

>KLTH0H04444g Chr8 (397467..399065) [1599 bp, 532 aa] {ON} similar
           to uniprot|P19807 Saccharomyces cerevisiae YGL077C HNM1
           Choline transporter (permease) that also controls the
           uptake of nitrogen mustard expression is co- regulated
           with phospholipid biosynthetic genes and negatively
           regulated by choline and myo- inositol
          Length = 532

 Score =  147 bits (372), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 125/522 (23%), Positives = 235/522 (45%), Gaps = 30/522 (5%)

Query: 47  IRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGG-LAAG 105
           +R  D +  T       E   +  L++++S   I GV F +      I+++M  G ++ G
Sbjct: 23  LRKEDDILVTESVSKNGEEHGEVHLRKQFSLWSILGVGFGLTNSWFGISTSMITGIMSGG 82

Query: 106 AVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDT 165
            + + +G  +   + + + ++LGELSS+ P AG  +    + AP K ++  +Y  G L  
Sbjct: 83  PMMVVYGIIIIALISICIAVSLGELSSAYPHAGGQFWWSLKLAPPKHKRFAAYMCGSLAW 142

Query: 166 LSLCASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITAR 225
                +  S    +A +I+    + +P+FEV    T+  F    + + +       +   
Sbjct: 143 AGSVFTSASTTLSVAAEIVGMYALTHPEFEVKRWHTFVCFEVLHLFLMLFNCYGKALPLI 202

Query: 226 LQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDW-NTGWSWCINGL 284
             +                      +     +N A ++F    N T W N+G ++ +  +
Sbjct: 203 SSSSLYISLFSFITITITVLACSHGK-----YNDAKFVFATFYNETGWKNSGIAFIVGLI 257

Query: 285 TPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAI 344
            PA W+    D   HMA E +   R +PI I+ +++  ++  +   I +   +  +++ +
Sbjct: 258 NPA-WSFSCLDCATHMAFEVEKPERVIPISILGTVAIGFVTSFCYVIAMFFSLQ-NLDKV 315

Query: 345 VNSPYGQGITQVFQDALG-KRWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPF 403
           VNS     I  ++  ALG K   +    L++   F    +     +R  W+FARD+G+PF
Sbjct: 316 VNSNTQVPILDIYYQALGSKAGAIVLGCLLLFTSFGCVIACHTWQARLCWSFARDEGLPF 375

Query: 404 SKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIAL 463
           S+++ +V     VP+ +   SSF+ + LG L LA  TA ++L +  I  + ++   P+  
Sbjct: 376 SRYWARVSPELGVPLNAHLMSSFWIVLLGCLYLASSTAFNSLITGCIMFLLLSYTIPVVC 435

Query: 464 RLTYGRKDFRPGPFYLGHFWSTAN----GWLAVFFQLFAVLMVMFPYDKSGITKETMNYT 519
            L   +++ + GPF+LG F   +N    GW+     LF+++   FP  +  + K+ MNY 
Sbjct: 436 -LLLKKRNIKHGPFWLGKFGCFSNVVLLGWM-----LFSIVFFCFP-SQMPVVKDNMNYA 488

Query: 520 VVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVGED 561
            V+  G+ + SL++   WQ       +   T     E  GED
Sbjct: 489 SVVIVGYLLFSLLF---WQF------RGRHTFHALEEEAGED 521

>KLLA0C15521g Chr3 complement(1347098..1348741) [1644 bp, 547 aa]
           {ON} similar to uniprot|P19807 Saccharomyces cerevisiae
           YGL077C HNM1 Choline transporter (permease) that also
           controls the uptake of nitrogen mustard expression is
           co- regulated with phospholipid biosynthetic genes and
           negatively regulated by choline and myo-inositol
          Length = 547

 Score =  147 bits (370), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 132/503 (26%), Positives = 223/503 (44%), Gaps = 22/503 (4%)

Query: 70  ELKREYSTVQIFGVAFSIMGLLPSIASTMDGGL-AAGAVGLNWGWFVAGGLILSVGIALG 128
            L++ +S   I GV F +      I+ +M  G+ + G + + +G  +   + + + + LG
Sbjct: 56  HLRKSFSLWSILGVGFGLTNSWFGISVSMVTGIYSGGPMMVVYGIIIIALISICIAVTLG 115

Query: 129 ELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVV 188
           ELSS+ P AG  +    Q AP K+R+  +Y  G         S  S    +A +++    
Sbjct: 116 ELSSAFPHAGGQFWWSLQLAPPKYRRLAAYLCGSFAWAGAIFSSASTTLSVASELVGMYA 175

Query: 189 VGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXX 248
           + +PDFEV     + VF  C   + +   M +     L   S                  
Sbjct: 176 LTHPDFEVKR---WHVF-VCFQILHLFLMMFNCSGKALPVISQSSLYISLISFFTITVTV 231

Query: 249 XSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDAR 308
            + S    +N A ++F    N T W  G    I GL    W+    D   HMA E ++  
Sbjct: 232 LACSHG-KYNDAKFVFATFYNETGWKNGVIAFIVGLINPAWSFSCLDCATHMAFEVENPE 290

Query: 309 RAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLT 368
           R +PI I+ ++   ++  +   I +   +  D+ A+ +S  G  I ++F+ A        
Sbjct: 291 RVIPISILCTVGIGFLTSFSYVIAMFFSLQ-DLEAVASSNTGMPILEIFRQATKSTPGAV 349

Query: 369 FLS-LIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFF 427
            L  LI+   F    +     +R  W+FARD+GIP+SK++ K+D    VP+ +   S   
Sbjct: 350 VLGCLILFTSFGCVIACHTWQARLCWSFARDNGIPYSKYWAKIDPELGVPLNAHLLSCAL 409

Query: 428 SIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTAN 487
              LG L +A  TA ++L +  IA +  +   P+   L   +++ + GPF+LG F + +N
Sbjct: 410 ISLLGCLYMASTTAFNSLITGCIAFLLFSYSVPVVCLLAR-KRNIKHGPFWLGKFGAFSN 468

Query: 488 ----GWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYY-FVWQRKFY 542
               GW      LFA++   FP     +TK+ MNY  V+  GF +  L ++ F  ++ FY
Sbjct: 469 IVLLGW-----NLFALVFFCFPAVMP-VTKDNMNYASVVIVGFLLFYLGFWQFKAKKVFY 522

Query: 543 EGPKSNLTDEEFVEAVGEDAIDA 565
                N    +  E+V  +A  A
Sbjct: 523 IREDENTDSNQ--ESVTTEAFHA 543

>TPHA0E02920 Chr5 (612901..614661) [1761 bp, 586 aa] {ON} Anc_6.205
           YGL077C
          Length = 586

 Score =  147 bits (371), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 133/536 (24%), Positives = 239/536 (44%), Gaps = 34/536 (6%)

Query: 2   GDDQESMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQV 61
           G D  S +K      H I+RN SN E+            S +GA +          D Q+
Sbjct: 12  GSDTTS-NKVIHVNSHAISRNTSNIEL------------STNGAKL---------DDQQL 49

Query: 62  LAEIGYKE-ELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGA-VGLNWGWFVAGGL 119
              +G  E  L++ +S   I GV F +      I++++  G+++G  + + +G  +   +
Sbjct: 50  NHHVGDGEVHLRKSFSAWSILGVGFGLTNSWFGISTSLVTGISSGGPLMVVYGIIIIALI 109

Query: 120 ILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGL 179
            + VG++LGELSS+ P AG  +    + AP K RK  +Y  G         +  S    +
Sbjct: 110 SVCVGVSLGELSSAYPHAGGQFWWSLKLAPPKHRKFAAYLCGSFAYAGSVFTSASTTLSV 169

Query: 180 AQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXX 239
           A +++    + +P+F+   P  + VF    +    L   N    +     S         
Sbjct: 170 ATEVVGMYALKHPEFK---PQRWHVFICFELLHLFLMLFNCYGKSLPLISSSSLYISLTS 226

Query: 240 XXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLH 299
                       S K  FN + ++F    N T W       I GL    W+    D   H
Sbjct: 227 FFTITVTVLACSSGK--FNDSKFVFASFYNETGWKNNGIAFITGLINPAWSFSCLDCATH 284

Query: 300 MAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQD 359
           MA E +   + +P+ I+ +I+  ++  +   I +   +  D++ ++NS  G  I  +F  
Sbjct: 285 MAFEVEKPEKIIPLAIMGTIAIGFVTSFCYVIAMFFSIR-DLDKLLNSTTGAPILDIFNQ 343

Query: 360 ALGKRWTLTFLS-LIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPM 418
           ALG      FL  LI+   F    +     +R  W+F+R+ G+P+S  + +V+    VP+
Sbjct: 344 ALGNSSGAIFLGCLILFTSFGCVIACHTWQARLCWSFSRNKGLPYSHLWSQVNPNVGVPL 403

Query: 419 RSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFY 478
            +   S      +G L +A  TA ++L +  IA + ++ + P+ + L   R+  + GPF+
Sbjct: 404 NAHLMSCALISIIGVLYIASSTAFNSLITACIAFLLLSYIIPV-ICLLLKRRQIKHGPFW 462

Query: 479 LGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYY 534
           LG F   +N  L + + +FA++   FP  +  +TK+ MNY  V+  G+ + +++Y+
Sbjct: 463 LGKFGLFSNIVL-LCWTIFAIVFFSFP-PQLPVTKDNMNYVSVVIVGYSIYAILYW 516

>YGL077C Chr7 complement(362225..363916) [1692 bp, 563 aa] {ON}
           HNM1Choline/ethanolamine transporter; involved in the
           uptake of nitrogen mustard and the uptake of glycine
           betaine during hypersaline stress; co-regulated with
           phospholipid biosynthetic genes and negatively regulated
           by choline and myo-inositol
          Length = 563

 Score =  146 bits (369), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 128/521 (24%), Positives = 229/521 (43%), Gaps = 27/521 (5%)

Query: 41  SAHGAPIRYIDALSATSDTQVLAEIGYKEE--LKREYSTVQIFGVAFSIMGLLPSIASTM 98
           S H   +R  + +    D      +    E  L++ +S   I GV F +      I+++M
Sbjct: 22  SMHKRDLRVEEEIKPLDDMDSKGAVAADGEVHLRKSFSLWSILGVGFGLTNSWFGISTSM 81

Query: 99  DGGLAAGA-VGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCIS 157
             G+++G  + + +G  +   + + +G +LGELSS+ P AG  +    + AP K+++  +
Sbjct: 82  VAGISSGGPMMIVYGIIIVALISICIGTSLGELSSAYPHAGGQFWWSLKLAPPKYKRFAA 141

Query: 158 YSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTS 217
           Y  G         +  S    +A +++    + +P+F    P  + +F    +    L  
Sbjct: 142 YMCGSFAYAGSVFTSASTTLSVATEVVGMYALTHPEF---IPKRWHIFVCFELLHLFLMF 198

Query: 218 MNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGW 277
            N    +     S                       K  FN A ++F    N T W  G 
Sbjct: 199 FNCYGKSLPIISSSSLYISLLSFFTITITVLACSHGK--FNDAKFVFATFNNETGWKNGG 256

Query: 278 SWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACM 337
              I GL    W+    D   HMA E +   R +PI I+ +++  ++  +   I +   +
Sbjct: 257 IAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIMGTVAIGFVTSFCYVIAMFFSI 316

Query: 338 NPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLS-LIIICQFLMGASTVLANSRQFWAFA 396
             D++A+++S  G  I  ++  ALG +    FL  LI+   F    +     +R  W+FA
Sbjct: 317 Q-DLDAVLSSTTGAPILDIYNQALGNKSGAIFLGCLILFTSFGCVIACHTWQARLCWSFA 375

Query: 397 RDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMA 456
           RD+G+P S+ + +V+  + VP+ +   S  +   +G L LA  TA  +L +  IA + ++
Sbjct: 376 RDNGLPLSRLWSQVNPHTGVPLNAHLMSCAWITLIGLLYLASSTAFQSLITGCIAFLLLS 435

Query: 457 LVFPIALRLTYGRKDFRPGPFYLGHFWSTAN----GWLAVFFQLFAVLMVMFPYDKSGIT 512
            + P+   L   +++   GPF+LG F   +N    GW      +F+V+   FP     +T
Sbjct: 436 YIIPVICLLA-KKRNIAHGPFWLGKFGFFSNIVLLGW-----TVFSVVFFSFP-PVLPVT 488

Query: 513 KETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEE 553
           K+ MNY  V+  G+   S++Y   W+   Y+G K     EE
Sbjct: 489 KDNMNYVCVVIVGYTAYSILY---WK---YKGKKEFHALEE 523

>Ecym_2212 Chr2 (417948..419585) [1638 bp, 545 aa] {ON} similar to
           Ashbya gossypii AFL081W
          Length = 545

 Score =  145 bits (367), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 124/477 (25%), Positives = 229/477 (48%), Gaps = 14/477 (2%)

Query: 70  ELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGA-VGLNWGWFVAGGLILSVGIALG 128
           EL++ +S   + GV F +      ++ +M  G+++G  + + +G  +   + + VG++LG
Sbjct: 46  ELRKSFSLWSVLGVGFGLTNSWFGLSVSMVTGISSGGPMMIIYGIVIIALISVCVGVSLG 105

Query: 129 ELSSSIPTAGAVYVACYQWAPEKWRKCISYSVG-FLDTLSLCASVCSIVYGLAQQILSAV 187
           ELSS+ P AG  +    Q AP K+++  +Y  G F    S+ AS  S +    + +L   
Sbjct: 106 ELSSAYPHAGGQFWWSLQLAPNKYKRLAAYLCGSFAWAGSVFASASSTL-STTRLLLGMY 164

Query: 188 VVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXX 247
            + +P  E+ D   + VF  C  A+ +   + +     L   S                 
Sbjct: 165 ALVHPSLEIKD---WHVF-VCYQALHMFLLLFNCHGRPLPLISSTALYVSLFSFITITIT 220

Query: 248 XXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDA 307
             + S   +FN A ++F + +N T W +     I GL    W+    D   HMA E +  
Sbjct: 221 VLASSHG-NFNDAKFVFANFRNETGWESNTIAFIVGLINPAWSFSCLDCATHMAFEVEKP 279

Query: 308 RRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTL 367
              +P  I+ +++  ++   + CI +   +  D++ I++S  G  I  ++  A G +   
Sbjct: 280 ETVIPTAILGTVAIGFLTSIVYCIAMFFSIR-DLDGILSSTTGAPILDIYYQASGSKACA 338

Query: 368 TFL-SLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSF 426
             L SL+++  F    S     +R  W+FARD+G P+S+ + KV+    VP+ +   S  
Sbjct: 339 IVLGSLVLLTSFTCVTSCHTWQARLCWSFARDNGFPYSRIWAKVNTELGVPLNAHLLSCA 398

Query: 427 FSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTA 486
               LG L LA  TA +AL +  I+ + ++   P+ + L   +++ + GPF+LG F + +
Sbjct: 399 VISLLGVLYLASSTAFNALVTGCISFLLLSYTVPV-ICLLLKQRNIKRGPFWLGKFGTFS 457

Query: 487 NGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYY-FVWQRKFY 542
           N ++ + + LF+++    P  K  ITK  MNY  ++   + + S++Y+ F   +KFY
Sbjct: 458 N-YVLLAWTLFSLVFFSLPPMKP-ITKGNMNYVSIVILSYLLYSILYWKFSGHKKFY 512

>CAGL0H03399g Chr8 complement(316110..317780) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P19807 Saccharomyces
           cerevisiae YGL077c HNM1 choline permease
          Length = 556

 Score =  145 bits (366), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 126/521 (24%), Positives = 235/521 (45%), Gaps = 25/521 (4%)

Query: 70  ELKREYSTVQIFGVAFSIMGLLPSIASTMDGGL-AAGAVGLNWGWFVAGGLILSVGIALG 128
            L++ +S   I GV F +      I+++M  G+ + G + + +G  +   + + +G++LG
Sbjct: 43  HLRKSFSLWSILGVGFGLTNSWFGISASMVTGINSGGPMMIVYGIIIIALISVCIGVSLG 102

Query: 129 ELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVV 188
           ELSS+ P AG  +    + AP K ++  +Y  G         +  S     A +++   V
Sbjct: 103 ELSSAYPHAGGQFWWSLKLAPTKHKRFAAYLCGSFAYAGSLFTSASTTLSAATELVGMYV 162

Query: 189 VGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXX 248
           + +P+F    P  + +F  C   + +   + +     L   S                  
Sbjct: 163 LTHPEF---TPKRWHIF-VCFELLHLFLMLFNCYGKSLPLISASSLYISLTSFFVITVTV 218

Query: 249 XSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDAR 308
            + S    FN A ++F    N T W       I GL    W+    D   HMA E +   
Sbjct: 219 LACSSG-KFNDAKFVFATFYNETGWKNSVIAFIVGLINPAWSFSCLDCATHMAFEVEKPE 277

Query: 309 RAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLT 368
           R +PI I+ +I+  ++  +   I +   +  D++A++ S  G  I  +++ A   +    
Sbjct: 278 RVIPIAIMGTIAIGFLTSFCYVIAMFFSIR-DLDALLASNTGAPILNIYEQATNSKAGAI 336

Query: 369 FLS-LIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFF 427
            L  L++I  F    +     +R  W+FARD+G+P+SK++ +V+  + VP+ +   SS  
Sbjct: 337 VLGCLVLITSFGCIIACHTWQARLGWSFARDNGLPYSKYWSQVNPNAGVPLNAHLMSSAL 396

Query: 428 SIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTAN 487
              +G L LA  TA ++L +  IA + ++ + P+ + L   ++  R GPF+LG F   +N
Sbjct: 397 IALIGVLYLASTTAFNSLITGCIAFLLLSYIIPV-ICLLMRKRQIRQGPFWLGKFGLFSN 455

Query: 488 ----GWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYY-FVWQRKFY 542
               GW      LFA++   FP     ++K+ MNY  V+  G+ V ++ Y+ F  +++F+
Sbjct: 456 IVLLGW-----TLFAIVFFSFP-PVLPVSKDNMNYVSVVIVGYTVYAIAYWEFKGKKEFH 509

Query: 543 E-----GPKSNLTDEEFVEAVGEDAIDAMLSNYSQAHQDKL 578
                        +E  +E + +      ++N    H DK+
Sbjct: 510 AVEEEESEDDIDVNESNIEIINDYHDSNSVNNIIHHHYDKV 550

>Smik_7.206 Chr7 complement(356650..358341) [1692 bp, 563 aa] {ON}
           YGL077C (REAL)
          Length = 563

 Score =  144 bits (362), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 131/545 (24%), Positives = 240/545 (44%), Gaps = 28/545 (5%)

