Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E12915g5.698ON65465432750.0
SAKL0E14828g5.698ON59256921680.0
Kpol_529.285.698ON61056921650.0
TPHA0O02000singletonON62058720830.0
Suva_11.3295.698ON60158120620.0
NDAI0E050205.698ON61956520580.0
TPHA0N01960singletonON59151820370.0
ZYRO0G06688g5.698ON61357620350.0
YKR093W (PTR2)5.698ON60158120190.0
Smik_11.3565.698ON60257520020.0
KNAG0C065705.698ON59057719740.0
CAGL0G02453g5.698ON59756519570.0
TBLA0A091205.698ON63356519550.0
TDEL0B022305.698ON57452019430.0
NCAS0A032205.698ON61153319230.0
KAFR0H00230singletonON59656319160.0
KAFR0H002405.698ON59153119140.0
TBLA0B04710singletonON61551918960.0
TBLA0E01140singletonON61151018880.0
Skud_11.3315.698ON39937414530.0
Kwal_47.16930na 1ON6115646423e-74
KLTH0D16544gna 1ON6265966363e-73
Ecym_2823na 2ON6135546064e-69
AGL365Cna 2ON5995305872e-66
AFR228WsingletonON5765694922e-53
NDAI0F01930singletonON564114880.057
TBLA0F01600singletonON567114810.37
TBLA0B00840singletonON637210780.97
KLTH0G00198gna 3ON458114761.3
TBLA0A03700singletonON572205751.8
NDAI0F01940singletonON55186733.0
NCAS0I03160singletonON575222733.2
ZYRO0G18700g1.173ON591164733.6
YPL224C (MMT2)6.248ON48449715.4
SAKL0G19844gsingletonON572116699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E12915g
         (654 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...  1266   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   839   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   838   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   806   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...   798   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   797   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   789   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   788   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...   782   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...   775   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   764   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   758   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   757   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   753   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   745   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      742   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   741   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            734   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   731   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   564   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   251   3e-74
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   249   3e-73
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   238   4e-69
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   230   2e-66
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   194   2e-53
NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON}               39   0.057
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    36   0.37 
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    35   0.97 
KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to...    34   1.3  
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}               33   1.8  
NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON}               33   3.0  
NCAS0I03160 Chr9 (587668..589395) [1728 bp, 575 aa] {ON}               33   3.2  
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    33   3.6  
YPL224C Chr16 complement(126634..128088) [1455 bp, 484 aa] {ON} ...    32   5.4  
SAKL0G19844g Chr7 (1708176..1709894) [1719 bp, 572 aa] {ON} high...    31   9.7  

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score = 1266 bits (3275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/654 (95%), Positives = 625/654 (95%)

Query: 1   MSAAEKDFLTDDKISDDIIXXXXXXXXXXXXXSQALNVDSTVSSDDEFTGEKKDEKFKNN 60
           MSAAEKDFLTDDKISDDII             SQALNVDSTVSSDDEFTGEKKDEKFKNN
Sbjct: 1   MSAAEKDFLTDDKISDDIINNNNNNNNNNNNNSQALNVDSTVSSDDEFTGEKKDEKFKNN 60

Query: 61  TDIKVYISKDHHASSDKIDFIGAVDEDDNQNENGREPTEEELSTLRHVSERIPFTCWLIA 120
           TDIKVYISKDHHASSDKIDFIGAVDEDDNQNENGREPTEEELSTLRHVSERIPFTCWLIA
Sbjct: 61  TDIKVYISKDHHASSDKIDFIGAVDEDDNQNENGREPTEEELSTLRHVSERIPFTCWLIA 120

Query: 121 IVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFFQFWCYVTPLLGGY 180
           IVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFFQFWCYVTPLLGGY
Sbjct: 121 IVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFFQFWCYVTPLLGGY 180

Query: 181 LADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVSLIIIGIGTGFIKA 240
           LADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVSLIIIGIGTGFIKA
Sbjct: 181 LADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVSLIIIGIGTGFIKA 240

Query: 241 NLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSLSVMATTHLEA 300
           NLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSLSVMATTHLEA
Sbjct: 241 NLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSLSVMATTHLEA 300

Query: 301 SYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICWIGLCNGFNLNRAV 360
           SYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICWIGLCNGFNLNRAV
Sbjct: 301 SYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICWIGLCNGFNLNRAV 360

