Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E12937gsingletonON20720710151e-142
TPHA0A018408.254ON68545750.34
KAFR0E01030singletonON64095740.46
Skud_4.3408.217ON62829682.9
SAKL0G12738g5.209ON66141673.6
CAGL0I04818g3.224ON91462647.9
CAGL0L04884g3.472ON271376310.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E12937g
         (207 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E12937g Chr5 (1145337..1145960) [624 bp, 207 aa] {ON} no si...   395   e-142
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...    33   0.34 
KAFR0E01030 Chr5 (212679..214601) [1923 bp, 640 aa] {ON}               33   0.46 
Skud_4.340 Chr4 complement(589540..591426) [1887 bp, 628 aa] {ON...    31   2.9  
SAKL0G12738g Chr7 (1086223..1088208) [1986 bp, 661 aa] {ON} simi...    30   3.6  
CAGL0I04818g Chr9 (431844..434588) [2745 bp, 914 aa] {ON} highly...    29   7.9  
CAGL0L04884g Chr12 complement(559230..560045) [816 bp, 271 aa] {...    29   10.0 

>KLLA0E12937g Chr5 (1145337..1145960) [624 bp, 207 aa] {ON} no
           similarity
          Length = 207

 Score =  395 bits (1015), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 196/207 (94%), Positives = 196/207 (94%)

Query: 1   MRTRVEESWLTSFFFLLDLPIEKEPAIRVQQGHLMARLWGSSFFLLRKHSRNTILIGRLI 60
           MRTRVEESWLTSFFFLLDLPIEKEPAIRVQQGHLMARLWGSSFFLLRKHSRNTILIGRLI
Sbjct: 1   MRTRVEESWLTSFFFLLDLPIEKEPAIRVQQGHLMARLWGSSFFLLRKHSRNTILIGRLI 60

Query: 61  LFIPLKFVMGLSLSWISMWHLLIFVCISKAPLETIENHLRDLTSEKMCRHKVTQKCELTY 120
           LFIPLKFVMGLSLSWISMWHLLIFVCISKAPLETIENHLRDLTSEKMCRHKVTQKCELTY
Sbjct: 61  LFIPLKFVMGLSLSWISMWHLLIFVCISKAPLETIENHLRDLTSEKMCRHKVTQKCELTY 120

Query: 121 LKKISEVKNNTSLMLGFLWQIGFLIRKRIRERASSEELAFANSSICTRDSQATFLLIFNN 180
           LKKISEVKNNTSLMLGFLWQIGFLIRKRIRERASSEELAFANSSICTRDSQATFLLIFNN
Sbjct: 121 LKKISEVKNNTSLMLGFLWQIGFLIRKRIRERASSEELAFANSSICTRDSQATFLLIFNN 180

Query: 181 DLGSSGQVCPMHKXXXXXXXXXXXSHK 207
           DLGSSGQVCPMHK           SHK
Sbjct: 181 DLGSSGQVCPMHKRFLFFLRLLVLSHK 207

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score = 33.5 bits (75), Expect = 0.34,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 28/45 (62%)

Query: 32  GHLMARLWGSSFFLLRKHSRNTILIGRLILFIPLKFVMGLSLSWI 76
           G ++  + G +FFLL  HS  TI +  L+L + + FV+ L LS++
Sbjct: 465 GFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFL 509

>KAFR0E01030 Chr5 (212679..214601) [1923 bp, 640 aa] {ON} 
          Length = 640

 Score = 33.1 bits (74), Expect = 0.46,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 43/95 (45%), Gaps = 10/95 (10%)

Query: 40  GSSFFLLRKHSRNTILIGRLILFIPLKFVMGLSLSWISMWHLLIFVCISKAPLETIENHL 99
           GSSF    +H R+         F  L  + G  + + +   L  FVC+++     IE  +
Sbjct: 550 GSSFIFEGQHFRS---------FTDLTKLNGYDIEYENFVTLHDFVCVNRKYFPYIEKSI 600

Query: 100 RDLTSEKMCRHKVTQKCELTYLKKISEVKNNTSLM 134
                EKMCR+ ++ + +   L K ++  N+  ++
Sbjct: 601 SKEEYEKMCRY-ISDRLQFLRLSKEADQNNDVKMV 634

>Skud_4.340 Chr4 complement(589540..591426) [1887 bp, 628 aa] {ON}
           YDR085C (REAL)
          Length = 628

 Score = 30.8 bits (68), Expect = 2.9,   Method: Composition-based stats.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 23  KEPAIRVQQGHLMARLWGSSFFLLRKHSR 51
           K+P++R   G ++ RLW SS    RKHS+
Sbjct: 318 KKPSLRSNLGFVLKRLWSSSGNSDRKHSK 346

>SAKL0G12738g Chr7 (1086223..1088208) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q07799 Saccharomyces cerevisiae YLL007C
           Hypothetical ORF
          Length = 661

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 25/41 (60%)

Query: 87  ISKAPLETIENHLRDLTSEKMCRHKVTQKCELTYLKKISEV 127
           +SK+ LE IE  L+D  ++     K+ Q   + YL++++E+
Sbjct: 3   LSKSNLEKIEGKLKDFKAKNSASLKLPQDVSIAYLQEVTEL 43

>CAGL0I04818g Chr9 (431844..434588) [2745 bp, 914 aa] {ON} highly
           similar to uniprot|P14180 Saccharomyces cerevisiae
           YBR038w CHS2 chitin synthase II
          Length = 914

 Score = 29.3 bits (64), Expect = 7.9,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 11/62 (17%)

Query: 1   MRTRVEESWLTSFFFLLDLPIEKEPAIRVQQGHLMARLW-----------GSSFFLLRKH 49
           +RTR+   W+ S   L+   I+  P  R+  G+L+  LW           GS  FL  K+
Sbjct: 820 IRTRIVMIWMLSNLILIMSIIQAYPPERINNGYLIFILWSVAALAGFRAVGSISFLFMKY 879

Query: 50  SR 51
            R
Sbjct: 880 LR 881

>CAGL0L04884g Chr12 complement(559230..560045) [816 bp, 271 aa] {ON}
           similar to uniprot|P53271 Saccharomyces cerevisiae
           YGR120c SEC35 required for ER to golgi vesicle docking
          Length = 271

 Score = 28.9 bits (63), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 92  LETIENHLRDLTSEKMCRHKVTQKCELTYLKKISEVK 128
           L++  N LR LT ++M R + T +  L YL+K+ E+K
Sbjct: 121 LDSFMNQLRILTEKEMPRTQETVQDTLDYLEKLEEIK 157

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.138    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,325,149
Number of extensions: 715646
Number of successful extensions: 2157
Number of sequences better than 10.0: 11
Number of HSP's gapped: 2195
Number of HSP's successfully gapped: 11
Length of query: 207
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 103
Effective length of database: 41,556,135
Effective search space: 4280281905
Effective search space used: 4280281905
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 63 (28.9 bits)