Query: 20  NRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQ---VLAEIGYKEELKREYS 76
           N N S D +    V +       H   +R  + +    D     V+A  G +  L++ +S
Sbjct: 5   NDNTSGDYM----VPDQSSNNYVHKRDLRVEEEMKPLDDMNGKGVVAGDG-EVHLRKSFS 59

Query: 77  TVQIFGVAFSIMGLLPSIASTMDGGLAAGA-VGLNWGWFVAGGLILSVGIALGELSSSIP 135
              I GV F +      I+++M  G+++G  + + +G  +   + + +G +LGELSS+ P
Sbjct: 60  LWSILGVGFGLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALISICIGTSLGELSSAYP 119

Query: 136 TAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFE 195
            AG  +    + AP K+++  ++  G         +  S    +A +++    + + +F 
Sbjct: 120 HAGGQFWWSLKLAPPKYKRFAAFMCGSFAYAGSVFTSASTTLAVATEVVGMYALMHSEFT 179

Query: 196 VTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKV 255
              P  + +F    +    L   N    +     S                       K 
Sbjct: 180 ---PKRWHIFVCFELLHLFLMFFNCYGKSLPIISSSSLYISLLSFFTITITVLACSHGK- 235

Query: 256 SFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGI 315
            FN + ++F    N T W  G    I GL    W+    D   HMA E +   R +PI I
Sbjct: 236 -FNDSKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAI 294

Query: 316 VASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLS-LII 374
           + +I+  ++  +   I +   +  D++ I++S  G  I  ++  ALG +    FL  LI+
Sbjct: 295 MGTIAIGFVTSFCYVIAMFFSIK-DLDGILSSTTGAPILDIYNQALGNKSGAIFLGCLIL 353

Query: 375 ICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGAL 434
              F    +     +R  W+F+RD+G+P S+ + +V+  + VP+ +   S  +   +G L
Sbjct: 354 FTSFGCVIACHTWQARLCWSFSRDNGLPLSRLWSQVNPHTGVPLNAHLMSCAWISLIGLL 413

Query: 435 CLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTAN----GWL 490
            LA  TA  +L +  IA + ++ + P+   L   ++D   GPF+LG F   +N    GW 
Sbjct: 414 YLASSTAFQSLITGCIAFLLLSYIIPVVCLLN-KKRDIAHGPFWLGKFGFFSNIVLLGW- 471

Query: 491 AVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYY-FVWQRKFYEGPKSNL 549
                LFAV+   FP     +TK+ MNY  V+  G+   S++Y+ +  +++F+   +S +
Sbjct: 472 ----TLFAVVFFSFP-PVLPVTKDNMNYVCVVIVGYTAYSILYWKYKGKKEFHAVEESEI 526

Query: 550 TDEEF 554
              +F
Sbjct: 527 DQTDF 531

>KNAG0D05140 Chr4 complement(937630..939261) [1632 bp, 543 aa] {ON}
           Anc_6.205 YGL077C
          Length = 543

 Score =  139 bits (350), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 127/493 (25%), Positives = 222/493 (45%), Gaps = 17/493 (3%)

Query: 68  KEELKREYSTVQIFGVAFSIMGLLPSIASTMDGG-LAAGAVGLNWGWFVAGGLILSVGIA 126
           +  L++ +S   I GV F +      I+ +M  G ++ G + + +G  +   + + VG +
Sbjct: 51  EPHLRKSFSLWSILGVGFGLTNSWFGISVSMVTGIMSGGPMMIVYGIIIIALISVCVGGS 110

Query: 127 LGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSA 186
           LGELSS+ P AG  +    + AP + R+  ++  G         +  S       +++  
Sbjct: 111 LGELSSAYPHAGGQFWWALKLAPARHRRFAAFLCGSFAYAGSVFTSASTTLSAGTEVVGM 170

Query: 187 VVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXX 246
             + +P F V     + VF  C   I +   M      +                     
Sbjct: 171 YALKHPGFVVKR---WHVF-VCFELIHLFL-MLFNCYGKSLPLISSSSLYISLISFLTIT 225

Query: 247 XXXSRSDKVSFNKASYIFGDVQNLTDW-NTGWSWCINGLTPAIWTIGAYDSCLHMAEEAK 305
                    SFN + ++F    N T W N+G ++ +  + PA W+    DS  HMA E +
Sbjct: 226 ITVLACSSGSFNDSKFVFATFYNETGWKNSGMAFIMGLINPA-WSFSCLDSATHMAFEVE 284

Query: 306 DARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRW 365
              R +P  I+ +++  ++  +   I +   +  D++A++ S  G  I ++++ ALG   
Sbjct: 285 RPERVIPTAIMGTVAIGFVTSFCYVIAMFFSIR-DISAVLKSTTGAPILEIYRQALGNEG 343

Query: 366 TLTFLS-LIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGS 424
              FL  L++   F    S     +R  W+F+RD+G+P+SK++ +V+    VP+ +   S
Sbjct: 344 GAIFLGCLVLFTSFGCIISCHTWQARLCWSFSRDNGLPYSKWWSQVNPDVGVPLNAHLMS 403

Query: 425 SFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWS 484
             +   +G L LA  TA ++L +  IA + ++   PI   L + R+D   GPF+LG F  
Sbjct: 404 CAWISLIGVLYLASSTAFNSLITACIAFLLLSYSVPIVC-LLWRRRDIPQGPFWLGKFGL 462

Query: 485 TANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYY-FVWQRKFY- 542
            AN  L   + +FAV+   FP     + +  MNY  V+  GF   SL+Y+ F   R F+ 
Sbjct: 463 FANVVLLA-WTVFAVVFFSFP-PVLPVDRNNMNYVCVVIVGFVTYSLLYWRFKGSRDFHK 520

Query: 543 --EGPKSNLTDEE 553
             + P   L D E
Sbjct: 521 VEDEPGEKLVDAE 533

>NDAI0I01140 Chr9 (276535..278337) [1803 bp, 600 aa] {ON} Anc_6.205
          Length = 600

 Score =  139 bits (349), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 122/477 (25%), Positives = 227/477 (47%), Gaps = 16/477 (3%)

Query: 70  ELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGA-VGLNWGWFVAGGLILSVGIALG 128
            L++ +S   + GV F +      I+++M  G+++G  + + +G  +   + + +G +LG
Sbjct: 67  HLRKSFSLWSVLGVGFGLTNSWFGISTSMVTGISSGGPMMVIYGIIIIALISICIGTSLG 126

Query: 129 ELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVV 188
           ELSS+ P AG  +    + AP K+++  +Y  G         +  S     A +++    
Sbjct: 127 ELSSAYPHAGGQFWWSLKLAPPKYKRLAAYMCGSFAYAGSVFTSASTTLSAATEVVGMYA 186

Query: 189 VGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXX 248
           + + DF    P  + VF  C   + +   + +     L   S                  
Sbjct: 187 LTHEDFV---PKRWHVF-VCFEILHLFLMIFNCYGKSLPIISASSLYISLSSFLIITITV 242

Query: 249 XSRSDKVSFNKASYIFGDVQNLTDW-NTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDA 307
            + S +  FN A ++F    N T W N+G ++ +  + PA W+    D   HMA E +  
Sbjct: 243 LACS-RGQFNDAKFVFATFYNETGWKNSGIAFIVGLINPA-WSFSCLDCATHMAFEVEKP 300

Query: 308 RRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTL 367
            R +PI I+++I+  +I  +   I +   +  D+++I+ S  G  I  ++  ALG +   
Sbjct: 301 ERVIPIAILSTIAIGFITSFCYVISMFFSLR-DLDSILKSTTGAPILDIYNQALGNKAGA 359

Query: 368 TFLS-LIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSF 426
             L  +I+   F    +     +R  W+FARD+G+P+SK + +V+ +  VP+ +   S  
Sbjct: 360 IILGCMILFTSFGCVIACHTWQARLGWSFARDNGLPYSKLWAQVNPQVGVPLNAHLMSCA 419

Query: 427 FSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTA 486
           +   +G L LA  TA ++L +  IA + ++ + P++  L   R+  R GPF+LG F   +
Sbjct: 420 WISLIGILYLASSTAFNSLITGCIAFLLLSYIIPVSCLLLKKRQ-IRHGPFWLGKFGLFS 478

Query: 487 NGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYE 543
           N  L + + +FA++   FP     +TK+ MNY  V+  G+ + S++Y   W  K Y+
Sbjct: 479 NIVL-LLWTVFAIVFFSFP-AMMPVTKDNMNYVAVVIAGYTLYSVLY---WNFKGYK 530

>Kpol_1033.41 s1033 complement(106505..108265) [1761 bp, 586 aa]
           {ON} complement(106505..108265) [1761 nt, 587 aa]
          Length = 586

 Score =  138 bits (348), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 144/591 (24%), Positives = 261/591 (44%), Gaps = 44/591 (7%)

Query: 1   MGDDQE---SMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATS 57
           M  DQ    S++     ++     N+ N+      V EL V  + H        ++S   
Sbjct: 1   MKKDQSEIISLNIHGSNIDQHSKLNSFNER-----VQELTVNENDH--------SISDKK 47

Query: 58  DTQVLAEIGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGA-VGLNWGWFVA 116
           + Q     G +  L++ +S   I GV F +      I++++  G+++G  + + +G  + 
Sbjct: 48  EIQQGGGNGDEVHLRKSFSLWSILGVGFGLTNSWFGISASLVTGISSGGPMMVVYGIIII 107

Query: 117 GGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIV 176
             + + VG++LGELSS+ P AG  +    + AP+K ++  +Y  G         +  S  
Sbjct: 108 ALISVCVGVSLGELSSAYPHAGGQFWWSLKLAPQKHKRFAAYLCGSFAYAGSVFTSASTT 167

Query: 177 YGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXX 236
             +A +++    + +P+F    P  + VF  C   + +   + +     L   S      
Sbjct: 168 LSVATELVGMYSLTHPEF---IPQRWHVF-VCFELLHLFLMLFNCYGKSLPLISTTSLYI 223

Query: 237 XXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDS 296
                          S   +FN   ++F    N T W       I GL    W+    D 
Sbjct: 224 SLASFLTITVTVLGCSHG-NFNDPKFVFATFYNQTGWKNSVIAFITGLINPAWSFSCLDC 282

Query: 297 CLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQV 356
             HMA E +   R +PI I+ +I+  ++  +   I +   +  D++A+  S  G  I  +
Sbjct: 283 ATHMAFEVEKPERVIPIAIMGTIAIGFVTSFCYVIAMFFSIR-DLDALFASHTGAPILDI 341

Query: 357 FQDALGKRWTLTFLS-LIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSH 415
           +  ALG +     L  LI+   F    +     +R  W+F+RD G+P+S  + +V+ +  
Sbjct: 342 YNQALGNKGGAIVLGCLILFTSFGCVIACHTWQARLCWSFSRDKGLPYSHLWAQVNPQLG 401

Query: 416 VPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPG 475
           VP+ +   S  +   +G L +A  TA ++L +  IA + ++ + P+   L   R+  + G
Sbjct: 402 VPLNAHLMSCAWISLIGILYIASTTAFNSLITGCIAFLLLSYIIPVICLLKKKRQ-IKHG 460

Query: 476 PFYLGHFWSTAN----GWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSL 531
           PF+LG F   +N    GW      LFA++   FP  +  +TK+ MNY  V+  G+ +  L
Sbjct: 461 PFWLGKFGLFSNIVLLGW-----TLFAIVFFSFP-PQLPVTKDNMNYVSVVIVGYTLYVL 514

Query: 532 IYYFVWQRKFYEGPKSNLTDEEFVEAVG---EDAIDAMLSNYSQAHQDKLS 579
           IY+     KF    + + T+EE  E  G   ED  D M+++Y+   ++ L+
Sbjct: 515 IYW-----KFKGSKEFHATEEESEEEEGDLVEDG-DMMIASYNGDLEESLN 559

>TBLA0A01960 Chr1 complement(473787..475571) [1785 bp, 594 aa] {ON}
           Anc_6.205 YGL077C
          Length = 594

 Score =  138 bits (348), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 132/533 (24%), Positives = 230/533 (43%), Gaps = 21/533 (3%)

Query: 53  LSATSDTQVLAEIGYKEE--LKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGA-VGL 109
           +S      +  E    EE  L++ +S   I GV F +      I+++M  G+ +G  + +
Sbjct: 38  ISDLDKNSINNEFNQTEEVHLRKSFSLWSILGVGFGLTNSWFGISASMVTGIESGGPMMI 97

Query: 110 NWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLC 169
            +G  +   + + VG++LGELSS+ P AG  +    + AP K R+  +Y  G        
Sbjct: 98  VYGIIIISLISICVGVSLGELSSAYPHAGGQFFWSLKLAPPKHRRFAAYMCGSYAYAGSV 157

Query: 170 ASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTF 229
            +  S    +A +++    + +  F    P  + VF    +    L   N     +   F
Sbjct: 158 FTSASTTLSVATELVGMYALCHESFV---PRRWHVFVCFELLHLFLLLFNCY--GKSLPF 212

Query: 230 SXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIW 289
                                      +N A ++F    N T W  G    I GL    W
Sbjct: 213 ISSSSLYISLLSFFTITITVLACAHGKYNDAKFVFATFYNETGWKNGGIAFIVGLINPAW 272

Query: 290 TIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPY 349
           +    D   HMA E +   R +P+ I+ +I+  +I  +   I +   +N D+NA+ NS  
Sbjct: 273 SFSCLDCATHMAFEVEKPERVIPMAIMGTIAIGFITSFCYVIAMFFSLN-DLNALFNSHT 331

Query: 350 GQGITQVFQDAL-GKRWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFK 408
           G  I  ++  AL  K   +    L++   F    +     +R  W+FA D G+P+SK++ 
Sbjct: 332 GAPILDIYNQALHNKAGAIVLGCLVLFTSFGCVIACHTWQARLCWSFATDQGLPYSKWWA 391

Query: 409 KVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYG 468
           +V+    VP+ +   S  +   +G L LA  TA ++L +  IA + ++ + P+ + L   
Sbjct: 392 EVNPTLGVPLNAHLMSCGWIAIIGLLYLASSTAFNSLITGCIAFLLLSYIIPV-ICLLQK 450

Query: 469 RKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWV 528
           ++  + GPF+LG F   +N  L + + LF+++   FP +   + +  MNY  V+  GF  
Sbjct: 451 KRQIKHGPFWLGKFGLFSNIVL-LCWTLFSIVFFSFPPNLP-VNRNNMNYVCVVIVGFTC 508

Query: 529 LSLIYYFVWQRKFYEGPKSNLTDEEFVE-----AVGEDAIDAMLSNYSQAHQD 576
             LIY   W+ K  +   S   D++ +E      +  D   A  SN S +H  
Sbjct: 509 YQLIY---WKWKGAKEFHSAQDDDDNIEYENNSNINMDTYMARTSNISDSHSQ 558

>NCAS0D03750 Chr4 complement(696686..698395) [1710 bp, 569 aa] {ON}
           Anc_6.205
          Length = 569

 Score =  136 bits (343), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 119/481 (24%), Positives = 216/481 (44%), Gaps = 19/481 (3%)

Query: 70  ELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGA-VGLNWGWFVAGGLILSVGIALG 128
            L++ +S   I GV F +      I+++M  G+++G  + + +G  +   + + +G +L 
Sbjct: 54  HLRKSFSVWSILGVGFGLTNSWFGISASMVTGISSGGPMMVVYGIIIIALVSICIGTSLS 113

Query: 129 ELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVV 188
           ELSS+ P AG  +    + AP K ++  +Y  G         +  S    +A +++    
Sbjct: 114 ELSSAYPHAGGQFFWSLKLAPPKHKRFAAYLCGSFAYAGSVFTSASTTLSVATEVVGMYA 173

Query: 189 VGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXX 248
           + +PDF+V     + +F  C   + +L  + +     L   S                  
Sbjct: 174 LTHPDFKVQR---WHIF-VCFELLHLLLMLFNCYGKSLPFISASSLYISLVSFFTITVTV 229

Query: 249 XSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDAR 308
            + S   +FN   ++F    N T W  G    I GL    W+    D   HMA E +   
Sbjct: 230 LACSHG-NFNDPKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPE 288

Query: 309 RAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLT 368
           R +PI I+ +I+  +   +   I +   +  D++ I+ S  G  I  ++   LG +    
Sbjct: 289 RVIPIAIMGTIAIGFATSFCYVIAMFFSLR-DLDKILTSTTGAPILDIYNQVLGNKSGAI 347

Query: 369 FLS-LIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFF 427
           FL  L++   F    +     +R  W+FARD+G+P+S  + +V+ +  VP+ +   S  +
Sbjct: 348 FLGCLVLFTSFGCVIACHTWQARLCWSFARDNGLPWSHLWAQVNPQMGVPLNAHLMSCAW 407

Query: 428 SIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTAN 487
              +G L LA  TA ++L +  IA + ++ + P+ + L   ++  R GPF+LG F   +N
Sbjct: 408 ISLIGILYLASSTAFNSLITGCIAFLLLSYIIPV-ICLLMKKRQIRHGPFWLGKFGLFSN 466

Query: 488 ----GWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYE 543
                W A     FA++   FP     +TK+ MNY  V+  G+   +L+Y+    RK + 
Sbjct: 467 IILLAWTA-----FAIIFFSFP-PVLPVTKDNMNYVAVVIVGYTSYALLYWRFKGRKEFH 520

Query: 544 G 544
            
Sbjct: 521 A 521

>TDEL0G01410 Chr7 (285255..286916) [1662 bp, 553 aa] {ON} Anc_6.205
           YGL077C
          Length = 553

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 132/522 (25%), Positives = 231/522 (44%), Gaps = 44/522 (8%)

Query: 32  SVSELRVVTSAHGAPIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIMGLL 91
           S+SE+    S  GA       L    DT ++ E G +  L++ +S   I GV F +    
Sbjct: 16  SLSEVHTRESHKGA-------LEYGKDT-MMTERGGEVHLRKSFSLWSILGVGFGLTNSW 67

Query: 92  PSIASTMDGGL-AAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPE 150
             I+ +M  G+ + G + + +G  +   + + VG +LGELSS+ P AG  +    + AP 
Sbjct: 68  FGISVSMVTGIFSGGPMMIVYGIIIVALISICVGASLGELSSAYPHAGGQFWWSLKLAPP 127

Query: 151 KWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIV 210
           K ++  +Y  G         +  S     A +++    + +PDF    P  + VF  C  
Sbjct: 128 KHKRFAAYLCGSFAYAGSVFTSASTTLSAATEVVGMYALAHPDF---TPKRWHVF-VCFE 183

Query: 211 AITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNL 270
            + +  ++ +     L   S                   + S    FN A ++F    N 
Sbjct: 184 IMHLFLTLFNCYGKSLPLISASALYISLLSFFTITVTVLACSSG-KFNDAKFVFATFYNE 242