Query: 361 PSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQAGTMELHGLPN 420
           PSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQAGTMELHGLPN
Sbjct: 361 PSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQAGTMELHGLPN 420

Query: 421 DFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSSAMVYAAVLQHFIY 480
           DFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSSAMVYAAVLQHFIY
Sbjct: 421 DFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSSAMVYAAVLQHFIY 480

Query: 481 KAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGLEYAYSKAPATMKA 540
           KAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGLEYAYSKAPATMKA
Sbjct: 481 KAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGLEYAYSKAPATMKA 540

Query: 541 FIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLCFHHYNKDEEA 600
           FIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLCFHHYNKDEEA
Sbjct: 541 FIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLCFHHYNKDEEA 600

Query: 601 LNALDYKTEEQEQMLSGVGVTGEGAALYXXXXXXXXXXXXXXXXNLEHQLSRSA 654
           LNALDYKTEEQEQMLSGVGVTGEGAALY                NLEHQLSRSA
Sbjct: 601 LNALDYKTEEQEQMLSGVGVTGEGAALYSVSSVRSRVQQQQKQQNLEHQLSRSA 654

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/569 (70%), Positives = 478/569 (84%), Gaps = 9/569 (1%)

Query: 59  NNTDIKVYISKDHHASSDKI----DFIGAVDEDDNQN---ENGREPTEEELSTLRHVSER 111
           N T+ +V ++     S +KI     F+  +D++   N   ++GREPT+EE+ TLRHVSE+
Sbjct: 9   NKTETEVVVTSSPENSVEKIARPESFVDVLDKNQYINADSDHGREPTDEEMKTLRHVSEQ 68

Query: 112 IPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFFQFWC 171
           IP  CWL+A+VELAERFSYYGLSAPFQNYMQNGPNDTPKG+L LK+QGATALSYFFQFWC
Sbjct: 69  IPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALSYFFQFWC 128

Query: 172 YVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVSLIII 231
           YV+PLLGG++ADT+WGKY TICVG   YVVGI ILF+T++PSI   ++SLGGFI SLI+I
Sbjct: 129 YVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGFITSLILI 188

Query: 232 GIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSLS 291
           G+ TG IKAN+SVLIADQIPK+RP +KVLK+GE+VIEDPN+T+QN+FMFFYLMINIGSLS
Sbjct: 189 GLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLMINIGSLS 248

Query: 292 VMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICWIGLC 351
           V+ATT +EA  GFWAAYLL FCFF+V + VL+ GR +YV+ P+GD VI++ FK+CWI + 
Sbjct: 249 VIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFKVCWIVMR 308

Query: 352 NGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQAG 411
           N F  + A PSLNPE  YPW+D FIDEI+RA  ACKVF FYPIYWV YGQML+NFV+QAG
Sbjct: 309 NKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLSNFVSQAG 368

Query: 412 TMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSSAMVY 471
            MELHGLPNDFLQAI+SIALIVFIPI E+F+YPFIRRFTPFRP+TKIF GF FG+ AM +
Sbjct: 369 MMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIFGALAMAW 428

Query: 472 AAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGLEYAY 531
           AAVLQHFIYKAGPCY +PM+CAPEY NTPNR+HI WQVPAYVLI+ SEIFASITGLEYAY
Sbjct: 429 AAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASITGLEYAY 488

Query: 532 SKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLCF 591
           SKAP +M++FIMSIFL+T A GSALGIALS  + NPK+VWTFSGLAV+CFIAGCLFW  F
Sbjct: 489 SKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAGCLFWAFF 548

Query: 592 HHYNKDEEALNALDYKTEEQEQMLSGVGV 620
           H YN  EEA+NA+DY  EE + +  GV +
Sbjct: 549 HKYNDTEEAMNAIDY--EEDDVLNYGVSI 575

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  838 bits (2165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/569 (66%), Positives = 471/569 (82%), Gaps = 20/569 (3%)

Query: 49  TGEKKDEKFKNNTDIKVYISKDHHA------------SSDKIDFIGAVDEDD---NQNEN 93
           +GE +D+ F ++ D K    +DH              +SD+++ I  V +DD   + N++
Sbjct: 10  SGELEDDSFASHIDSK----QDHEVKIVSKFDSTSLQNSDQLE-ITKVGDDDIEYDDNQD 64

Query: 94  GREPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVL 153
             EPTEEE+ TL+HVS +IP  CWLIA+VEL+ERFSYYGL+APFQNYM NGPNDTPKGVL
Sbjct: 65  FVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVL 124

Query: 154 QLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPS 213
            L +QGA+ALSYFFQFWCY+TP+ GGY+ADT+WGKYNTIC G   YVVGI +LF+T++PS
Sbjct: 125 MLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPS 184

Query: 214 INDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVT 273
           I+ + ++LGG++ ++I+IGI TG IKAN+SVLIA+QIP+T+PR+   K G++VIEDPN+T
Sbjct: 185 IDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNIT 244

Query: 274 MQNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRP 333
            QNVFMFFY+MIN+GSLS+MATT LE+  GFWAAYLL FCFFW+ +VVLV GR +Y+  P
Sbjct: 245 TQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVP 304

Query: 334 IGDHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYP 393
           +GD +I++ FK+ WI + N  N + A PS+NPEK YPWND F++EIRRA +ACKVF FYP
Sbjct: 305 VGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYP 364

Query: 394 IYWVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFR 453
           IYW VYGQM+NNFVTQAGTMELH LPNDFLQA +SIA+IVFIPI E+FIYPF+RRFTPFR
Sbjct: 365 IYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFR 424

Query: 454 PVTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYV 513
           P+TKIF GF FGS AM++AAVLQ FIYKAGPCY+ PM CAPEYANTPN+VH+ WQVPAYV
Sbjct: 425 PITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYV 484

Query: 514 LISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTF 573
           LI++SEI AS+TGLEYAYS APA+MK+FIMSIFLVTNA GSA+GIA+SPTA++PKY WTF
Sbjct: 485 LIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTF 544

Query: 574 SGLAVACFIAGCLFWLCFHHYNKDEEALN 602
           +GLAVACFIAGCLFW+CF  YN  E+A+N
Sbjct: 545 TGLAVACFIAGCLFWICFRSYNNTEDAMN 573

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/587 (62%), Positives = 467/587 (79%), Gaps = 12/587 (2%)

Query: 45  DDEFTGEKKDEKFKN---NTDIKVYISKDHHASSDKIDFIGAVDEDDNQNENGR--EPTE 99
           D  ++GEK+ +   +   N D KV    ++  + +++D     DE D  N+     EPTE
Sbjct: 23  DAIYSGEKELDSSHDVTFNIDDKV----ENDTNEEELDEFAVDDEADPYNDEWGYVEPTE 78

Query: 100 EELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQG 159
           EE++TL+HV+  IP+ CWLIA+VEL+ERFSYYGLSAPFQNYM NGPNDTPKG+LQL + G
Sbjct: 79  EEMATLKHVAGHIPYRCWLIAVVELSERFSYYGLSAPFQNYMANGPNDTPKGILQLNTNG 138

Query: 160 ATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNS 219
           AT LSYFFQFWCY+TP+ GGY+ADT+W KYNTI VG   Y++GI ILF+TAIPSI  K +
Sbjct: 139 ATGLSYFFQFWCYITPIFGGYMADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIATKET 198

Query: 220 SLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFM 279
           + GGF+ ++I+IGIGTG IKANLSVL+A+QIPK + R+   K GE+VIEDP++TMQNVFM
Sbjct: 199 ATGGFVTAIILIGIGTGMIKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVFM 258

Query: 280 FFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVI 339
           FFYLMINIG+LSV+ATT LE+  GFWAAYLL FCFFW+ +V+LV GR  Y+ +P+GD VI
Sbjct: 259 FFYLMINIGALSVLATTELESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKVI 318

Query: 340 ARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVY 399
           ++CFK+ +I   N FN + A PSLNPE +YPW+D F+DEI R+ KACKVF FYPIYW VY
Sbjct: 319 SKCFKVTFIVCKNKFNFDSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCVY 378

Query: 400 GQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIF 459
           GQM+NNF+TQAGTMELH +PNDFLQ  +SI +IVFIPI E+F+YP IRRFTP +P+TKIF
Sbjct: 379 GQMINNFITQAGTMELHNIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKIF 438