Query: 271 TDW-NTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASI------SSCW 323
           T W N+G ++ +  + PA W+    D   HMA E +   R +PI I+ ++      S C+
Sbjct: 243 TGWKNSGIAFIVGLINPA-WSFSCLDCATHMAFEVEKPERVIPIAIMGTVAIGFATSFCY 301

Query: 324 ILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLS-LIIICQFLMGA 382
           ++     I        D+++++ S  G  I  ++  ALG      FL  +++   F    
Sbjct: 302 VISMFFSI-------RDLDSLMQSATGAPILDIYNQALGNTSGAIFLGCMVLFTSFGCII 354

Query: 383 STVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAA 442
           +     +R  W+FARD G+PFS    +V+ +  VP+ +   S      +G L LA  TA 
Sbjct: 355 ACHTWQARLGWSFARDKGLPFSGLLSQVNPQVGVPLNAHLMSCALISLIGLLYLASSTAF 414

Query: 443 DALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFY---LGHFWSTA-NGWLAVFFQLFA 498
           ++L +  IA + ++   P+ + L   ++  + GPF+   LG+F++    GW      +F 
Sbjct: 415 NSLCTGCIAFLLLSYSIPV-ICLLRKKRQIKHGPFWFGKLGYFFNIVLLGW-----AVFC 468

Query: 499 VLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRK 540
           ++   FP     +TK+ MNY  V+  GF   +L+Y   W+ K
Sbjct: 469 IVFFSFP-PALPVTKDNMNYVSVVIVGFTAYALLY---WKFK 506

>ZYRO0G08602g Chr7 complement(697178..698887) [1710 bp, 569 aa] {ON}
           similar to uniprot|P19807 Saccharomyces cerevisiae
           YGL077C HNM1 Choline transporter (permease) that also
           controls the uptake of nitrogen mustard expression is
           co- regulated with phospholipid biosynthetic genes and
           negatively regulated by choline and myo-inositol
          Length = 569

 Score =  134 bits (337), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 121/503 (24%), Positives = 226/503 (44%), Gaps = 13/503 (2%)

Query: 66  GYKEE--LKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLN-WGWFVAGGLILS 122
           G  EE  L++ +S   I GV F +      I++++  GL++G   L  +G  +   + ++
Sbjct: 46  GGSEEVVLRKSFSLWSILGVGFGLTNSWFGISASLVTGLSSGGPLLVIYGIILISLISIT 105

Query: 123 VGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQ 182
           +G++LGEL+S+ P AG  +    + AP K ++  +Y  G         +  S    +A +
Sbjct: 106 IGVSLGELTSAYPHAGGQFWWSLKLAPPKHKRFAAYMCGSFAYAGAIFTSASTTLSVASE 165

Query: 183 ILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXX 242
           +++   + + DF    P  + VF   ++    L   N      L   +            
Sbjct: 166 LVAMYQLTHEDF---TPKRWQVFVTYLILHFFLMQFNC-YGKSLPLIASSSLYISLLSFI 221

Query: 243 XXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAE 302
                  + S    FN A ++F    N T W++G    I GL    W+    D   HMA 
Sbjct: 222 VITITVLACSSG-HFNSAKFVFSHFYNETGWSSGGIAFIVGLINPAWSFSCLDCATHMAF 280

Query: 303 EAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALG 362
           E +     +P  I+ +I+  +I  +   I +   +  D+ +++N+  G  +  +++ AL 
Sbjct: 281 EVEKPETIIPTAILGTIAIGFITSFCYVISLFFSIR-DLPSVLNNTGGFPVLVIYEQALN 339

Query: 363 KRWTLTFLS-LIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSI 421
            +     L  LI+   F    ++    SR  W+F+RD G+PF+  + KV+ R  VP+ + 
Sbjct: 340 SKAGAIVLGCLILFTSFGCVIASHTWQSRLCWSFSRDGGLPFAGLWSKVNSRMGVPLNAH 399

Query: 422 WGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGH 481
             S  +   +G L LA  TA ++L +  IA + ++   P+ + L   ++    GPF+ G 
Sbjct: 400 LMSCVWVAIIGFLYLASSTAFNSLITACIAFLLLSYSIPV-ICLLMKKRQIAHGPFWFGK 458

Query: 482 FWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKF 541
           F    N  L + + +F ++   FP D   + K+ MNY  V+  G+++ SLIY+  W  K 
Sbjct: 459 FGLFCNIAL-LLWTVFCLVFFSFPPDYP-VNKDNMNYVSVVIVGYFLYSLIYWKFWASKD 516

Query: 542 YEGPKSNLTDEEFVEAVGEDAID 564
           +     +  ++   + +  +  D
Sbjct: 517 FHTHDDDDDEQTVAQEISNEGFD 539

>AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL077C (HNM1)
          Length = 542

 Score =  129 bits (324), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 117/479 (24%), Positives = 217/479 (45%), Gaps = 13/479 (2%)

Query: 64  EIGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGA-VGLNWGWFVAGGLILS 122
           ++   + L++ +S   + GV F +      I+ +M  G+ +G  + + +G  +   + + 
Sbjct: 35  QVDEGQLLRKSFSLWSVLGVGFGLTNSWFGISVSMITGIGSGGPMMIVYGIVIIALVSVC 94

Query: 123 VGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQ 182
           VG++L ELSS+ P AG  +    + AP K R+  +Y  G L       +  S     A +
Sbjct: 95  VGVSLAELSSAYPHAGGQFWWSLKLAPPKHRRLAAYLCGSLAWAGSVFTSASTTLSAATE 154

Query: 183 ILSAVVVGNPDFEVTDPITYGVF-CACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXX 241
           ++    +  P+F V     + VF C  I+   ++       +  L + S           
Sbjct: 155 LVGMYALVRPEFVVRK---WHVFVCYQILHCFLMLFNCYGRSLPLVSSSALYVSLFSFVT 211

Query: 242 XXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMA 301
                   SR     FN   ++F   +N T W       I GL    W+    D   HMA
Sbjct: 212 ITITVVACSRGH---FNDPKFVFATFRNETGWQNSAIAFIVGLINPAWSFSCLDCATHMA 268

Query: 302 EEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDAL 361
            E +   R +PI I+ +++  ++  +   I +   +  D++ I+ S  G  I  ++  AL
Sbjct: 269 FEVEQPERVIPIAILGTVAIGFLTSFCYVIAMFFSLR-DLSEIMTSNTGVPILDIYYQAL 327

Query: 362 GKR-WTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRS 420
           G R   L   SL+++       S+    +R  W+FARD G+P+S  + +V+    VP+ +
Sbjct: 328 GSRAGALVLGSLVLLTSVGCIISSHTWQARLCWSFARDGGLPYSHLWARVNRSVGVPLNA 387

Query: 421 IWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLG 480
              S      LG L +A  TA ++L +  IA + ++ + P+ + L   ++  + GPF+LG
Sbjct: 388 HLMSCVCISLLGILYMASSTAFNSLITGCIAFLLLSYIVPV-ICLLLKKRQIKHGPFWLG 446

Query: 481 HFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQR 539
            F +  N ++ + + +F ++    P  K  +TK+ MNY  V+  G+ +  LI++ +  R
Sbjct: 447 PFGAFCN-YVLLAWTVFVLIFFSLPPLKP-VTKDNMNYVSVVVVGYILYVLIFWRLQGR 503

>KAFR0K00360 Chr11 (79233..80849) [1617 bp, 538 aa] {ON} Anc_6.205
           YGL077C
          Length = 538

 Score =  127 bits (320), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 119/517 (23%), Positives = 228/517 (44%), Gaps = 21/517 (4%)

Query: 54  SATSDTQVLAEIGYKEE----LKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGA-VG 108
           + + D ++L++   +++    L++ +S   I GV F +      I+++M  G+ +G  + 
Sbjct: 24  TPSKDPEILSDKLIEQDEDIHLRKSFSLWSILGVGFGLTNSWFGISASMITGITSGGPMM 83

Query: 109 LNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSL 168
           + +G  +   + + +G++LGELSS+ P AG  +    Q A  K ++  +Y  G       
Sbjct: 84  IVYGIIIIALISICIGVSLGELSSAYPHAGGQFHWTLQLASPKHKRFAAYMCGSFAYAGS 143

Query: 169 CASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQT 228
             +  S    +A  ++    + + +F    P  + VF    +    L   N    +    
Sbjct: 144 VFTSASTTLSVATLLVGMYSLTHENF---IPKRWHVFVCFELVHLFLMLFNCYGKSLPLI 200

Query: 229 FSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAI 288
            S                     S K  FN + ++F    N T W +     I GL    
Sbjct: 201 SSSSLYISLFSFFTITITVLACSSGK--FNDSKFVFATFYNETGWKSSAIAFIVGLINPA 258

Query: 289 WTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSP 348
           W+    D   HMA E +   R +P+ I+ +I+  ++  +   I +   +  ++  ++NS 
Sbjct: 259 WSFSCLDCATHMAFEVEKPERVIPMAIMGTIAIGFLTSFAYVISMFFSIR-NIQDVLNSN 317

Query: 349 YGQGITQVFQDALGKRWTLTFLS-LIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFF 407
            G  I +++  ALG +     L  L++   F    +     +R  W+FARD G+P+S+F+
Sbjct: 318 SGAPILEIYNQALGNKAGAVILGCLVLFTSFGCVIACHTWQARLCWSFARDKGLPYSRFW 377

Query: 408 KKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTY 467
            +V+    VP+ +   S      +G L LA  TA ++L +  IA + ++   P+ + L  
Sbjct: 378 SQVNPTFGVPLHAHLMSCTLISIIGLLYLASSTAFNSLITACIAFLLLSYSIPV-ICLLL 436

Query: 468 GRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFW 527
            ++D   GPF+LG F   +N  L   + +F+++   FP  +  + +  MNY  V+  G+ 
Sbjct: 437 RKRDMNRGPFWLGKFGLFSNIVLLA-WTVFSLVFFSFP-SQIPVNRNNMNYVSVVIAGYT 494

Query: 528 VLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVGEDAID 564
             S+ Y+FV      +G      D+  + +  E+  D
Sbjct: 495 FFSVSYWFV------KGKNEFYLDDNIISSSSEEEAD 525

>Kwal_56.24009 s56 complement(812371..813399) [1029 bp, 342 aa] {ON}
           YGL077C (HNM1) - Transporter (permease) for choline and
           nitrogen mustard; share homology with UGA4 [contig 168]
           PARTIAL
          Length = 342

 Score =  115 bits (288), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 89/316 (28%), Positives = 156/316 (49%), Gaps = 21/316 (6%)

Query: 256 SFNKASYIFGDVQNLTDW-NTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIG 314
           ++N   ++F    N T W N+G ++ +  + PA W+    D   HMA E +   R +PI 
Sbjct: 39  NYNDPKFVFATFFNETGWRNSGIAFIVGLINPA-WSFSCLDCATHMAFEVERPERVIPIS 97

Query: 315 IVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFL-SLI 373
           I+ +++  ++  +   I +   ++ +++ IV S  G  I  ++  ALG +     L  L+
Sbjct: 98  ILGTVAIGFVTSFCYVIAMFFSLH-NLDEIVGSNTGAPILDIYLQALGNKAGAVVLGCLV 156

Query: 374 IICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGA 433
           +   F    +     +R  W+FARD+G+P+S+ + KV     VP+ +   S F+ + LG 
Sbjct: 157 LFTSFGCVIACHTWQARLCWSFARDEGLPYSRIWAKVSPELGVPLNAHLMSCFWIVLLGL 216

Query: 434 LCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTAN----GW 489
           L LA  TA ++L +  I  +  + + P+ + L   +++ + GPF+LG F   AN    GW
Sbjct: 217 LYLASTTAFNSLITGCIMFLLFSYIVPV-ICLLIKKRNIKHGPFWLGKFGLFANIVLLGW 275

Query: 490 LAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNL 549
                 LFA++   FP+    + K+ MNY  V+  G+ + SL++   W    ++G  S  
Sbjct: 276 -----SLFALVFFCFPFVMP-VDKDNMNYASVVIVGYILFSLLF---WH---FKGRHSFH 323

Query: 550 TDEEFVEAVGEDAIDA 565
             EE  E V     DA
Sbjct: 324 LLEEEEENVFPLETDA 339

>TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa]
           {ON} Anc_1.173 YKL174C
          Length = 659

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 118/541 (21%), Positives = 232/541 (42%), Gaps = 27/541 (4%)

Query: 54  SATSDTQVLAEIGYKEELKREY-STVQIFGVAFSIMGLLPSIASTMDGGLA-AGAVGLNW 111
           + T   Q +    Y ++L +   S   + G+ F +M  +  + ++M  GL   G   + W
Sbjct: 37  AETEGPQEVEHFNYHQDLDKSLLSRGSVMGLGFGLMSPVLGMCTSMAIGLMNGGPATIMW 96

Query: 112 GWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCAS 171
           G+ ++G ++    ++LGE+ S  P    ++V+    AP+K +   S+  G+L  +     
Sbjct: 97  GFLISGIMVWFCSLSLGEIVSKFPME--LHVSSAMLAPKKLKLICSWYTGWLTLIGNWTM 154

Query: 172 VCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSX 231
             SI +  AQ  +S +++ N D      + +       + +T++  +N K+   ++  + 
Sbjct: 155 STSITFAGAQLTISLILMANNDLISETNLIFFTVIVFYLVVTIVGIVNLKLARFIEIINK 214

Query: 232 XXXX-XXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWT 290
                                S K    K +    D  +L+ +   +   I G   + +T
Sbjct: 215 VCVYWIIYAILFIDILLLFFHSGKYRSLKFALFHFD-NSLSGYANCFVSFIIGFQQSNFT 273

Query: 291 IGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYG 350
           +  +     +A+E K+A R +P  + AS+    + G++  + I+  + PD   +      
Sbjct: 274 LQGFSMLPALADEVKEAERDIPRAMSASVLISTVSGFIFLLPIMLIL-PDNTNLFADHKI 332

Query: 351 QGITQVFQDALGKRWTLTFLSLIIICQ-FLMGASTVLANSRQFWAFARDDGIPFSKFFKK 409
             I  +F  +    +   FL L+I+   F  G  ++  +SR  ++F+RD  IP  +F+  
Sbjct: 333 LPIVSIFTQSTHSTFVSFFLVLMILGNLFFSGIGSITTSSRVVYSFSRDHAIPKHEFWTY 392

Query: 410 VDER--SHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTY 467
           VD +  S VP  S+  S   S  LG L L    A +A    ++  +  A V P+ L L  
Sbjct: 393 VDPQSVSKVPKYSVLLSMAVSYLLGILALFSTAAFNAFIGAAVLCLCSATVLPLVLVLFT 452

Query: 468 GRKDFRPGPFYLGHFWSTANGWL----AVFFQLFAVLMVMFPYDKSGITKETMNYTVVIG 523
            R+  R  P  + +      GW+    ++ + L ++  V  P  +  +T  TMNY +++ 
Sbjct: 453 RRRILRNAPIKIHY----KLGWIVNITSIVWLLLSMGSVCLP-SQVPVTVRTMNYALIVY 507

Query: 524 PGFWVLSLIYYFVWQRKFYEGPKSNLTDEEF--VEAVGEDAIDAMLSN---YSQAHQDKL 578
               +   I YF W +  +  P   L DE++  + ++ E A  +       +S+ + D+ 
Sbjct: 508 VACLIAITILYFRWGKYHFTLP---LVDEDYKNLTSIMESATSSNFPTNFAFSKKNDDQT 564

Query: 579 S 579
           S
Sbjct: 565 S 565

>CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa]
           {ON} highly similar to uniprot|P36029 Saccharomyces
           cerevisiae YKL174c
          Length = 621

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 119/516 (23%), Positives = 220/516 (42%), Gaps = 29/516 (5%)

Query: 48  RYIDALSATSDTQVLAEIGYKEELKREY-STVQIFGVAFSIMGLLPSIASTMD-GGLAAG 105
            Y+     T + + +    YK+EL +   S   + G+ F +M  +  + ++M  G L  G
Sbjct: 34  HYVQEDEVTDEPEEVEHFNYKQELDKSLLSRNSVIGLGFGLMSPVLGMCTSMGIGMLNGG 93

Query: 106 AVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDT 165
            + +  G+F++G LI    ++LGE+ S  P    ++V     AP + +   S+  G+L  
Sbjct: 94  PLSIMLGFFISGILIWFSSLSLGEIVSKFPME--LHVGSAMIAPPRLKLICSWFTGWLML 151

Query: 166 LSLCASVCSIVYGLAQQILSAVVVGNPDF-EVTDPITYGVFCACIVAITVLTSMNSKITA 224
           +       SI +  AQ  +S +++ N +    T  I + V    +V +T++  +N K  A
Sbjct: 152 IGNWTMSTSITFAGAQLTISLILMANNELISETHLILFTVIVFYMV-VTLVGLVNLKF-A 209

Query: 225 RLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASY-IFGDVQNLTDWNTGWSWCING 283
           R                            K  F    Y +F    +++ +++ +   + G
Sbjct: 210 RFIEIINKVCVYWIIYAIIFIDILLLIFHKGKFRSLKYALFHFDNSMSGYSSAFLSFLIG 269

Query: 284 LTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNA 343
              + +T+  +     +A+E K   + +P G+  ++      G +  + I+  + PD+  
Sbjct: 270 FQQSNFTLQGFSMLPALADEVKKPEKDIPRGMSTAVLLSTFSGLIFLLPIMLIL-PDIET 328

Query: 344 IVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQ-FLMGASTVLANSRQFWAFARDDGIP 402
           I ++     I  +F  +        FL L+I+   F  G  ++  +SR  ++F+RD  IP
Sbjct: 329 IFSNHKVLPIVTIFTKSTHSMVVSVFLVLLILGNLFFSGIGSITTSSRAVYSFSRDHAIP 388

Query: 403 FSKF--FKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFP 460
                 F   D +S VP  SI  S   S  LG L L    A +A    ++  +  A   P
Sbjct: 389 RYDLWTFVPPDSQSRVPKYSILLSMGISYFLGLLALISTAAFNAFIGAAVLCLCSATFIP 448

Query: 461 IALRLTYGRKDFRPGPFYLGHFWSTANGWL----AVFFQLFAVLMVMFPYDKSGITKETM 516
           + L L  GR+  +  P  + + +    GW     +V + L  ++ V FP  +  +T + M
Sbjct: 449 LVLVLCTGRRSIKHAPVKIRYKF----GWFINIASVLWLLLVMVSVCFP-TQLPVTVKGM 503