Query: 460 IGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSE 519
           +GF  GS AMV+AAVLQ FIYKAGPCYD PM+C PEY N PNRVH+ WQ+PAYV+I+ SE
Sbjct: 439 LGFMCGSCAMVWAAVLQSFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWSE 498

Query: 520 IFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVA 579
           IFAS+TGLE+AYS AP +MKAFIMSIFL TNA+G+ALG+A+SPT+ +PKY W F+GLAV+
Sbjct: 499 IFASVTGLEFAYSNAPDSMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAVS 558

Query: 580 CFIAGCLFWLCFHHYNKDEEALNALDYKTEEQEQMLSGVGVTGEGAA 626
           CF+AGCLFW+CFHHYN  +  + A+D+    ++ M++  G   + A+
Sbjct: 559 CFVAGCLFWICFHHYNDIDADMKAIDFV---EDDMINASGDVEKTAS 602

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/581 (65%), Positives = 461/581 (79%), Gaps = 15/581 (2%)

Query: 36  LNVDSTVSSD--DEFTGE---KKDEKFKNNTDIKVYISKDHHASSDKIDFIGAVDEDDNQ 90
           LN  S  S D  DE  GE    ++EK +  T    Y+S D   S+++ +   +   +DN+
Sbjct: 2   LNHLSQGSDDIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNL--SPSPEDNE 59

Query: 91  NENGREPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPK 150
            E    PT+EEL +LRHV  +IP  CWLIAIVEL+ERFSYYGLSAPFQNYM+ GPNDTPK
Sbjct: 60  FE---APTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPK 116

Query: 151 GVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTA 210
           G+L L S GAT LSYFFQFWCYVTP+ GGY+ADTFWGKYNTIC G + Y+ GI ILF+T+
Sbjct: 117 GMLSLNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITS 176

Query: 211 IPSINDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDP 270
           IPS+ +++S+LGGFI S+I+IGI TG IKANLSVLIADQ+PK +P IKVLK+GE+VIED 
Sbjct: 177 IPSVGNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDG 236

Query: 271 NVTMQNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYV 330
           N+T+QNVFMFFY MIN+GSLS+MATT LE   GFWAAYLL FCFFWV +V LVFG+K+Y+
Sbjct: 237 NITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYI 296

Query: 331 RRPIGDHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFA 390
           +RPIGD VIA+ FK+CWI   N F+ N A PS++PEK+YPWND F+DEI+RA  ACKVF 
Sbjct: 297 QRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFV 356

Query: 391 FYPIYWVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFT 450
           FYPIYW  YG M+++F+TQA  MELHG+PNDFLQA +SIALI+FIPI E+F YPFIRR+T
Sbjct: 357 FYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYT 416

Query: 451 PFRPVTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVP 510
           PF+P+TKIF GF FGS AM +AAVLQ F+YKAGP Y  P+       NTPN VH+ WQ+P
Sbjct: 417 PFKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLG-----HNTPNHVHVCWQIP 471

Query: 511 AYVLISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYV 570
           AYVLIS SEIFASITGLEYAYSKAPA MK+FIMSIFL+TNA GSA+G ALSP   +PK+ 
Sbjct: 472 AYVLISFSEIFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFT 531

Query: 571 WTFSGLAVACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQ 611
           W F+GLAVACFI+GCLFWLCF  YN  EE +NA+DY+ E++
Sbjct: 532 WLFTGLAVACFISGCLFWLCFRKYNDTEEEMNAMDYEEEDE 572

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/565 (65%), Positives = 447/565 (79%), Gaps = 6/565 (1%)

Query: 49  TGEKKDEKFKNNTDIKVYISKDHHASSDKIDFIGAVDEDDNQNENGREPTEEELSTLRHV 108
           T +K+     ++T+ K++  + ++ S+   D     D DD   E   EPT+EEL+TL+ V
Sbjct: 28  TTKKETNATTSSTEEKLHDVETYNLSNSANDSTNDFD-DDEMEEGYEEPTDEELNTLKRV 86

Query: 109 SERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFFQ 168
             +IP  CWLI +VELAERFSYYGLSAPFQNYMQNGPND+PKGVL L S GAT LSYFFQ
Sbjct: 87  GGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLSYFFQ 146

Query: 169 FWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVSL 228
           FWCYVTP+ GG++ADT+WGKYN+I VG  FY+VGI ILF+TAIPSI  +N+SLGGFIVS+
Sbjct: 147 FWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGFIVSI 206

Query: 229 IIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIG 288
           I+IGIGTGFIKANLSVLIADQ+PK +PR+K+LK+GE+VIEDPN+T+QNVFM FYLMINIG
Sbjct: 207 ILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLMINIG 266

Query: 289 SLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICWI 348
           S+SVMATT LE+  GFWAAYLL FCFFW+ +V+LVFGRK YV+  +GD+V+ + FK+CWI
Sbjct: 267 SMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFKVCWI 326

Query: 349 GLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVT 408
              N  + N A PS +PE+ YPWND F+DE++R   ACKVF FYPIYWV YG M++ FVT
Sbjct: 327 VAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMISTFVT 386

Query: 409 QAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSSA 468
           Q  TMELHG+PNDFLQ  +SIALI+FIPI E F+YPFIRRFTP RP+TKI IGF  G  A
Sbjct: 387 QGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFVGGCA 446

Query: 469 MVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGLE 528
           M +AAVLQHFIY  GPCYD P+SC     +TPN++H+ WQ+PAYVLI+ SEIFASITGLE
Sbjct: 447 MTWAAVLQHFIYNTGPCYDHPLSC-----DTPNKIHVAWQIPAYVLIAFSEIFASITGLE 501

Query: 529 YAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFW 588
           YAYSKAP +MK+F+MSIFL+TNA GS LGIALS    +PK+VW F GLAV+C + G LFW
Sbjct: 502 YAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFW 561

Query: 589 LCFHHYNKDEEALNALDYKTEEQEQ 613
           LCF   N  EE +NA+DY  E  EQ
Sbjct: 562 LCFRGLNATEEEMNAMDYDAEIDEQ 586

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/518 (70%), Positives = 436/518 (84%)

Query: 97  PTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLK 156
           PTEEEL TLRHVS  IP  CWLIAIVELAERFSYYGLSAPFQNYM NGPNDTPKG+LQL 
Sbjct: 57  PTEEELKTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGLLQLN 116

Query: 157 SQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSIND 216
           S GATA+SYFFQFWCYVTP+ GGY+ADT WGKYNTIC G   YV GI ILFMT+I SI  
Sbjct: 117 SSGATAISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIESITT 176

Query: 217 KNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQN 276
           +N++ GG+I ++I+IGI TG IK+N+SVLIA+Q+PK + R+     GE+VIEDP +T+QN
Sbjct: 177 QNAARGGYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKLTVQN 236

Query: 277 VFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGD 336
           +FMFFYLMINIGSLSV+ATT LEA  GFWAAYLL FCFFW+ +VVL+ G+K+YVR+P+GD
Sbjct: 237 IFMFFYLMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRKPVGD 296

Query: 337 HVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYW 396
            VI++CF I WI   N  + + A PS +PE  YPW D F++E+RRA +ACKVF FYPIYW
Sbjct: 297 KVISKCFTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFYPIYW 356

Query: 397 VVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVT 456
            VYGQMLNNFVTQAGTMELHGLPNDFLQAI+SIA+IVFIPI E+F+YPFIR+FTPFR +T
Sbjct: 357 CVYGQMLNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPFRSIT 416

Query: 457 KIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLIS 516
           KIF GF FGS+AM++AAVLQ FIYKAGPC+D P++CA +YA+TPN+VHI WQVPAYVLI+
Sbjct: 417 KIFWGFMFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAYVLIA 476

Query: 517 LSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGL 576
            SEIFASITGLEYAYS AP +MK+FIMSIFL+T A GSALGIA+SPT+ +PK+ W F+GL
Sbjct: 477 FSEIFASITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWAFTGL 536

Query: 577 AVACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQEQM 614
           AV+CFIAGCLFW+CF  YN  E++++ +D+  E+   M
Sbjct: 537 AVSCFIAGCLFWICFRKYNNTEDSMDEIDFIDEKVTDM 574

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/576 (64%), Positives = 453/576 (78%), Gaps = 15/576 (2%)

Query: 43  SSDDEFTGEKKDEKFKNNTDIKVYISKDHHASSDKIDFIGAVDEDDNQNENGREPTEEEL 102
           S+    TG +K++    +  ++V  S +           G +D D+ +  N  EPTEEEL
Sbjct: 3   SASPSITGPEKNKVIIEDKSLEVSGSHER----------GELDFDEYEVPNDDEPTEEEL 52