Query: 517 NYTVVIGPGFWVLSL----IYYFVWQRKFYEGPKSN 548
           NY +V+    +VL L    I YF W +  +  P S+
Sbjct: 504 NYAIVV----YVLCLIGITILYFKWGKYNFRLPLSD 535

>SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 568

 Score =  101 bits (251), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 112/504 (22%), Positives = 208/504 (41%), Gaps = 22/504 (4%)

Query: 60  QVLAEIGYKEELKREY-STVQIFGVAFSIMGLLPSIASTMDGGLA-AGAVGLNWGWFVAG 117
           +V+ +  Y+++L +   S   + G+ F +M  +  +++TM  GL   G + +  G+ V G
Sbjct: 41  EVVEQFQYEQKLDKSLLSRGSVIGLGFGLMSPVLGMSTTMSIGLLNGGPLTIVAGFMVVG 100

Query: 118 GLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVY 177
                  ++LGE+ S  P    ++      A +K R   S+  G+L  L       SI +
Sbjct: 101 FATWLCSLSLGEIVSKFPIE--LHGGSAMLAAKKHRLVFSWYTGWLMLLGNWTMSTSITF 158

Query: 178 GLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXX 237
             AQ ++S + + N      D + +         +TV+  +N K    ++T +       
Sbjct: 159 AGAQLVISLISLANDSLVPKDSVIFYTVVVFYAIVTVVGVVNLKFARFIETINKVCVYWI 218

Query: 238 XXXXXXXXXXXXSRSDKVSFNKASYIFGDVQN-LTDWNTGWSWCINGLTPAIWTIGAYDS 296
                              +    Y      N L+ + +     + G   + +T+  +  
Sbjct: 219 IYAIIFTDILLLLFHTG-EYRSLKYALAHFDNSLSGYRSAALSFMIGFQQSNFTLQGFSM 277

Query: 297 CLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQV 356
              +A+E K+  R +P G+  S+    + G +  + I+  + PD +AI+N+     I  +
Sbjct: 278 LPALADEVKEPERDIPRGMSLSVVLSALSGLVFLLPIMLIL-PDTSAILNNDRVMPIVLI 336

Query: 357 FQDALGKRWTLTFLSLIIICQFLM-GASTVLANSRQFWAFARDDGIPFSKFFKKVD--ER 413
           F  +        FL L+I+   L  G  ++  +SR  ++ +RD  +P+ + +  V+   +
Sbjct: 337 FTQSTHSIVVSFFLVLMILGNLLFSGIGSITTSSRAVYSMSRDHALPYHELWTYVEPASQ 396

Query: 414 SHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFR 473
           S VP  SI  +   S  LG L L    A +A    ++  +  A   P+ L L   R+  R
Sbjct: 397 SRVPKYSILLTMAISYVLGLLALVSTAAFNAFVGAAVLCLCSATCIPVVLVLASRRRALR 456

Query: 474 PGPFYLGHFWSTANGWL----AVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVL 529
             P  + +      GWL    +V + +F + ++  P  +  +T  TMNY   +   F V 
Sbjct: 457 GSPIKVRY----KLGWLVNLASVAWLVFTMFVISMP-PQVPVTLVTMNYAAFVFAAFMVG 511

Query: 530 SLIYYFVWQRKFYEGPKSNLTDEE 553
               YF W R  +  P   L DE 
Sbjct: 512 ITALYFCWGRHHFRAP---LVDEN 532

>Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {ON}
           YKL174C - Hypothetical ORF [contig 110] PARTIAL
          Length = 549

 Score =  100 bits (249), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 109/517 (21%), Positives = 225/517 (43%), Gaps = 32/517 (6%)

Query: 67  YKEELKREY-STVQIFGVAFSIMGLLPSIASTMDGGLA-AGAVGLNWGWFVAGGLILSVG 124
           Y+++L R + S   I G+ F++M  +  +++TM+ GL   G + +  G+ + G       
Sbjct: 45  YEQQLDRSFLSKGSIIGLGFALMSPVLGMSTTMNIGLLNGGPMTILLGFLINGLATWLCS 104

Query: 125 IALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQIL 184
           ++LGE+ S  P    ++      AP  ++   S+  G+L  L       SI +  AQ ++
Sbjct: 105 LSLGEIVSRFPIE--LHGGSAMLAPYNYQLSCSWFTGWLMLLGNWTMSTSITFAGAQLVI 162

Query: 185 SAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXX 244
           S V + N        I      A  + +T++  +N +  + ++  +              
Sbjct: 163 SLVTMANDQLIGEKYIVLFTVLAFYIIVTIVGLINLRFASFIEAVNKVCVYWIIYAVIFI 222

Query: 245 XXXXXSRSDKVSFNKASY------IFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCL 298
                     + F+  SY      +F    + + +++     + G   + +T+  +    
Sbjct: 223 DILL------LLFHSGSYRSLKYALFHFDNSFSGYSSKALSFMIGFQQSSFTLQGFSMLP 276

Query: 299 HMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQ 358
            +A+E K   R +P G+  ++ +  + G +  + I+  + PD   I+++P    I  +F 
Sbjct: 277 ALADEVKRPERDIPKGMFTAVLTSTLTGIVFLLPIMIIL-PDTKTIIDNPKLMPIVLIFT 335

Query: 359 DALGKRWTLTFLSLIIICQ-FLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERS--H 415
            +    +   FL ++I+   F  G  ++  +SR  ++ +RD  +P+S+F+  VD  S   
Sbjct: 336 QSTHSMFVSLFLVIMILGNLFFSGIGSITTSSRAVYSMSRDMALPYSEFWSYVDPTSDHR 395

Query: 416 VPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPG 475
           VP  SI  S   S  LG L L    A +A    ++  +  A   P+ L +   R+  R  
Sbjct: 396 VPKNSILLSMGISYLLGLLALVSTAAFNAFMGAAVMCLCSATCIPLVLVMMSRRRALRGA 455

Query: 476 PFYLGHFWSTANGWL----AVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSL 531
           P  + +      GWL    ++ + LF ++++ +P  K  +T  +MNY  ++   F     
Sbjct: 456 PVKVRY----RMGWLVNIISILWLLFTMVVICWP-PKLPVTLGSMNYAFLVYLLFLTGIT 510

Query: 532 IYYFVWQRKFYEGP---KSNLTDEEFVEAVGEDAIDA 565
           + YF W +  ++ P   + N ++E  + +V  + ++ 
Sbjct: 511 VLYFRWGKYNFKTPLIGEENKSNESTLTSVVLENVEV 547

>KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 549

 Score = 98.6 bits (244), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 113/502 (22%), Positives = 217/502 (43%), Gaps = 21/502 (4%)

Query: 55  ATSDTQVLAEIGYKEELKREY-STVQIFGVAFSIMGLLPSIASTMDGGLA-AGAVGLNWG 112
           A  + + +    Y+++L R + S   + G+ F +M  +  +++TM  GL   G + +  G
Sbjct: 33  ADEEEEEVQRFKYEQQLDRSFLSKSSVIGLGFGLMSPVLGMSTTMSIGLLNGGPLTIVIG 92

Query: 113 WFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASV 172
           + + G       ++LGE+ S  P    ++      A +K++   S+  G+L  L      
Sbjct: 93  FLINGIATWLCSLSLGEIVSRFPIE--LHGGSAMLARQKFKLACSWFTGWLMLLGNWTMS 150

Query: 173 CSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXX 232
            SI +  AQ ++S V + N      + I      A  + +T++  +N K    ++T +  
Sbjct: 151 TSITFAGAQLLVSLVTMTNDKLIGENYIVVTTVLAFYLIVTIVGLINLKFAGFIETVNKV 210

Query: 233 XXX-XXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQN-LTDWNTGWSWCINGLTPAIWT 290
                               S K  +    Y      N  + +++     I G   + +T
Sbjct: 211 CVYWIVYAVIFIDILLLLFHSGK--YRSLKYALAHFDNSFSGYSSAALSFIIGFQQSSFT 268

Query: 291 IGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYG 350
           +  +     +A+E K++ R +P G+  ++ +  + G +  + I+  + PD   I+N+P  
Sbjct: 269 LQGFSMLPALADEVKESERDIPKGMSTAVLTSTVTGVVFLLPIMLIL-PDTQTIINNPKV 327

Query: 351 QGITQVFQDALGKRWTLTFLSLIIICQFLM-GASTVLANSRQFWAFARDDGIPFSKFFKK 409
             I  +F  +    +   FL ++I+   L  G  +V  +SR  ++ +RD  +P+S+F+  
Sbjct: 328 MPIALIFTQSTHSIFVSLFLVIMILGNLLFSGIGSVTTSSRAVYSMSRDMALPYSEFWSY 387

Query: 410 VDERS--HVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTY 467
           VD  S   VP  SI  S   S  LG L L    A +A    ++  +  A   P+ L L  
Sbjct: 388 VDPSSKHRVPKNSILLSMGISYLLGLLALLSTAAFNAFMGAAVLCLCSATCIPLVLVLIS 447

Query: 468 GRKDFRPGP----FYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIG 523
            R+  R  P    + LG F + A    ++ + +F ++++  P  +  +T  +MNY  V+ 
Sbjct: 448 RRRALRGSPIKVRYRLGWFVNIA----SILWLVFTMVVICIP-PQVPVTFSSMNYAFVVY 502

Query: 524 PGFWVLSLIYYFVWQRKFYEGP 545
             F     + YF W R  ++ P
Sbjct: 503 LLFLAAITVLYFRWGRYNFKTP 524

>ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} similar
           to uniprot|P36029 Saccharomyces cerevisiae YKL174C TPO5
           Protein involved in excretion of putrescine and
           spermidine putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 591

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 107/504 (21%), Positives = 216/504 (42%), Gaps = 21/504 (4%)

Query: 54  SATSDTQVLAEIGYKEELKREY-STVQIFGVAFSIMGLLPSIASTMD-GGLAAGAVGLNW 111
            A ++ ++     Y++EL +   S   + G+ F +M  +  + ++M  G L  G   + +
Sbjct: 34  EADNEPEIAEHFEYEQELDKSLLSRTSVIGLGFGLMSPVLGMCTSMGIGLLNGGPFTIMF 93

Query: 112 GWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCAS 171
           G+ V G        +LGE+ S  P    ++ A    AP+  ++  S+  G+   L     
Sbjct: 94  GFQVCGVFSFLCACSLGEVVSKFPME--LHGASAILAPDYIKRISSWLTGWFLLLGNWFM 151

Query: 172 VCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSX 231
              + +  AQ I+S + + N D      +           +T++  +N K    ++T + 
Sbjct: 152 SIGVTFAGAQLIISLIAMANFDLISEKYLVLYTVLIYYAVVTIVGVVNLKYAKYVETINK 211

Query: 232 XXX--XXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIW 289
                                R+   S   A + F +   L+ + +     I G   + +
Sbjct: 212 VCIYWIIYAVLFIDVLLLLFHRNKFRSLPYALFHFDN--ELSGYRSVIISFIIGFQQSNF 269

Query: 290 TIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPY 349
           T+  +     +A+E K   + +P G+ +++    ++G +    I+  + PD   + ++  
Sbjct: 270 TLQGFSMLPALADEVKVPEKDIPRGMSSAVLISTVIGIIFLFPIMVIL-PDSRDLFSNQK 328

Query: 350 GQGITQVFQDALGKRWTLTFLSLIIICQ-FLMGASTVLANSRQFWAFARDDGIPFSKFFK 408
              I  +F+ +   ++   FL L+I+   F  G  ++  +SR  ++F+RD  IP+ + + 
Sbjct: 329 VLPIVNIFKKSTDSQFVSIFLVLLILGNLFFSGIGSITTSSRAVYSFSRDHAIPYYRLWT 388

Query: 409 KVDER--SHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLT 466
            VD +  S VP  SI  S   S  LG L L  + A +A    ++  +  A + P+ L L 
Sbjct: 389 YVDPQSESRVPKYSILLSMSISYILGLLPLFSNAAFNAFIGCAVLCLCSATLIPLLLVLV 448

Query: 467 YGRKDFRPGPFYLGHFWSTANGWLA----VFFQLFAVLMVMFPYDKSGITKETMNYTVVI 522
             R+  +  P  + +      GW+A    V + L ++  V  P  +  +T +TMNY +++
Sbjct: 449 TRRRVLKNAPVKIKY----KLGWIANIGSVCWLLLSMFSVCLP-PQIPVTAKTMNYALLV 503

Query: 523 GPGFWVLSLIYYFVWQRKFYEGPK 546
               + +  I Y+ W RK ++ P+
Sbjct: 504 FLFCFFIICILYYKWGRKHFQLPQ 527

>NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON}
           Anc_1.173
          Length = 612

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 117/540 (21%), Positives = 230/540 (42%), Gaps = 27/540 (5%)

Query: 50  IDALSATSDTQVLAEIGYKEELKREY-STVQIFGVAFSIMGLLPSIASTMDGGLA-AGAV 107
           I   S T + + +    Y +EL +   S   + G+ F +M  +  ++++M  GL   G  
Sbjct: 31  IHEESDTDEVESVEHFKYNQELDKSLLSRSSVVGLGFGLMSPVLGMSTSMAIGLINGGPA 90

Query: 108 GLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLS 167
            + WG+ ++G  I    ++LGE+ S  P    ++V+    AP+  +   S+  G+L  L 
Sbjct: 91  TILWGFIISGICIWFCSLSLGEVVSKFPM--ELHVSSAMLAPKDAKLICSWYTGWLMLLG 148

Query: 168 LCASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQ 227
                 SI +  AQ  +S +++   D      +         + +T++  +N K    ++
Sbjct: 149 NWTMSTSITFAGAQLTISLILMAKSDLIAEKYMIGFTVIIFYLVVTLVGLINLKFARFIE 208

Query: 228 TFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASY------IFGDVQNLTDWNTGWSWCI 281
           T +                        + F++  Y      +F    +L+ ++  +   I
Sbjct: 209 TINKVCVVWIIYAICVIDILL------LIFHQGKYRSLKFALFNFDNSLSGYSNFFVSFI 262

Query: 282 NGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDV 341
            G   + +T+  +     +A+E K   + +P G+  ++      G +  I I+  + PD 
Sbjct: 263 IGFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSNAVLLSTFSGIIFLIPIMIIL-PDS 321

Query: 342 NAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQ-FLMGASTVLANSRQFWAFARDDG 400
           + + ++     I  +F  +   +    FL L I+   F  G  ++  +SR  ++F+RD  
Sbjct: 322 DKLFSNNQMLPIVNIFTQSTHSKIVSLFLVLSILGNLFFSGIGSITTSSRAVYSFSRDHA 381

Query: 401 IPFSKF--FKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALV 458
           IP  +   F K + +S VP  SI  S   S  LG L L    A +A    ++  +  A  
Sbjct: 382 IPHHELWTFVKPESQSKVPKNSILLSMAISYFLGILALFSTAAFNAFIGAAVLCLCSATC 441

Query: 459 FPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNY 518
            P+ L L   R+  R  P  + +    A   +++ + + +++ V FP  K  +T  TMNY
Sbjct: 442 IPLVLVLFRRRRIIRSAPVKIRYKLGWAVNIISIVWLILSMISVCFP-PKIPVTWGTMNY 500

Query: 519 TVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVG-EDAIDAMLSNYSQAHQDK 577
            +++   F +   I Y  W +  ++ P   L DE+ +  +G  D I   +  Y++  Q++
Sbjct: 501 ALIVYVIFLIAITIMYLKWGKYNFKLP---LIDEDKMVPIGAHDKIP--MKKYTKVEQEE 555

>TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.173
           YKL174C
          Length = 647

 Score = 96.7 bits (239), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 118/517 (22%), Positives = 222/517 (42%), Gaps = 24/517 (4%)

Query: 67  YKEELKREY-STVQIFGVAFSIMGLLPSIASTMDGGLA-AGAVGLNWGWFVAGGLILSVG 124
           Y+++L +   S   I G+ F +M  +  + ++M  GL   G + +  G+ V+G       
Sbjct: 54  YEQQLDKSLLSKSSIVGLGFGLMSPVLGMCTSMSIGLKDGGPLTILIGFMVSGIFTWFCS 113

Query: 125 IALGELSSSIPTA---GAVYVACY---QWAPEKWRKCISYSVGFLDTLSLCASVCSIVYG 178
           ++LGE+ S  P      +  ++ Y        K R   S+  G+L  +       SI + 
Sbjct: 114 LSLGEVVSKYPNELHISSAMLSSYLTDNTLDSKLRYIASWYTGWLMLIGNWTMSTSITFA 173

Query: 179 LAQQILSAVVVGNPDF-EVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXX-X 236
            AQ  +S +++   D    T  I + V    +V +T++  +N K +  ++T +       
Sbjct: 174 GAQLTISLLLLMKSDLISETHLILFTVIVFYLV-VTIVGFINLKFSRFIETINKICVIWI 232

Query: 237 XXXXXXXXXXXXXSRSDKVSFNKASY-IFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYD 295
                         ++ K  F    Y +F    +L+ + + +   I G   + +T+  + 
Sbjct: 233 FYAIIFIDVLLLVFQAGK--FRSLKYALFHFDNSLSGYTSAFLSFIIGFQQSNFTLQGFS 290

Query: 296 SCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQ--GI 353
               +A+E K   R +P G+  ++      G +  + I+  + PD++ I N+       I
Sbjct: 291 MLPALADEVKRPERDIPRGMSTAVLLSTFSGVVFLLPIMLIL-PDLDNIFNNKNSNLLPI 349

Query: 354 TQVFQDALGKRWTLTFLSLIIICQFLM-GASTVLANSRQFWAFARDDGIPFSKF--FKKV 410
             +F  +   ++   FL   I+   L  G  ++  +SR  ++F+RD  +P+ +   F   
Sbjct: 350 VSIFTQSTHSKFVSVFLVFCILGNLLFSGIGSITTSSRAVYSFSRDHALPYHELWTFVDS 409

Query: 411 DERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRK 470
           D  S VP  SIW S   S  LG L L    A +A    ++  +  A V P+ L L  GR+
Sbjct: 410 DSVSKVPKYSIWLSMGVSYTLGLLALFSTAAFNAFVGAAVLCLCTATVIPLILVLISGRR 469

Query: 471 DFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLS 530
             R  P  + +        L+V + L A++ V FP  +  +T  TMNY +++     ++ 
Sbjct: 470 SIRNAPVKMKYKLGWIVNILSVAWLLLAMVSVCFP-PQIPVTFSTMNYALMVYIFCLIII 528

Query: 531 LIYYFVWQRKFYEGP---KSNLTDEEFVEAVGEDAID 564
            + YF W +  +  P   K++LT      A+ +  +D
Sbjct: 529 TVLYFQWGKNNFVLPHPMKTSLTSNPSTYAMSKSLVD 565

>TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {ON}
           Anc_1.173 YKL174C
          Length = 593