Query: 103 STLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATA 162
            +LRHV   IPF CWLIAIVEL+ERFSYYGLSAPFQNYMQNG +D P GVL LKSQGAT 
Sbjct: 53  RSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATG 112

Query: 163 LSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLG 222
           L+YFFQFWCYVTP+ GG+LADT+WGKY TICVG   YVVGI ILF+T++PS++ KN++LG
Sbjct: 113 LAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALG 172

Query: 223 GFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFY 282
           GFI ++++IGI TG IKANLSVLIADQ PK +PRIK  K GE+VIEDPN+T+QNVFMFFY
Sbjct: 173 GFITAIVLIGIATGMIKANLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFY 232

Query: 283 LMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARC 342
           LMINIGSLSV+ATT LE   GFWAAYLL FCFFW+ ++VL  GRK YVR P+GD VIA+ 
Sbjct: 233 LMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKS 292

Query: 343 FKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQM 402
           F++    + + F+     PS++PE++YPWND F++EI+RA KACKVF FYPIYWV YGQM
Sbjct: 293 FRVLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQM 352

Query: 403 LNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGF 462
            + FV+  G M+LHGLPNDF QAI+SIALIVFIPI E ++YPFIRR+TPF+P+TKIF GF
Sbjct: 353 TSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGF 412

Query: 463 CFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFA 522
            + S++M++AAVLQHFIYK GPCYD PM C     N PN +HIGWQVPAYVLI+ SEIFA
Sbjct: 413 MWCSASMIWAAVLQHFIYKTGPCYDHPMDC----PNGPNNIHIGWQVPAYVLIAFSEIFA 468

Query: 523 SITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFI 582
           SITGLEYAYSKAP +MK+FIMSIFL+TNA GSA+G ALSP   +PKY+W F+GLAVA FI
Sbjct: 469 SITGLEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFI 528

Query: 583 AGCLFWLCFHHYNKDEEALNALDYKTEEQEQMLSGV 618
           +GCLFWL FHH N  EE +NA+DY+ E QE++  G+
Sbjct: 529 SGCLFWLTFHHLNDTEEEMNAMDYE-ENQEKIDDGL 563

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/581 (64%), Positives = 462/581 (79%), Gaps = 15/581 (2%)

Query: 36  LNVDSTVSSD--DEFTGE---KKDEKFKNNTDIKVYISKDHHASSDKIDFIGAVDEDDNQ 90
           LN  S  S D  DE  G+    ++EK +  T    Y+S D   S+++ +   + +++D +
Sbjct: 2   LNHPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSPEDEDFE 61

Query: 91  NENGREPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPK 150
                 PTEEE+ TLRHV  +IP  CWLIAIVEL+ERFSYYGLSAPFQNYM+ GPND+PK
Sbjct: 62  G-----PTEEEMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPK 116

Query: 151 GVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTA 210
           GVL L SQGAT LSYFFQFWCYVTP+ GGY+ADTFWGKYNTIC G + Y+ GI ILF+T+
Sbjct: 117 GVLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITS 176

Query: 211 IPSINDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDP 270
           IPS+ +++S++GGFI ++I+IGI TG IKANLSVLIADQ+PK +P IKVLK+GE+VI D 
Sbjct: 177 IPSVGNRDSAIGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDS 236

Query: 271 NVTMQNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYV 330
           N+T+QNVFMFFY MIN+GSLS+MATT LE   GFWAAYLL FCFFW+ +V L+FG+K+Y+
Sbjct: 237 NITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYI 296

Query: 331 RRPIGDHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFA 390
           +RPIGD VIA+ FK+CWI   N F+ N A PS++PEK YPWND F+DEI+RA  ACKVF 
Sbjct: 297 QRPIGDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFI 356

Query: 391 FYPIYWVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFT 450
           FYPIYW  YG M+++F+TQA  MELHG+PNDFLQA +SIALI+FIPI E+F+YPFIRR+T
Sbjct: 357 FYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYT 416

Query: 451 PFRPVTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVP 510
           P +P+TKIF GF FGS AM +AAVLQ F+YKAGP Y+ P+       NTPN VH+ WQ+P
Sbjct: 417 PLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLG-----HNTPNHVHVCWQIP 471