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 117/530 (22%), Positives = 225/530 (42%), Gaps = 32/530 (6%)

Query: 42  AHGAPIRYIDAL------SATSDTQVLAEIGYKEELKREY-STVQIFGVAFSIMGLLPSI 94
           AH AP   +D L      ++T   +V+    Y+++L +   S   + G+ F +M  +  +
Sbjct: 17  AHLAPNEILDNLHTIIHENSTDVPEVVEHFEYEQQLDKSLLSRSSVVGLGFGLMSPVLGM 76

Query: 95  ASTMDGGLA-AGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWR 153
            ++M  GL   G   + +G+ + G        +LGE+ S  P    ++ A    AP+  +
Sbjct: 77  CTSMGIGLVNGGPFTIMFGFPICGFFSFLCASSLGEVVSKYPIE--LHGASAMIAPKSIK 134

Query: 154 KCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAIT 213
              S+  G+L  L        + +  AQ I+S V +G+ D      +           +T
Sbjct: 135 PMCSWFTGWLMLLGNWFMSIGVTFAGAQLIISLVNIGDRDVIADGRLGIYTVLVYYGVVT 194

Query: 214 VLTSMNSKITARLQTFSXXXX--XXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLT 271
           V+  +N K    ++  +                      R    S   A + F +   L+
Sbjct: 195 VVGVVNLKYARYVEAINKVCIYWIIYAVLFIDVLLLLFHRQKFRSLPYALFHFDN--TLS 252

Query: 272 DWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICI 331
            +++ +   I G   + +T+  +     +A+E +   + +P G+ +++    ++G +  +
Sbjct: 253 GYSSAFLSFIIGFQQSNFTLQGFSMLPALADEVQVPEKDIPRGMSSAVLISTLIGMIFLL 312

Query: 332 VILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQ-FLMGASTVLANSR 390
            I+  + PDV+ +  +     I  VF  +   ++   FL L+I+   F  G  ++  +SR
Sbjct: 313 PIMLIL-PDVDGLFENTKVLPIVDVFTHSTNSKFVSVFLILLILGNLFFSGIGSITTSSR 371

Query: 391 QFWAFARDDGIPFSKFFKKVD--ERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSL 448
             ++F+RD  IP  + +  VD    S VP  SI  S   S  LG L L    A +A    
Sbjct: 372 AVYSFSRDCAIPNHQLWTYVDPTSESKVPKYSILLSMGVSYILGLLPLFSTAAFNAFIGC 431

Query: 449 SIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLA-----VFFQLFAVLMVM 503
           ++  +  A + P+ L L   R+  R  P  + +      GW+A     ++  L  V + M
Sbjct: 432 AVLCLCSATLIPLVLVLLTRRRILRDAPVKIKY----KLGWIANVGSVIWLPLSMVSVCM 487

Query: 504 FPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEE 553
            P  +  +T +TMNY +V+    +   ++ YF W +  ++ P   L D++
Sbjct: 488 PP--QIPVTPKTMNYALVVFIACFAGIIVLYFKWGKYNFKLP---LVDKQ 532

>KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {ON}
           Anc_1.173 YKL174C
          Length = 607

 Score = 89.7 bits (221), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 115/534 (21%), Positives = 218/534 (40%), Gaps = 28/534 (5%)

Query: 51  DALSATSDTQVLAEIGYKEELKREY-STVQIFGVAFSIMGLLPSIASTMDGGLA-AGAVG 108
           D  S  SDT  +    Y++EL +   S   + G+ F +M  +  + ++M  GL   G + 
Sbjct: 33  DEDSVNSDT--VEHFKYEQELDKSLLSRSSVIGLGFGLMSPVLGMCTSMSIGLINGGPLT 90

Query: 109 LNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSL 168
           +  G+ ++G  I    ++LGE+ S  P    ++VA    AP+K++   S+  G+L  +  
Sbjct: 91  IMLGFILSGISIWFCSLSLGEIISKFPME--MHVASAMLAPKKFKLLCSWYTGWLMLIGN 148

Query: 169 CASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQT 228
                SI +  AQ  +S  ++ +      +   +       + +TV+  +N K  AR   
Sbjct: 149 WTMSTSITFAGAQLTISLFLMKDQYLISEEHFIFYTVIVFYLVVTVVGLINLKF-ARFIE 207

Query: 229 FSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWC----INGL 284
                                    K ++    Y      N     +G+S      I G 
Sbjct: 208 IINKVCVYWIIYAIIFIDILLLIFHKGTYRSLKYALFHFDN---SRSGYSNVLISFIIGF 264

Query: 285 TPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAI 344
             + +T+  +     +A+E K   R +P G+  S+      G +  + I+  + PD++ I
Sbjct: 265 QQSNFTLQGFSMLPALADEVKKPERDIPRGMSISVLISTFSGIIFLLPIMIIL-PDLSTI 323

Query: 345 VNSPYGQGITQVFQDALGKRWTLTFLSLIIICQ-FLMGASTVLANSRQFWAFARDDGIPF 403
                   I  +F  +        FL L+I+   F  G  ++ A+SR  ++F+RD  IP+
Sbjct: 324 FTDHKVLPIVNIFIQSTDSMIVSFFLVLLILGNLFFSGIGSITASSRTVYSFSRDQAIPY 383

Query: 404 SK--FFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPI 461
                F K +  S VP  S+  S   S  LG L L    A +A    ++  +  A   P+
Sbjct: 384 YDHWIFVKPESESKVPKNSVLLSMAISYVLGILALFSTAAFNAFIGAAVLCLCSATCIPL 443

Query: 462 ALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVV 521
            L L   R+  +  P  + +        +++ + L ++  V  P  +  +T +TMNY ++
Sbjct: 444 ILILFGRRRILKNAPIKIRYKLGWGINIISILWLLLSMFSVCLPV-QIPVTFQTMNYALM 502

Query: 522 IGPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVGEDAIDAMLSNYSQAHQ 575
           +     +     Y  W ++ ++ P   L + ++      D +D+     S ++Q
Sbjct: 503 VYVFCLICVTFLYVKWGKRNFKLP---LAEHQY------DLLDSTTDATSDSYQ 547

>KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {ON}
           similar to uniprot|P36029 Saccharomyces cerevisiae
           YKL174C TPO5 Protein involved in excretion of putrescine
           and spermidine putative polyamine transporter in the
           Golgi or post-Golgi vesicles
          Length = 560

 Score = 89.0 bits (219), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 108/491 (21%), Positives = 210/491 (42%), Gaps = 13/491 (2%)

Query: 62  LAEIGYKEEL-KREYSTVQIFGVAFSIMGLLPSIASTMDGGLA-AGAVGLNWGWFVAGGL 119
           + E  Y ++L K   S   + G+ F +M  +  +++TM  GL   G+  + +G+ + G +
Sbjct: 72  VKEFTYVQQLDKNLLSRTSVIGLGFGLMSPVLGMSTTMSIGLLNGGSPSIIFGYLICGIM 131

Query: 120 ILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGL 179
                ++L E+ S  P    ++ A    AP + R  +S+  G+L          SI +  
Sbjct: 132 TWISSLSLSEIVSKYPIE--LHGAAAMLAPGRLRLRMSWYCGWLMLFGSWTMSTSITFAG 189

Query: 180 AQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXX-XXX 238
           AQ I+S + + N     +  +T        + +TV+  +N K ++ ++T +         
Sbjct: 190 AQLIISLLTMTNESLIDSRWLTLWTVLMFYLIVTVVGVINLKFSSFIETINKVCVYWILY 249

Query: 239 XXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNT-GWSWCINGLTPAIWTIGAYDSC 297
                       + +  SF      F +  +L+ +++   S+ I G   + +T   +   
Sbjct: 250 AILFTSTLLLLFQPNHRSFKDVFTKFDN--SLSGYSSMALSFLIGGFQQSNFTFQGFAML 307

Query: 298 LHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVF 357
             +++E +   + +P  +  S+    + G    I ++  + PDV+ ++N      I  +F
Sbjct: 308 SALSDETEKPEKDIPYSMTRSVIISLVSGLFFLIPMMLIL-PDVSEVMNHEGVMPIVLIF 366

Query: 358 QDALGKRWTLTFLSLIIICQFLM-GASTVLANSRQFWAFARDDGIPFSKFFKKVD--ERS 414
             +    +   FL L+I+   L  G  +V  +SR  ++ +RD GIP+   +  VD    S
Sbjct: 367 TKSTKSLFVSIFLVLLILGNLLFSGIGSVTTSSRALYSLSRDRGIPYHHLWTYVDPASES 426

Query: 415 HVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRP 474
            VP  S+  S   S  L  L L    A +A    ++  +  A + PI L L + RK  + 
Sbjct: 427 KVPKYSVMLSMGVSYVLALLALISTAAFNAFVGCAVLCLCSASMLPILLSLYHRRKLVKG 486

Query: 475 GPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYY 534
             F + +        L V + LF ++++  P  K  +T  +MNY+ V+   F ++  + Y
Sbjct: 487 SAFRIKYRLGYITNCLTVIWLLFTMVIISLP-QKVPVTFRSMNYSSVVYFLFMIMVTVLY 545

Query: 535 FVWQRKFYEGP 545
             W    +  P
Sbjct: 546 DRWGIYNFRAP 556

>ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar to
           uniprot|Q0CZS0 Aspergillus terreus NIH2624 ATEG_00814
           Hypothetical protein
          Length = 535

 Score = 88.6 bits (218), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 105/463 (22%), Positives = 188/463 (40%), Gaps = 41/463 (8%)

Query: 122 SVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQ 181
           ++G ++ EL+SS+P +G VY        +KW     +  G+ D L+    + S    +A 
Sbjct: 89  AIGASIAELASSVPASGGVYHWAAMTPGKKWGPICGWFAGWFDFLAWNFGIASNANMVAS 148

Query: 182 QILSAVVVGNPDFEVTDPITYGVF------CACIVAIT--VLTSMNSKITARLQTFSXXX 233
            I+ +  + +PD E+     Y  F      C  +V      L ++N     R+ +F    
Sbjct: 149 MIVYSYGLFHPDTELQRWHVYICFLILTWLCCFVVMFADWALPTIN-----RIGSFLILG 203

Query: 234 XXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGA 293
                            +    +     +++   QN T +++     + G+    +++G 
Sbjct: 204 GWFVTVVVCAVMPSTTGKGHASN----DFVWSKWQNNTGYSSDGFAFLLGMLNGAFSVGT 259

Query: 294 YDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAI-------VN 346
            D   H+AEE  DA R +P  +   I    ++G++  I  +  M   +N +         
Sbjct: 260 PDCITHLAEEIPDAGRNLPKVLFWQI----LVGFITAITYMIAMFYAINNLPIIFSSNTF 315

Query: 347 SPYGQGITQVFQDALGKRWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKF 406
           SP G+   Q      G    L  + L IIC  +      +   R  +  ARD+  PFSK+
Sbjct: 316 SPLGEIYLQATNSRGGAIGLLLIIYLPIICAIV---GCYITAGRTLYVLARDNATPFSKY 372

Query: 407 FKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFS----LSIAGMYMALVFPIA 462
              +  R   P  + +        LGA+ +   TA +A       L+ A  ++A++    
Sbjct: 373 LGAIHPRYKSPFWATFACGVLCTCLGAIYVGSATAFNAFVGSFVLLTTAAFFLAML---- 428

Query: 463 LRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVI 522
             L   R     G F +G F    N    ++  +F V+   FPY     T E MNYT V+
Sbjct: 429 PNLLTKRSKLPLGSFNMGKFGYAVNIISCLYILVFFVIYC-FPYSLPA-TAENMNYTSVM 486

Query: 523 GPGFWVLSLIYYFVWQRKFYEGPKSNLTDEEFVEAVGEDAIDA 565
             G  ++  I++ V  RK Y+GP  ++ +++    + +D + A
Sbjct: 487 VSGLTLMVAIWWMVHGRKNYKGPTFDMVEKDNCSVLTDDYLVA 529

>Kpol_2002.70 s2002 complement(159457..161325) [1869 bp, 622 aa]
           {ON} complement(159457..161325) [1869 nt, 623 aa]
          Length = 622

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 109/499 (21%), Positives = 211/499 (42%), Gaps = 25/499 (5%)

Query: 60  QVLAEIGYKEELKREYSTVQI-----FGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWF 114
           +V+ +  Y++EL +   ++       FG+   ++G+  S++  +  G   G + +  G+ 
Sbjct: 40  EVVEQFKYEQELDKSLLSLSSVVGLGFGLMSPVLGMCTSMSIGLKNG---GPLTIIMGFL 96

Query: 115 VAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCS 174
           ++G  I    ++LGE+ S  P    ++ +    AP+  +   S+  G+L  +       S
Sbjct: 97  LSGISIWFCSLSLGEVVSKFPME--LHGSSALLAPDSLKLICSWYTGWLMLIGNWTMSTS 154

Query: 175 IVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXX 234
           I Y  AQ  +S +++ N D      + +       + +T++  +N K +  ++  +    
Sbjct: 155 ITYAGAQLTISLILMNNSDLISEANLIFFTVIVFYMVVTIVGLVNLKFSRFIEIINKICV 214

Query: 235 X-XXXXXXXXXXXXXXSRSDKVSFNKASY-IFGDVQNLTDWNTGWSWCINGLTPAIWTIG 292
                             S K  F    Y +F    +L+ + +G    I G   + +T+ 
Sbjct: 215 LWIIYAIIFIDILLLIFHSGK--FRSLKYALFHFDNHLSGYGSGVLSFIIGFQQSNFTLQ 272

Query: 293 AYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQG 352
            +     ++EE K     +P G+    S+  +L  L  ++ L  +   +  I     G  
Sbjct: 273 GFSMLPALSEEVKRPENDIPRGM----SNAVLLSTLSGVIFLIPILIILPDIDTLFTGHK 328

Query: 353 I---TQVFQDALGKRWTLTFLSLIIICQ-FLMGASTVLANSRQFWAFARDDGIPFSKFFK 408
           I     +F  +        FL L+I+   F  G  ++  +SR  ++F+RD GIP+   + 
Sbjct: 329 ILPIVNIFTKSTNSTVVSIFLVLMILGNLFFSGIGSITTSSRSVYSFSRDRGIPYHNLWT 388

Query: 409 KVDERS--HVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLT 466
            VD  S   VP  SIW S   S  LG L L    A +A    ++  +  A V P+ L L 
Sbjct: 389 YVDPSSVSKVPKYSIWLSMAISYFLGLLALFSTAAFNAFIGAAVLCLCSATVIPLILVLF 448

Query: 467 YGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGF 526
             R+  R  P  + +        ++V + L +++ V FP  +  +T +TMNY +++    
Sbjct: 449 SRRRVIRNAPVKMKYKLGWIVNIISVLWLLLSMVSVCFP-PQIPVTFQTMNYALIVYIFC 507

Query: 527 WVLSLIYYFVWQRKFYEGP 545
            +   + YF W +  ++ P
Sbjct: 508 LISITVLYFKWGKYNFQLP 526

>KNAG0C00980 Chr3 complement(191133..193277) [2145 bp, 714 aa] {ON}
           Anc_1.173 YKL174C
          Length = 714

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 122/555 (21%), Positives = 232/555 (41%), Gaps = 54/555 (9%)

Query: 54  SATSDTQVLAEIGYKEELKREY-STVQIFGVAFSIMGLLPSIASTMDGGL-AAGAVGLNW 111
           S  ++ +++    Y++EL +   S   I G+ F +M  +  + ++M  GL   G   + W
Sbjct: 32  SDENEPEIVEHFKYEQELDKSLLSRSSIVGLGFGLMSPVLGMCTSMAIGLINGGPATIMW 91

Query: 112 GWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCAS 171
           G+ ++G  I    ++LGE+ S  P    ++V     AP   +   S+  G+L  +     
Sbjct: 92  GFLISGICIWFCSLSLGEIVSKFPME--IHVGSAMLAPASLKLISSWYTGWLMLIGNWTM 149

Query: 172 VCSIVYGLAQQILSAVVVGNPDFEVTDP--ITYGVFCACIVAITVLTSMNSKITARLQTF 229
             SI +  AQ  +S +++ N D  + DP  + Y V    +V +T++  +N K    ++T 
Sbjct: 150 STSITFAGAQLTISLILMNNNDL-IKDPHLVLYTVIVFYLV-VTIVGLINLKFARFIETI 207

Query: 230 SXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASY--IFGDVQNLTDWNTGW-----SWCIN 282
           +                        + F+K  Y  +   + +  +  +G+     S+ I 
Sbjct: 208 NKVCVYWILYAVIFIDILL------LIFHKGKYRSLKYALTHFDNSRSGYGNFVISFII- 260

Query: 283 GLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVN 342
           G   + +T+  +     +A+E +   + +P G+  ++      G +I ++ +  + PD++
Sbjct: 261 GFQQSNFTLQGFSMLPALADEVRVPEKDIPRGMSNAVLLSAFSG-IISLLPIMIILPDMD 319

Query: 343 AIVNSPYGQG----ITQVF-QDALGKRWTLTFLSLIIICQFLMGASTVLANSRQFWAFAR 397
             +   +  G    I  +F Q       +   + LI+   F  G  ++ A+SR  ++F+R
Sbjct: 320 TFI---FYDGRVLPIVNIFTQSTDSVILSTLLVLLILGNLFFSGIGSITASSRSVYSFSR 376

Query: 398 DDGIPFSKF--FKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYM 455
           D  IP      F K +  S VP  SI  S   S  LG L L    A +A    ++  +  
Sbjct: 377 DHAIPGYDLWTFVKPESESKVPKNSILLSMLISYILGLLALFSTAAFNAFIGAAVLCLCS 436

Query: 456 ALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPY---DKSGIT 512
           A   P+ L L   R+  +  P  + +      GW    F +  +L+ MF      +  +T
Sbjct: 437 ATCIPLVLVLFRRRRILKSAPVKIRY----KLGWGINIFSICWLLLSMFSVCLPTRIPVT 492

Query: 513 KETMNYTVVIGPGFWVLSLIYYFVWQRKFYEGPKSN--------------LTDEEFVEAV 558
            +TMNY +V+     +   + YF W +  +  PK++              L+DE  ++  
Sbjct: 493 FKTMNYALVVYVVCLISITVLYFFWGKSNFRLPKADGQVAKYEMGSDVGGLSDEGGIQGA 552

Query: 559 GEDAIDAMLSNYSQA 573
           G   I A +S    A
Sbjct: 553 GFHTIGATISPEEDA 567

>NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {ON}
           Anc_1.173 YKL174C
          Length = 641

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 114/504 (22%), Positives = 220/504 (43%), Gaps = 20/504 (3%)

Query: 59  TQVLAEIGYKEELKREY-STVQIFGVAFSIMGLLPSIASTMDGGLA-AGAVGLNWGWFVA 116
           T+V+    Y +EL +   S   I G+ FS+M     ++++M  GL   G   + WG+ ++
Sbjct: 40  TEVVEHFKYNQELDKSLLSRGSIVGLGFSLMSAPLGMSTSMAIGLINGGPATIIWGFLIS 99

Query: 117 GGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIV 176
           G  I    ++LGE+ S  P    ++V+    AP+K +   S+  G+L  L       SI 
Sbjct: 100 GICIWFCSLSLGEVVSKFPME--LHVSSAMLAPKKLKLICSWYTGWLMLLGNWTMSTSIT 157

Query: 177 YGLAQQILSAVVVGNPDFEVTDPITYGVFCACI--VAITVLTSMNSKITARLQTFSXXXX 234
           +  AQ  +S +++ N D  +++    G F   I  + +T++  +N K    ++T +    
Sbjct: 158 FAGAQLTISLILMTNSDL-ISEKYLIG-FTVIIFYLVVTIVGLINLKFARFIETINRACV 215

Query: 235 XXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGW--SWCINGLTPAIWTIG 292
                              +  ++   Y      N     +G+  S+ I G   + +T+ 
Sbjct: 216 IWIIYAILFIDILL-LIFHRGKYHSLKYSLFHFDNSLSGYSGFLISFLI-GFQQSNFTLQ 273

Query: 293 AYDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQG 352
            +     +A+E K   + +P G+  ++      G +  I I+  + P+ + +  +     
Sbjct: 274 GFSMLPALADEVKVPEKDIPRGMSNAVLLSAFSGIVFLIPIMIIL-PESDKLFTNHKILP 332

Query: 353 ITQVFQDALGKRWTLTFLSLIIICQ-FLMGASTVLANSRQFWAFARDDGIPFSK--FFKK 409
           I  +F  +    +   FL L+I+   F  G  ++  +SR  ++F+RD  IP  +   F +
Sbjct: 333 IVNIFTQSTHSMFVSFFLLLMILGNLFFSGIGSITTSSRAVYSFSRDHAIPHHETWTFVQ 392

Query: 410 VDERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGR 469
            + +S VP  SI  S   S  LG L L    A +A    ++  +  A   P+ L L   R
Sbjct: 393 PESQSKVPKNSILLSMAISYILGLLALFSTAAFNAFIGAAVLCLCSATCIPLVLVLFRRR 452

Query: 470 KDFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVL 529
           +  R  P  + +        +++ + L +++ V  P  K  +T E+MNY +++     ++
Sbjct: 453 RVLRNAPVKIRYKLGWFVNIVSILWLLLSMVSVCLP-PKIPVTLESMNYALIVYLLCIII 511

Query: 530 SLIYYFVWQRKFYEGPKSNLTDEE 553
             + YF W +  ++ P   L +EE
Sbjct: 512 ITLMYFKWGKDNFKLP---LIEEE 532

>Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar to
           Ashbya gossypii AEL125C
          Length = 583

 Score = 85.5 bits (210), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 113/501 (22%), Positives = 205/501 (40%), Gaps = 22/501 (4%)

Query: 58  DTQVLAEIGYKEELKREY-STVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVA 116
           DT ++    Y++ L +   S   + G+ F +M  +  +++++  GL  G      G F+ 
Sbjct: 38  DTVLVEHFQYEQRLDKSLLSKYSVIGLGFGLMSPVLGMSTSLSTGLVNGGPLTILGAFII 97

Query: 117 GGLIL-SVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSI 175
            G +     +++GE+ S  P      VA    AP+ +R   +Y  G+L  L  C    SI
Sbjct: 98  CGFMNWLTSLSIGEVVSKYPIELHGSVA--MLAPDNYRLVTAYFTGWLMLLGNCVMNASI 155

Query: 176 VYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXX 235
            Y  A+ I+S V +        D +         + IT+   +NS     L+  +     
Sbjct: 156 QYAGARLIISLVTISGDSLISEDNLIIWTVLVYFLCITITGIINSNFARYLEIINTVCIY 215

Query: 236 XXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQN-LTDWNTG-WSWCINGLTPAIWTIGA 293
                               SF    Y F    N L+ +++   S+ + G   + +T+  
Sbjct: 216 WILYAVAFIDILLLMFHYG-SFRPFLYAFFHFDNKLSGYSSAVLSFMVGGFQQSNFTLQG 274

Query: 294 YDSCLHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGI 353
           +     +++E ++  + +P G+  S+    I G +  I IL  + P+   I+N      I
Sbjct: 275 FSLLPALSDETREPEKDIPKGMSQSVLVSTICGIIYLIPILLVI-PEPEEIMNDSRVMEI 333

Query: 354 TQVFQDALGKRWTLTFLSLIIICQFLM-GASTVLANSRQFWAFARDDGIPFSKFFKKV-- 410
             +F  +   +    F  L+I+   L  G  ++  +SR  ++ +RD G+P+S  +  V  
Sbjct: 334 VLIFTKSTRSKIVSYFQVLLILGNLLFSGIGSITTSSRAVYSMSRDHGLPYSDLWSYVSP 393

Query: 411 DERSHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRK 470
           D +S VP  +++ S   S   G L      A ++    S+  +  A    I   +  GR+
Sbjct: 394 DSQSQVPRYAVYLSMGISYIFGLLPFISGNAYNSFIGASVLCLCSASSIAIICVMLTGRR 453

Query: 471 DFRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMF----PYDKSGITKETMNYTVVIGPGF 526
             +     + +      GW    F L  + +VMF    P     +T  TMNYT +I   F
Sbjct: 454 GIKGAGVKIRYRL----GWPVDVFVLLWLGLVMFCMCMPVTVP-VTINTMNYTFLIFLVF 508

Query: 527 WV-LSLIYYFVWQRKFYEGPK 546
            V +S +Y F W +  +  P+
Sbjct: 509 LVGISGLYNF-WGKYNFSIPE 528

>Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {ON}
           YKL174C (REAL)
          Length = 619

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 102/476 (21%), Positives = 209/476 (43%), Gaps = 14/476 (2%)

Query: 80  IFGVAFSIMGLLPSIASTMDGGLA-AGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAG 138
           I G+   +M  +  ++++M  GL   G + +  G+ ++G  I    ++LGE+ S  P   
Sbjct: 61  IVGLGLGLMSPVLGMSTSMAIGLINGGPLTIMLGFLISGVCIWFSSLSLGEIVSKFPME- 119

Query: 139 AVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTD 198
            ++V     APEK +   S+  G+L  +       SI +  AQ  +S +++ N +     
Sbjct: 120 -LHVGSAMLAPEKLKLACSWYTGWLMLIGNWTMSTSITFAGAQLTISLILMTNSNLISEA 178

Query: 199 PITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFN 258
            +T+       + +T++  +N K    ++T +                       K  F 
Sbjct: 179 HLTFYTVIVFYLVVTIVGLVNLKFARFIETIN-KVCVYWIIYAIIFIDILLLIFHKGKFR 237

Query: 259 KASY-IFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVA 317
              Y +F    +L+ + + +   I G   + +T+  +     +A+E K   R +P G+  
Sbjct: 238 SLKYALFHFDNSLSGYKSAFLSFIIGFQQSNFTLQGFSMLPALADEVKVPERDIPRGMSN 297

Query: 318 SISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQ 377
           ++      G +  I I+  + PD + +  +     I  +F  +      L+F  +++I  
Sbjct: 298 AVLLSAFSGVIFLIPIMLIL-PDNDLLFTNHKVLPIVNIFTKSTASV-VLSFFLVLLILG 355

Query: 378 FLM--GASTVLANSRQFWAFARDDGIP-FSKF-FKKVDERSHVPMRSIWGSSFFSIALGA 433
            L+  G  ++  +SR  ++F+RD  IP + K+ + + D +S VP  S+  S   S  LG 
Sbjct: 356 NLLFSGIGSITTSSRAVYSFSRDRAIPHYEKWTYVEPDSQSKVPKNSVILSMVISYFLGL 415

Query: 434 LCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVF 493
           L L    A +A    ++  +  A   P+ L L   R+  R  P  + + +      +++ 
Sbjct: 416 LALISTAAFNAFIGAAVLCLCSATFIPLVLVLFTRRRAIRSAPVKIRYKFGWFINIVSIA 475

Query: 494 FQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLI-YYFVWQRKFYEGPKSN 548
           + L +++ V  P  +  +T +TMNY +++   F +L++   YF W +  +  P ++
Sbjct: 476 WLLLSMVSVCLP-TQVPVTFKTMNYALMVYI-FCILAITGLYFKWGKYNFRLPLAD 529

>YNR056C Chr14 complement(731618..733303) [1686 bp, 561 aa] {ON}
           BIO5Putative transmembrane protein involved in the
           biotin biosynthesis pathway; responsible for uptake of
           7-keto 8-aminopelargonic acid; BIO5 is in a cluster of 3
           genes (BIO3, BIO4, and BIO5) that mediate biotin
           synthesis
          Length = 561

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 125/564 (22%), Positives = 225/564 (39%), Gaps = 89/564 (15%)

Query: 36  LRVVTSAHGAPIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIMGLLPSIA 95
           L +V   H   IR    +S++  ++V        +  + ++   + G+AFS+      I+
Sbjct: 18  LSIVPDRHRTEIR----MSSSERSEV--------KFDKHFNWWSLLGIAFSLSCSWVGIS 65

Query: 96  STMDGGLAAGA-VGLNWGWFVAGGLILSVGIALGELSSSIPTA--GAVYVA--------- 143
           ++M  G+A+G  + + +G  +A    L  GI+LG+ ++ +P +  G+ +V          
Sbjct: 66  ASMAVGIASGGPLLIIYGLIIAAFFSLMCGISLGDFAAILPNSSGGSFWVLKMLEQESVT 125

Query: 144 ---------------------CYQWAPE---KWRKCISYSVGFLDTLSLCASVCSIVYGL 179
                                C  +  E   K++K  S  VG L+      +  SI   L
Sbjct: 126 LKTPEYEDPSDDDEEVFLENYCQTFNVEVSSKFQKVSSMVVGLLNYFGAIFTTASICSSL 185

Query: 180 AQQILSAVVVGNPDFEVTDPITYGVFCA--CIVAITVLTSMNSKITARLQTFSXXXXXXX 237
           +   +    + +PD+E+     + VF    CI A+  L ++ S     +  F        
Sbjct: 186 SMSCIGIHKLLHPDYELKH---WHVFVGYECINAVLTLFNIYSTPLPYISQFGLYTSLLS 242

Query: 238 XXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSC 297
                       S +    + KAS IFG   N T WN+     + GL   IW     DS 
Sbjct: 243 FAMTFIICIVSRSDNTVDPWPKASNIFGSFDNQTGWNSSGMAFVVGLVNPIWAFVGIDSA 302

Query: 298 LHMAEEA--KDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQ 355
            HM +E     +R  VP  I+ +I   ++  ++ C+ +  C+  D  A+V S     I +
Sbjct: 303 THMIDEVGYSKSRFLVPKVIITTIIVGFVTSFIYCVGLFFCIT-DQTAVVESIL--PIVE 359

Query: 356 VFQDALGKRWTLTFLSLIIICQ-FLMGASTVLANSRQFWAFARDDGIPF-------SKFF 407
           +F  A G R    FL  + I   F+ G ++    SR   +F +    PF       +K  
Sbjct: 360 IFYQATGNRNLSVFLQCMCITTGFVSGIASGTWQSRILQSFGKSYA-PFYKEGSLGNKSL 418

Query: 408 KKVDERS---HVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALR 464
           KK+   +     P+ + + S      +G + +   TA +A+ +  I  + M+   P  + 
Sbjct: 419 KKLAVLTPGFKSPLYAHFLSQICVTIIGCIFMGSSTAFNAIITACITLLLMSYAVPSFIF 478

Query: 465 LTYGRKD-------------FRPGPFYLGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGI 511
           L   +K+              RP    +    S     + + + LF ++ + FPY    +
Sbjct: 479 LFVIKKEKFIHRIESDVNCVSRPNRRRM----SMIPHIICILWTLFCLVFLSFPYTLP-V 533

Query: 512 TKETMNYT-VVIGPGFWVLSLIYY 534
           T   MNYT VV    F ++S++ +
Sbjct: 534 TAGNMNYTSVVYAVVFCIISIVVF 557

>Smik_14.390 Chr14 complement(688421..690085) [1665 bp, 554 aa] {ON}
           YNR056C (REAL)
          Length = 554

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 115/533 (21%), Positives = 211/533 (39%), Gaps = 77/533 (14%)

Query: 68  KEELK--REYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGA-VGLNWGWFVAGGLILSVG 124
           + E+K  + ++   + G+AFS+      I+++M  G+A+G  + + +G  +A    L  G
Sbjct: 29  RSEVKFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFSLMCG 88

Query: 125 IALGELSSSIPTA------------------------------GAVYVACYQWAPE---- 150
           I+LG+ ++ +P +                              G V++  Y         
Sbjct: 89  ISLGDFAAILPNSSGGSFWVLKMLEQESVALKTPEYEDTSDDDGEVFLENYCQTANVEVC 148

Query: 151 -KWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCA-- 207
            K++K  S  VG L+      +  SI   L+   +    + +PD+E+     + VF    
Sbjct: 149 SKFQKVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHPDYELKH---WHVFVGYQ 205

Query: 208 CIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDV 267
           CI AI    ++ S     +  F                    S +    + KAS IFG  
Sbjct: 206 CINAILTFFNIYSSPLPYISQFGLYTSLLSFAMTFIICIVSRSNNTVEKWPKASNIFGSF 265

Query: 268 QNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEA--KDARRAVPIGIVASISSCWIL 325
            N T WN+     + GL   +W     DS  HM +E     +R  VP  I+ +I   ++ 
Sbjct: 266 DNQTGWNSSGMAFVVGLVNPLWAFVGIDSATHMIDEVGYSRSRFLVPKVIITTIIVGFVT 325

Query: 326 GWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQ-FLMGAST 384
            ++ C+ +  C+  D  A+V S     I ++F  A G R    FL  + I   F+ G ++
Sbjct: 326 SFIYCVGLFFCIT-DKTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGFISGIAS 382

Query: 385 VLANSRQFWAFAR------DDGIPFSKFFKKVD---ERSHVPMRSIWGSSFFSIALGALC 435
               SR   +F +      ++G   +K  K++     +   P+ + + S      +G + 
Sbjct: 383 GTWQSRILQSFGKSYAPFYNEGSLGNKSLKRLSILTPKFKSPLYAHFLSQICVTIIGCIF 442

Query: 436 LAGDTAADALFSLSIAGMYMALVFP-IALRLTYGRKDF------------RPGPFYLGHF 482
           +   TA +A+ +  I  + M+   P         ++ F            RP    +   
Sbjct: 443 MGSSTAFNAIITACITLLLMSYAVPSFIFVFVVNKEKFIYRIENDVNGISRPNRRRM--- 499

Query: 483 WSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYT-VVIGPGFWVLSLIYY 534
            S     + + + LF ++ + FPY    +T   MNYT VV    F ++S++ +
Sbjct: 500 -SMVPHIICILWTLFCLVFLSFPYTLP-VTAGNMNYTSVVYAVVFCIISIVVF 550

>YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON}
           TPO5Protein involved in excretion of putrescine and
           spermidine; putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 618

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 102/476 (21%), Positives = 204/476 (42%), Gaps = 14/476 (2%)

Query: 80  IFGVAFSIMGLLPSIASTMDGGLA-AGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAG 138
           I G+   +M  +  + ++M  GL   G + +  G+ ++G  I    ++LGE+ S  P   
Sbjct: 61  IVGLGLGLMSPVLGMCTSMAIGLINGGPLTIMLGFLISGVCIWFSSLSLGEIVSKFPME- 119

Query: 139 AVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTD 198
            ++V     APEK +   S+  G+L  +       SI +  AQ  +S +++ N +     
Sbjct: 120 -LHVGSAMLAPEKLKLVCSWYTGWLMLIGNWTMSTSITFAGAQLTISLILMTNSNLISEA 178

Query: 199 PITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFN 258
            + +       + +TV+  +N K    ++T +                       K  F 
Sbjct: 179 HLIFYTVIVFYLVVTVVGLVNLKFARFIETINKVCVYWIIYAIIFIDILLLVF-HKGKFR 237

Query: 259 KASY-IFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVA 317
              Y +F    NL+ + + +   I G   + +T+  +     +A+E K   + +P G+  
Sbjct: 238 SLKYALFHFDNNLSGYKSAFLSFIIGFQQSNFTLQGFSMLPALADEVKVPEKDIPRGMSN 297

Query: 318 SISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQ 377
           ++      G +  I I+  + PD + +  +     I  +F  +      L+F  +++I  
Sbjct: 298 AVLLSAFSGVIFLIPIMLIL-PDNDLLFTNHKVLPIVNIFTKS-TDSVVLSFFLVLLILG 355

Query: 378 FLM--GASTVLANSRQFWAFARDDGIPFSKFFKKV--DERSHVPMRSIWGSSFFSIALGA 433
            L+  G  ++  +SR  ++F+RD  IP+   +  V  D +S VP  S+  S   S  LG 
Sbjct: 356 NLLFSGIGSITTSSRAVYSFSRDQAIPYYDKWTYVEPDSQSKVPKNSVVLSMIISYFLGL 415

Query: 434 LCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWSTANGWLAVF 493
           L L    A +A    ++  +  A   P+ L L   R+  R  P  + + +      +++ 
Sbjct: 416 LALISTAAFNAFIGAAVLCLCSATFIPLVLVLFTRRRAIRSAPVKIRYKFGWFINIVSIV 475

Query: 494 FQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLI-YYFVWQRKFYEGPKSN 548
           + L +++ V  P  +  +T +TMNY +++   F +L +   YF W +  +  P ++
Sbjct: 476 WLLLSMVSVCLP-TQVPVTFKTMNYALMVYV-FCILVITGLYFKWGKYNFRLPLAD 529

>Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {ON}
           YKL174C (REAL)
          Length = 616

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 104/481 (21%), Positives = 202/481 (41%), Gaps = 14/481 (2%)

Query: 72  KREYSTVQIFGVAFSIMGLLPSIASTMDGGLA-AGAVGLNWGWFVAGGLILSVGIALGEL 130
           K   S   I G+   +M  +  + ++M  GL   G + +  G+ ++G       ++LGE+
Sbjct: 53  KSLLSRSSIVGLGLGLMSPVLGMCTSMAIGLINGGPLTIMLGFLISGMCTWFSSLSLGEI 112

Query: 131 SSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG 190
            S  P    ++V     AP+  +   S+  G+L  +       SI +  AQ  +S +++ 
Sbjct: 113 VSKFPME--LHVGSAMLAPKNLKLVCSWYTGWLMLIGNWTMSTSITFAGAQLTISLILMT 170

Query: 191 NPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXS 250
           N D      + +       + +TV+  +N K    ++T +                    
Sbjct: 171 NSDLISEAHLIFYTVIVFYLVVTVVGLVNLKFARFIETIN-KVCVYWIVYAIIFIDILLL 229

Query: 251 RSDKVSFNKASY-IFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARR 309
              K  F    Y +F    NL+ + + +   I G   + +T+  +     +A+E K   R
Sbjct: 230 IFHKGKFRSLKYALFHFDNNLSGYKSAFLSFIIGFQQSNFTLQGFSMLPALADEVKVPER 289

Query: 310 AVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTF 369
            +P G+  ++      G +  I I+  + PD +A+  +     I  +F  +      L+F
Sbjct: 290 DIPRGMSNAVLLSAFSGVIFLIPIMLIL-PDNDALFTNHKVLPIVNIFTKS-TDSVVLSF 347

Query: 370 LSLIIICQFLM--GASTVLANSRQFWAFARDDGIPFSKFFKKV--DERSHVPMRSIWGSS 425
             +++I   L+  G  ++  +SR  ++F+RD  IP    +  V  D +S VP  S+  S 
Sbjct: 348 FLVLLILGNLLFSGIGSITTSSRAVYSFSRDHAIPHYGRWTYVEPDSQSKVPKNSVILSM 407

Query: 426 FFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWST 485
             S  LG L L    A +A    ++  +  A   P+ L L   R+  R  P  + + +  
Sbjct: 408 IISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLVLVLLTRRRAIRSAPVKIRYKFGW 467

Query: 486 ANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLI-YYFVWQRKFYEG 544
               +++ + L +++ V  P  +  +T +TMNY +++   F +L +   YF W +  +  
Sbjct: 468 FINIVSIAWVLLSMVSVCLP-TQVPVTFKTMNYALMVY-VFCILVITGLYFKWGKYNFRL 525

Query: 545 P 545
           P
Sbjct: 526 P 526

>Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {ON}
           YKL174C (REAL)
          Length = 619

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 106/484 (21%), Positives = 201/484 (41%), Gaps = 14/484 (2%)

Query: 72  KREYSTVQIFGVAFSIMGLLPSIASTMDGGLA-AGAVGLNWGWFVAGGLILSVGIALGEL 130
           K   S   I G+   +M  +  + ++M  GL   G   +  G+ ++G  I    ++LGE+
Sbjct: 53  KSLLSRSSIVGLGLGLMSPVLGMCTSMAIGLINGGPFTIMLGFLISGVCIWFSSLSLGEI 112

Query: 131 SSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVG 190
            S  P    ++V     APE  +   S+  G+L  +       SI +  AQ  +S +++ 
Sbjct: 113 VSKFPME--LHVGSAMLAPETLKLVCSWYTGWLMLIGNWTMSTSITFAGAQLTISLILMT 170

Query: 191 NPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXS 250
           N D      + +       + +T +  +N K  AR                         
Sbjct: 171 NSDLISEAHLIFYTVIVFYLVVTAVGLVNLKF-ARFIEIINKVCVYWIIYAIIFIDILLL 229

Query: 251 RSDKVSFNKASY-IFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARR 309
              K  F    Y +F    NL+ + + +   I G   + +T+  +     +A+E K   R
Sbjct: 230 VFHKGKFRSLKYALFHFDNNLSGYKSAFISFIIGFQQSNFTLQGFSMLPALADEVKVPER 289

Query: 310 AVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTF 369
            +P G+  ++      G +  I I+  + PD + +  +     I  +F  +      L+F
Sbjct: 290 DIPRGMSNAVLLSAFSGVIFLIPIMIIL-PDNDLLFTNHKVLPIVNIFTKS-TDSVVLSF 347

Query: 370 LSLIIICQFLM--GASTVLANSRQFWAFARDDGIPFSKFFKKV--DERSHVPMRSIWGSS 425
             +++I   L+  G  ++  +SR  ++F+RD  IP+   +  V  D +S VP  S+  S 
Sbjct: 348 FLVLLILGNLLFSGIGSITTSSRAVYSFSRDQAIPYYDKWTYVEPDSQSKVPKNSVILSM 407

Query: 426 FFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFYLGHFWST 485
             S  LG L L    A +A    ++  +  A   P+ L L   R+  R  P  + + +  
Sbjct: 408 IISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLVLVLFTRRRAIRSAPVKIRYKFGW 467

Query: 486 ANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLI-YYFVWQRKFYEG 544
               +++ + L +++ V  P  +  +T +TMNY +V+   F +L +   YF W +  +  
Sbjct: 468 FINIVSIVWLLLSMVSVCLP-TQLPVTFKTMNYALVVY-IFCILVITGLYFKWGKYNFRL 525

Query: 545 PKSN 548
           P ++
Sbjct: 526 PLAD 529

>Skud_14.392 Chr14 complement(699671..701266) [1596 bp, 531 aa] {ON}
           YNR056C (REAL)
          Length = 531

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 116/521 (22%), Positives = 205/521 (39%), Gaps = 78/521 (14%)

Query: 68  KEELK--REYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGA-VGLNWGWFVAGGLILSVG 124
           + E+K  + ++   + G+AFS+      I+++M  G+A+G  + + +G  +A    L  G
Sbjct: 6   RPEVKFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFSLMCG 65

Query: 125 IALGELSSSIPTA--GAVYVA------------------------------CYQWAPE-- 150
           I+LG+ +S +P +  G+ +V                               C     E  
Sbjct: 66  ISLGDFASMLPNSCGGSFWVLKMLEQKSATLKTPDYEDTSDDDEEVFLENYCQTANVEVS 125

Query: 151 -KWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCA-- 207
            K ++  S  VG L+      +  SI   L+   +    + +PD+E+     + +F    
Sbjct: 126 SKVQRVSSMVVGLLNYFGAIFTTASICSSLSMSCIGIHKLLHPDYELKH---WHIFVGYQ 182

Query: 208 CIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDV 267
           CI AI  L ++ S     +  F                    S +   ++ KAS IFG  
Sbjct: 183 CINAILTLFNIYSSPLPYISQFGLYTSLLSFAMTFIICIVSRSNNTIDAWPKASNIFGSF 242

Query: 268 QNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEA--KDARRAVPIGIVASISSCWIL 325
            N T WN+     + GL   IW     DS  HM +E     +R  VP  I+ +I   +I 
Sbjct: 243 DNQTGWNSSGMAFVVGLVNPIWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTIIVGFIT 302

Query: 326 GWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQ-FLMGAST 384
            ++ C+ +  C+  D  A+V S     I ++F  A G R    FL  + I   F+ G ++
Sbjct: 303 SFIYCVGLFFCIT-DKTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGFVAGIAS 359

Query: 385 VLANSRQFWAFARDDGIPF-------SKFFKKVDERS---HVPMRSIWGSSFFSIALGAL 434
               SR   +F +    PF       +K  K++   +     P+ + + S      +G +
Sbjct: 360 GTWQSRILQSFGKSYA-PFYKEDSLGNKSLKRLAMLTPGFKSPLYAHFLSQICVTVIGCI 418

Query: 435 CLAGDTAADALFSLSIAGMYMALVFP-IALRLTYGRKDF------------RPGPFYLGH 481
            +   TA +A+ +  I  + M+   P         ++ F            RP    +  
Sbjct: 419 FMGSSTAFNAIITACITLLLMSYAVPSFIFVFVVDKEKFIHRIGNDVSCISRPNRRRM-- 476

Query: 482 FWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVI 522
             S     + + + LF ++ + FPY    +T   MNYT V+
Sbjct: 477 --SKIPHIICILWALFCLVFLSFPYTLP-VTAGNMNYTSVV 514

>SAKL0H11484g Chr8 complement(983765..985447) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53744 Saccharomyces cerevisiae
           YNR056C BIO5 Putative transmembrane protein involved in
           the biotin biosynthesis pathway responsible for uptake
           of 7-keto 8-aminopelargonic acid BIO5 is in a cluster of
           3 genes (BIO3 BIO4 and BIO5) that mediate biotin
           synthesis
          Length = 560

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 95/420 (22%), Positives = 165/420 (39%), Gaps = 42/420 (10%)

Query: 150 EKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACI 209
             W++ ++ +VG ++      +  S+   L+   L    + +P +E+     + VF    
Sbjct: 149 SNWQRSVALTVGLINYFGAVFTTASVCSSLSLNFLGVYSLVHPAYEIKH---WHVFLTYE 205

Query: 210 VAITVLTSMN--SKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDV 267
           +     T+ N  SK    +  F                    S      +   S IF + 
Sbjct: 206 ILNVFFTTFNCWSKWLPAISQFGLYMSMFSFGLTFVISLVCRSNDKVTPWPTKSSIFSEF 265

Query: 268 QNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEA--KDARRAVPIGIVASISSCWIL 325
            N T W++     I GL   +W     DS  HM +E     +R  VP  I+ ++   ++ 
Sbjct: 266 SNTTGWSSSGMAFIVGLINPLWAFAGIDSATHMVDEVGHSTSRTLVPRAIIGTVLLGFVT 325

Query: 326 GWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQ-FLMGAST 384
            +   I +  C+  D  ++V S     I Q++  A G R    FL    I    + G ++
Sbjct: 326 SFTYSIGMFYCIT-DTKSVVESIL--PILQIYYQATGNRNLSIFLQCCCITSGVVCGIAS 382

Query: 385 VLANSRQFWAFARD-DGIP----------FSKFFKKVDERSHVPMRSIWGSSFFSIALGA 433
               SR  W+ +RD + I           F K F  V+    VP+ S   S      +G 
Sbjct: 383 GTWQSRILWSISRDFENIDTNKPRPVFRYFCKRFGHVNSLLKVPLTSHLFSQVIVAIIGC 442

Query: 434 LCLAGDTAADALFSLSIAGMYMALVFPIALRL-TYGRKDF--RPGP------------FY 478
           + +   TA +A+ +  I  + ++   P  + L   G++ F  R G             F+
Sbjct: 443 IFMGSTTAFNAIITACITLLLLSYAIPCTILLVVVGKRQFYRRIGQELDELKLSTSSIFH 502

Query: 479 LGHFW--STANGWLAVFFQLFAVLMVMFPYDKSGITKETMNY-TVVIGPGFWVLSLIYYF 535
             + W    ANG+  + + LF ++ + FPY    ++   MNY +VV G    V+S+I YF
Sbjct: 503 SKNVWFGYIANGF-TIAWALFCLIFLSFPYTLP-VSAGNMNYVSVVYGAIALVISVIVYF 560

>Suva_14.415 Chr14 complement(716463..718061) [1599 bp, 532 aa] {ON}
           YNR056C (REAL)
          Length = 532

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 111/535 (20%), Positives = 210/535 (39%), Gaps = 77/535 (14%)

Query: 70  ELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGA-VGLNWGWFVAGGLILSVGIALG 128
           +  + ++   + G+AFS+      I+++M  G+A+G  + + +G  +A    L  GI+LG
Sbjct: 10  KFDKHFNWWSLLGIAFSLSCSWVGISASMAVGIASGGPLLIIYGLIIAAFFTLMCGISLG 69

Query: 129 ELSSSIPTAGA------------------------------VYVACYQWAPE-----KWR 153
           + +S +P +                                V++  Y          + +
Sbjct: 70  DFASILPNSCGGSFWVLKMLEREPATLKTPDYEDASDDDEEVFLETYCQTSNVEISSRLQ 129

Query: 154 KCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCA--CIVA 211
           K  S  VG L+      +  S+   L+   +    + +P++E+     + VF    CI A
Sbjct: 130 KGTSMVVGLLNYFGAIFTTASVCSSLSMSCIGIHKLLHPEYELKH---WHVFVGYQCINA 186

Query: 212 ITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLT 271
              + ++ S     +  F                    S +   S+ KAS IFG+  N T
Sbjct: 187 TLTVFNIYSSPLPYISQFGLYTSLLSFAMTFIICIVSRSNNTVDSWPKASNIFGNFDNQT 246

Query: 272 DWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEA--KDARRAVPIGIVASISSCWILGWLI 329
            W++     + GL   IW     DS  HM +E     +R  VP  I+ +I   +I  ++ 
Sbjct: 247 GWHSSGMAFVVGLVNPIWAFVGIDSATHMIDEVGYSKSRFLVPKVIITTIVVGFITSFIY 306

Query: 330 CIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQ-FLMGASTVLAN 388
           C+ +  C+  D  A+V S     I ++F  A G R    FL  + I   ++ G ++    
Sbjct: 307 CVGLFFCIT-DKTAVVESIL--PIVEIFYQATGNRNLSVFLQCMCITTGYVAGIASGTWQ 363

Query: 389 SRQFWAFARDDGIPF-------SKFFKKVDERS---HVPMRSIWGSSFFSIALGALCLAG 438
           SR   ++ +    PF       +K  KK+   +     P+ + + S      +G + +  
Sbjct: 364 SRILQSYGKSYA-PFYKEGSLGNKSLKKLATLTPGFKSPLYAHFLSQICVTIIGCIFMGS 422

Query: 439 DTAADALFSLSIAGMYMALVFP-IALRLTYGRKDF------------RPGPFYLGHFWST 485
            TA +A+ +  I  + M+   P         +++F            RP    +    S 
Sbjct: 423 STAFNAIITACITLLLMSYAVPSFIFVFVVNKENFTSRIENEVNGISRPKTRRM----SI 478

Query: 486 ANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYT-VVIGPGFWVLSLIYYFVWQR 539
               + + + LF ++ + FPY    +T   MNYT VV    F +++++ +   +R
Sbjct: 479 IPHIICILWTLFCLIFLSFPYTLP-VTAGNMNYTSVVYAVVFCIITIVVFPACRR 532

>KLLA0B00385g Chr2 complement(25847..27541) [1695 bp, 564 aa] {ON}
           similar to uniprot|P53744 Saccharomyces cerevisiae
           YNR056C BIO5 Putative transmembrane protein involved in
           the biotin biosynthesis pathway responsible for uptake
           of 7-keto 8-aminopelargonic acid BIO5 is in a cluster of
           3 genes (BIO3 BIO4 and BIO5) that mediate biotin
           synthesis
          Length = 564

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 94/403 (23%), Positives = 168/403 (41%), Gaps = 41/403 (10%)

Query: 152 WRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVA 211
           ++K ++ +VG ++      +  SIV  L   I+    + +P FE+    T+ ++    V 
Sbjct: 152 FQKNMAIAVGLINYFGCVFTTASIVSALVYSIMGIHSILHPSFELKQWHTFILYEILTVF 211

Query: 212 ITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVS---FNKASYIFGDVQ 268
           +TV  + N +    L +F                    SRS+ +S   + K+  IF    
Sbjct: 212 LTVF-NCNYRCLPFLSSFGLAMSLLSYAITFILCLV--SRSNSISEQPWPKSEDIFYKFH 268

Query: 269 NLTDWNT-GWSWCINGLTPAIWTIGAYDSCLHMAEEAKD--ARRAVPIGIVASISSCWIL 325
           N T W + G ++ ++ + P +W+    DS  HM +E     A+  VP  I+ +I   +I 
Sbjct: 269 NNTGWKSNGMAFVVSLINP-LWSFVGIDSATHMVDEVGHVAAQVLVPKVIITTIFIGFIT 327

Query: 326 GWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSL-IIICQFLMGAST 384
            +   I +  C+  D  A++ S     +  ++  A G R    F+    I+     G ++
Sbjct: 328 SFSYSIALFYCVR-DTAAVLESI--APVVTIYYQATGNRNLAVFMQASTIVAGLTCGVAS 384

Query: 385 VLANSRQFWAFARD------DGIPFSKF----FKKVDERSHVPMRSIWGSSFFSIALGAL 434
               SR  W+ +R+      DGI  S F    F  +D  + VP+ + + S    + +G +
Sbjct: 385 GTWQSRMLWSLSREMETMRPDGI-LSGFVTARFATIDSVNKVPLYAHFFSQALVVIIGCI 443

Query: 435 CLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDF--------------RPGPFYL- 479
            L    A +A+ S ++  + ++   P  + L  GR  F               P  + + 
Sbjct: 444 MLGSTKAFNAIVSAAVTLLIVSYAIPSLILLVRGRNKFIAKCERETANETDIVPNKYSMW 503

Query: 480 GHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVI 522
              W      L V + LF V+M+ FPY K  +T   MNY  V+
Sbjct: 504 LKKWGVIPHTLTVAYALFCVVMLSFPYVKP-VTSSNMNYVSVV 545

>Kthe_YGOB_SAKL0H11484g Chr5 complement(59674..60886,60889..61346)
           [1671 bp, 556 aa] {ON} ANNOTATED BY YGOB -
          Length = 556

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 85/396 (21%), Positives = 153/396 (38%), Gaps = 38/396 (9%)

Query: 156 ISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACIVAITVL 215
           ++ +VG L+      +  S+   LA  IL    + +  +E+     + V+      +T+L
Sbjct: 156 LALAVGLLNYFGAVFTTASVFSSLALSILGVYSLLHASYELKHWHVFVVYELLNFLLTIL 215

Query: 216 TSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQNLTDWNT 275
               SKI   L  F                    S    +S+ K+S IFG  +N T W++
Sbjct: 216 GCW-SKILPALSRFGLYISLFTYLITFVISLVSRSNYSDISWPKSSDIFGQFRNTTGWSS 274

Query: 276 GWSWCINGLTPAIWTIGAYDSCLHMAEEA--KDARRAVPIGIVASISSCWILGWLICIVI 333
                + GL   +W     DS  HM +E   K +   VP  I+++I   ++  +   I +
Sbjct: 275 SGMAFVVGLINPLWAFAGIDSATHMVDEVGYKASTTLVPQAILSTIIIGFLTSFTYAIGM 334

Query: 334 LACMNPDVNAIVNSPYGQGITQVFQDALGKR-WTLTFLSLIIICQFLMGASTVLANSRQF 392
             C+  D   +  S     I +++  A G R  ++      I+   L G ++V   SR  
Sbjct: 335 FFCVT-DTEKVTESIL--PILEIYYQATGNRNLSVLMQCCCILTGALCGIASVTWQSRIL 391

Query: 393 WAFARD-----DGIPFSK----FFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDTAAD 443
           W+  +D        P  K    FF  V+ +   P+ +   S      +G + +   TA +
Sbjct: 392 WSLGKDFSQVTTTRPVCKKTMGFFGTVNSKLRAPLNAHLFSQLCVAIIGCIFMGSSTAFN 451

Query: 444 ALFSLSIAGMYMALVFPIALRLTYGRKDFR-----------------PGPFYLGHFWSTA 486
           A+ S  I  + +    P  + L  G+++F                  P    +G   +  
Sbjct: 452 AIISACITLLLLTYAVPCLIVLLIGKREFYERAKSKLNVLGVNLGRVPVCSKIGQIPNV- 510

Query: 487 NGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVI 522
              L + + LF ++ + FPY    ++   MNY  V+
Sbjct: 511 ---LTILWALFCLIFLSFPYSLP-VSANNMNYVTVV 542

>AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL174C
          Length = 575

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 113/530 (21%), Positives = 219/530 (41%), Gaps = 35/530 (6%)

Query: 67  YKEELKREY-STVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLIL-SVG 124
           Y+++L R   S   + G+ F +M  +  +++T+  GL  G      G F   GL+     
Sbjct: 46  YEQKLDRTLLSRRSVIGLGFGLMSPVLGMSTTLGIGLVHGGPPTILGAFALCGLMSWLTA 105

Query: 125 IALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQIL 184
           +A+GE+ S  P      VA    APE++R   +Y  G L  L       SI Y  AQ I+
Sbjct: 106 LAIGEVVSKYPIELHGSVAL--LAPERYRLVAAYYTGCLILLGNWVMNASIQYAGAQLII 163

Query: 185 SAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXX 244
           S + +   D    + +         ++ITV   +N+K  + L+  +              
Sbjct: 164 SLIAISG-DLVSEENLAIWTVAVYFLSITVTGVINAKFASFLEPINTVCIYWILYAVVFI 222

Query: 245 XXXXXSRSDKVSFNKASY--IFGDVQNLTDWNTGW-----SWCINGLTPAIWTIGAYDSC 297
                     + F+K S+        N  +  +G+     S+ + GL  + +T+  +   
Sbjct: 223 DVLL------ILFHKGSFRPFLSAFSNFDNRLSGYESMLLSFLVGGLQQSNFTLQGFSML 276

Query: 298 LHMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVF 357
             +++E ++  + +P G+  ++    + G +  + +L  M P    +++      I  +F
Sbjct: 277 PALSDETQEPEKDIPKGMSQAVLVSTVCGVIYLVPLLLVM-PSPEEVMSDSRVMEIVLLF 335

Query: 358 QDALGKRWTLTFLSLIIICQFLM--GASTVLANSRQFWAFARDDGIPFSKFFKKVD--ER 413
             +  +   +++L +++I   L+  G  ++  +SR  ++ +RD  IP+ + +  V    +
Sbjct: 336 TKS-TRSNIVSYLQVMLILGNLLFSGIGSITTSSRAVYSISRDHAIPYYELWSYVSPGSQ 394

Query: 414 SHVPMRSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFR 473
           S VP  +++ S   S   G L L   TA ++    S+  +  A    +   +  GR+  +
Sbjct: 395 SQVPKYAVYLSMGASYLFGILPLISGTAYNSFIGASVMCLCSASGLAVICVMLNGRRGVK 454

Query: 474 PGPFYLGHFWSTANGWLAVFFQLFAVLMVMF----PYDKSGITKETMNYTVVIGPGFWVL 529
                +        GW      L  +L+VMF    P     +T  +MNYT  I   F V 
Sbjct: 455 GAAVKI----RCRLGWPVSIVVLLWLLLVMFCMCMPVTLP-VTFSSMNYTSCIFAVFLVG 509

Query: 530 SLIYYFVWQRKFYEGPKSNLTDEEFVEAVGEDAIDAMLSNYSQAHQDKLS 579
               Y +W R  ++ P+  + +   + + G      ML + S+A    L+
Sbjct: 510 IGALYNLWGRYHFKIPQ--IYENIPLTSRGTTVSPLMLDSPSKAEDTFLT 557

>Kwal_55.19602 s55 (43521..45197) [1677 bp, 558 aa] {ON} YNR056C
           (BIO5) - transmembrane regulator of KAPA/DAPA transport
           [contig 159] FULL
          Length = 558

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 74/343 (21%), Positives = 132/343 (38%), Gaps = 28/343 (8%)

Query: 148 APEKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCA 207
           A    ++  + +VG ++      +  S+   LA  IL    + N ++ +     + V+  
Sbjct: 150 ATSTIQRSTALAVGLINYFGAIFTTSSVFSSLAISILGVHSLLNEEYTLKHWHVFVVYEV 209

Query: 208 CIVAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDV 267
            ++ +T L S  S I   L  F                    S + +V++ K S IFG+ 
Sbjct: 210 LVIFLT-LVSCWSLILPALSKFGLGMSLITYMLTFIVSLVCRSSNTEVAWPKPSMIFGEF 268

Query: 268 QNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEA--KDARRAVPIGIVASI------ 319
           +N T W +     I GL   +W     DS  HM +E     + + VP  I+ +I      
Sbjct: 269 KNTTGWKSSQMAFIVGLINPLWAFAGIDSATHMVDEVGYTASMKLVPRVIIGTILIGFVT 328

Query: 320 SSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLS-LIIICQF 378
           S  + +G   CI   A ++  V  I+         +++  A G +    FL    I+   
Sbjct: 329 SFTYAIGMFFCITDPAKLSDAVLPIL---------ELYYQATGNKNLSVFLQCCCIVSGI 379

Query: 379 LMGASTVLANSRQFWAFARDDGI---------PFSKFFKKVDERSHVPMRSIWGSSFFSI 429
             G ++V   SR  W+  RD               KFF  V+     P+ + + S     
Sbjct: 380 TCGVASVTWQSRILWSLGRDFSTLELRQTYSKKILKFFGVVNPTLKTPLNAHFFSQLLVA 439

Query: 430 ALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDF 472
            +G + +   TA +A+ +  I  + ++   P  +    GR+ F
Sbjct: 440 IIGCIFMGSSTAFNAIITACITLLLLSYAIPCLILFMVGRRRF 482

>TDEL0G04830 Chr7 complement(891989..893620) [1632 bp, 543 aa] {ON} 
          Length = 543

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 85/401 (21%), Positives = 158/401 (39%), Gaps = 33/401 (8%)

Query: 150 EKWRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTDPITYGVFCACI 209
           +KW+K +    G  +      +  SI   L+  IL    + +PD+E+     +  +    
Sbjct: 135 KKWKKDLGIMTGLFNYAGAVFTSASICASLSLSILGVYSLMHPDYELRHWNVFLTYELLN 194

Query: 210 VAITVLTSMNSKITARLQTFSXXXXXXXXXXXXXXXXXXXSRSDKVSFNKASYIFGDVQN 269
           +A+  + S    + A +  F                    S +    +     +FG+  N
Sbjct: 195 IAMAFVASWARWLPA-ISQFGLGISVVSYVLTFLISIISRSFNHSEQWPTGKTVFGEFTN 253

Query: 270 LTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEA--KDARRAVPIGIVASISSCWILGW 327
            T W++     I GL   +W+    DS  HM ++     +R+ VP  I+A+I   +   +
Sbjct: 254 TTGWSSSGMAFIVGLINPLWSFAGIDSATHMVDDVGYSASRKLVPRIIIATILLGFATAF 313

Query: 328 LICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFL-SLIIICQFLMGASTVL 386
              IV+  C+  D   +V+S     I Q++  A G +    F+ S  II  F+ G S+  
Sbjct: 314 PYAIVMFFCIT-DSTQVVSSIL--PILQIYYQATGNKSLSAFMQSCCIITGFICGVSSST 370

Query: 387 ANSRQFWAFAR--------DDGIPFSKFFKKVDERS---HVPMRSIWGSSFFSIALGALC 435
             +R  W+ +R        +     ++   K+   S    +P+ +   S FF   +G + 
Sbjct: 371 WQNRILWSVSRTYHLIECDEMNAKKAQVVAKIASISPTIRIPVYAHLLSHFFVAVIGCIF 430

Query: 436 LAGDTAADALFSLSIAGMYMALVFP-IALRLTYGRKDF------RPGPFYLGH------- 481
           +   TA +A+ +  I+ + ++   P I +    G+K+F            L H       
Sbjct: 431 MGSSTAFNAIITACISILLLSYAVPCIIMVFVVGKKNFYRNIASEQQALGLSHQVEESRA 490

Query: 482 FWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVI 522
            W      L + + LF ++ + FPY    +    MNY  V+
Sbjct: 491 SWYLVPNILTICWALFCLIFLSFPYVIP-VDSSNMNYVSVV 530

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 69  EELKREYSTVQIFGVAFSIMGLLPSIASTMDGGL-AAGAVGLNWGWFVAGGLILSVGIAL 127
           E+   +++ + + G+AFS+      ++S++  GL + G V + +G  +     +  G++L
Sbjct: 3   EKRFTKFNWLSLLGIAFSLTSSWLGVSSSLVAGLYSGGPVLIIYGLIIGAVFTIMCGLSL 62

Query: 128 GELSSSIPTAGAV 140
            E SS +P A  V
Sbjct: 63  CEFSSMLPNASGV 75

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 54  SATSDTQVLAEIGYKEELKR--EYSTVQIFGVAFSI-MGLLPSIASTMDGGLAAGAVGLN 110
           S T+D     E   +E+L R  +   V +  +A  I  GL  S + ++  G   G   L 
Sbjct: 33  SFTTDENYDPEANIREDLTRALKPRVVNMISIAGIIGTGLYLSTSKSLHTG---GPASLF 89

Query: 111 WGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCA 170
             + + GG++    +ALGE+S+ +P +G+  V   ++  E +   + ++  F D +S+ +
Sbjct: 90  MNYTIMGGVVYLTLLALGEMSTYMPISGSFCVYARKFGSESFACALMWNYWFNDAVSVAS 149

Query: 171 SVCSI 175
            + ++
Sbjct: 150 DLTAL 154

>KLTH0F01518g Chr6 complement(113886..115841) [1956 bp, 651 aa] {ON}
           some similarities with uniprot|P36110 Saccharomyces
           cerevisiae YKR013W
          Length = 651

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%)

Query: 7   SMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQVLAEIG 66
           S    SG + H   RNN  + IGFG+VS+   +       I+Y D  + T  T    E+G
Sbjct: 528 SYDPCSGNLVHSSTRNNQGENIGFGTVSDPNTLVDYWYDEIQYYDYDNVTGITHDGQEVG 587

Query: 67  YKEEL 71
           +  +L
Sbjct: 588 HFTQL 592

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 30/143 (20%), Positives = 66/143 (46%), Gaps = 5/143 (3%)

Query: 35  ELRVVTSAHGAPIRYIDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIMGLLPS- 93
           +++ V S H   +  + +L +        E   +E+LKR+ S   I  +  SI G++ + 
Sbjct: 33  KVKAVYSTHSV-LEGVHSLESIESASFDPESNIREDLKRDLSPRHINMI--SIAGVIGTG 89

Query: 94  -IASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKW 152
              ST       G   L   + + GG++    + LGE+S+ +P +G+      ++  E +
Sbjct: 90  LYLSTSKSLHVGGPASLFMNYSIFGGVVYLTMMCLGEMSTYMPISGSFCSYAKKFGSESF 149

Query: 153 RKCISYSVGFLDTLSLCASVCSI 175
              + ++  F D +S+ + + ++
Sbjct: 150 ACALMWNYWFNDAVSVASDLTAL 172

>CAGL0K10758g Chr11 complement(1048208..1048711) [504 bp, 167 aa]
           {ON} similar to uniprot|Q04969 Saccharomyces cerevisiae
           YML055w SPC2
          Length = 167

 Score = 33.1 bits (74), Expect = 1.0,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 6/76 (7%)

Query: 490 LAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQRK-----FYEG 544
           LA+ + + A+ +  F  DK    KE M+Y +++   ++ LSL+Y+ V+Q+       Y G
Sbjct: 41  LALGYTMAAIAVGSFLLDKKFEKKEIMHYQLILTVLYFALSLVYW-VYQKTVNKNAIYHG 99

Query: 545 PKSNLTDEEFVEAVGE 560
            K++  + + + ++G+
Sbjct: 100 KKTSGENIKVITSIGK 115

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/129 (20%), Positives = 65/129 (50%), Gaps = 6/129 (4%)

Query: 50  IDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIM---GLLPSIASTMDGGLAAGA 106
           +D  ++ SD     +   +E L R  S   +  +A + +   GL  S A +++ G   G+
Sbjct: 41  VDTNNSVSDDPESQDAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAG-GPGS 99

Query: 107 VGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTL 166
           + +N+   + GG+I    ++LGE+S+ +P +G+      ++  E +   +  ++ + D +
Sbjct: 100 LLINY--VIMGGVIYLTMLSLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAV 157

Query: 167 SLCASVCSI 175
           S+ + + ++
Sbjct: 158 SVASDLTAL 166

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 104 AGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCIS--YSVG 161
           AG  G+  GW + G +I  + +A+GEL+ + P AG       ++  E +    +  Y++G
Sbjct: 109 AGPAGILIGWALTGTMIYCMVMAMGELAVTFPVAGGYTTYASRFVDESFGFAFNTVYAMG 168

Query: 162 FLDTLSLCASVCSI 175
           +L TL L     SI
Sbjct: 169 WLITLPLEIVAASI 182

>KNAG0D04070 Chr4 (733476..735290) [1815 bp, 604 aa] {ON} Anc_4.195
           YGR055W
          Length = 604

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 69/317 (21%), Positives = 118/317 (37%), Gaps = 36/317 (11%)

Query: 261 SYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCLHMAEEAKDARRAVPIGIVASIS 320
           S+ F +    TD  T +   +N L   IW+   Y +  +   E KD  R + I    S+ 
Sbjct: 241 SHNFHNAFEGTDKATAYG-IVNALYNVIWSFVGYSNVNYALGEVKDPVRTLKIAGPTSLV 299

Query: 321 SCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQDALGKRWTLTFLSLIIICQFLM 380
              ++   + I   A +  D               +      KR    F+ L  +   + 
Sbjct: 300 FLAVVYIFVNIAYFAVVPKDKLVSSKLILAADFFDICFGGHAKRAAAAFVGLSALGNVM- 358

Query: 381 GASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPMRSIWGSSFFSIALGALCLAGDT 440
             S + +  R      R+  +PFSKFF      S  P  S     F    +  + +    
Sbjct: 359 --SVIFSQGRIIQQLGREGVLPFSKFFA-----SSKPFNSPVVGLFQHFIVCLVTILAPP 411

Query: 441 AADAL-FSLSIAGMYMALV-FPIALRLTY-------GRKDFRPGPFYLGHFWSTANGWLA 491
             DA  F +++    M ++ F I+  L +       GR +++P P   G   +T      
Sbjct: 412 PGDAYNFIMNLISYPMNIINFAISTGLLWIYYQSYKGRIEWKP-PIKAGVTVTT------ 464

Query: 492 VFFQLFAVLMVMFPY----DKSGITKETMNYTV--VIGPGFWVLSLIYYFVWQRKFYEGP 545
            FF L  + +++ PY    D   +  E + Y +  V+  G + L  +YY VW +      
Sbjct: 465 -FFALSNLYLIIAPYIPPSDGESVY-ENLPYWIHCVVSWGIFGLGGLYYLVWTQLLPRWG 522

Query: 546 KSNLTDEEFVEAVGEDA 562
           K  L  +   + +GED 
Sbjct: 523 KYKLVTK---DVLGEDG 536

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 60/129 (46%), Gaps = 10/129 (7%)

Query: 50  IDALSATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIM---GLLPSIASTMDGGLAAGA 106
           ID L +  D     E   +E+L R  S   I  ++ + +   GL  S A ++  G   G 
Sbjct: 29  IDELRSDFD----PEQNIREDLTRALSPRHINMISIAGIIGTGLYLSTAKSLHNG---GP 81

Query: 107 VGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTL 166
             L   + + GG++    + LGE+S+ +P +G+      ++  E +   + ++  F D +
Sbjct: 82  ASLFMNYTIIGGVVYLTMLCLGEMSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAV 141

Query: 167 SLCASVCSI 175
           S+ + + ++
Sbjct: 142 SVASDLTAL 150

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 54  SATSDTQVLAEIGYKEELKREYSTVQIFGVAFSIM---GLLPSIASTMDGGLAAGAVGLN 110
           S T++     E   +E+L+R      I  ++ + +   GL  S A ++  G   G   L 
Sbjct: 37  SLTTEEDYDPEANIREDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQG---GPASLF 93

Query: 111 WGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCA 170
             + + GG++    + LGE+S+ +P +G+      ++  E +   + ++  F D +S+ +
Sbjct: 94  MNYTIMGGVVYLTLLCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVAS 153

Query: 171 SVCSI 175
            + ++
Sbjct: 154 DMTAL 158

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 104 AGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCI--SYSVG 161
           AG  G+  GW V G +I S+ +A+GEL+   P +G       ++  E +   I  +Y + 
Sbjct: 120 AGPAGILIGWTVTGTMIYSMVMAVGELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQ 179

Query: 162 FLDTLSL 168
           +L TL L
Sbjct: 180 WLITLPL 186

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 80/200 (40%), Gaps = 24/200 (12%)

Query: 23  NSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQ-VLAEIGYKEELKREYSTVQIF 81
            +NDE G GS  +    +     P+     L+       V A+   K  LK  +  +Q+ 
Sbjct: 41  TTNDEAGSGSKWQDFKDSFRRVEPVEVDPNLTEAEKVAFVTAQTPLKHHLKNRH--LQMI 98

Query: 82  GVAFSI-MGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAGAV 140
            +  +I  GLL    + +  G   G   L  GW   G +I S+ +ALGEL+   P +G  
Sbjct: 99  AIGGAIGTGLLVGSGTALRTG---GPASLLIGWGSTGTMIYSMVMALGELAVIFPISGGF 155

Query: 141 YVACYQWAPEK--WRKCISYSVGFLDTLSLCASVCSIVYGLAQQILSAVVVGNPDFEVTD 198
                ++  E   +    +Y + +L  L L             +I+SA +  N  F  TD
Sbjct: 156 TTYATRFIDESFGYANNFNYMLQWLVVLPL-------------EIVSASITVN--FWGTD 200

Query: 199 PITYGVFCACIVAITVLTSM 218
           P     F A    + V+ +M
Sbjct: 201 PKYRDGFVALFWLVIVIINM 220

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 104 AGAVGLNWGWFVAGGLILSVGIALGELSSSIPTAG 138
           AG  G+  GW + G +I ++ +ALGEL+   P +G
Sbjct: 121 AGPAGILIGWSITGTMIFTMVMALGELAVMFPVSG 155

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,730,512
Number of extensions: 2164410
Number of successful extensions: 5540
Number of sequences better than 10.0: 127
Number of HSP's gapped: 5479
Number of HSP's successfully gapped: 156
Length of query: 579
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 464
Effective length of database: 40,294,809
Effective search space: 18696791376
Effective search space used: 18696791376
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 68 (30.8 bits)