Query: 511 AYVLISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYV 570
           AYVLIS SEIFASITGLEYAYSKAPA+MK+FIMSIFL+TNA GSA+G ALSP   +PK+ 
Sbjct: 472 AYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFT 531

Query: 571 WTFSGLAVACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQ 611
           W F+GLAVACFI+GCLFWLCF  YN  EE +NA+DY+ E++
Sbjct: 532 WLFTGLAVACFISGCLFWLCFRKYNDTEEEMNAMDYEEEDE 572

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/575 (63%), Positives = 456/575 (79%), Gaps = 17/575 (2%)

Query: 44  SDDEFTGEKK-------DEKFKNNTDIKVYISKDHHASSDKIDFIGAVDEDDNQNENGRE 96
           S DE   EK+       +EK    T    Y+S D   S+++ +   + +++D +      
Sbjct: 8   SSDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSPEDEDFE-----A 62

Query: 97  PTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLK 156
           PTEEE  TLRHV  +IP  CWLIAIVEL+ERFSYYGLSAPFQNYM+ GPND+PKGVL L 
Sbjct: 63  PTEEETKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLN 122

Query: 157 SQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSIND 216
           SQGAT LSYFFQFWCYVTP+ GGY+ADTFWGKYNTIC G + Y+ GI ILF+T+IPS+ +
Sbjct: 123 SQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGN 182

Query: 217 KNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQN 276
           ++S++GGFI ++I+IGI TG IKAN+SVLIADQ+PK +P IKVLK+GE+VI D N+T+QN
Sbjct: 183 RDSAIGGFIAAIILIGIATGMIKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQN 242

Query: 277 VFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGD 336
           VFMFFY MIN+GSLS+MATT LE   GFWAAYLL FCFFW+ +V L+FG+K+Y++RPIGD
Sbjct: 243 VFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGD 302

Query: 337 HVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYW 396
            V+A+ F++CWI   N F+ N A PS++PE+ YPWND F+DEI+RA  ACKVF FYPIYW
Sbjct: 303 KVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYW 362

Query: 397 VVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVT 456
             YG M+++F+TQA  MELHG+PNDFLQA +SIALIVFIPI E+F+YPFIRR+TP +P+T
Sbjct: 363 TQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPIT 422

Query: 457 KIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLIS 516
           KIF GF FGS AM +AAVLQ F+YKAGP Y+ P+       NTPN +H+ WQ+PAYVLIS
Sbjct: 423 KIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLG-----HNTPNHIHVCWQIPAYVLIS 477

Query: 517 LSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGL 576
            SEIFASITGLEYAYSKAPA+MK+FIMSIFL+TNA GSA+G ALSP   +PK+ W F+GL
Sbjct: 478 FSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGL 537

Query: 577 AVACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQ 611
           AVACFI+GCLFWLCF  YN  EE +NA+DY+ +++
Sbjct: 538 AVACFISGCLFWLCFRKYNDTEEEMNAMDYEEDDE 572

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/577 (62%), Positives = 438/577 (75%), Gaps = 10/577 (1%)

Query: 53  KDEKFKNNTDIKVYISKDHHASSDK--IDFIGAVDEDDNQNENGREPTEEELSTLRHVSE 110
           +D+      D+ +     H    D   +D + +  EDD   E    PTEEEL TL+HV  
Sbjct: 11  EDDSLDKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIP-EGYEVPTEEELRTLKHVGG 69

Query: 111 RIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFFQFW 170
            IP  CWLIA+VEL+ERFSYYGLSAPFQNYM NGP+D P G+LQL S GAT LSYFFQFW
Sbjct: 70  HIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFW 129

Query: 171 CYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVSLII 230
           CYVTP+ GGY+ADT WGKYNTI VG   Y+ GI ILFMT+IPSI  KN+ LGGFIV++I+
Sbjct: 130 CYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIIL 189

Query: 231 IGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSL 290
           IGI TG IK+NLSVLIADQ+PK +P +K  KNGE+VIED N+T+QNVFMFFYLMINIGSL
Sbjct: 190 IGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSL 249

Query: 291 SVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICWIGL 350
           SV+AT+ LE   GFWAAYLL FCFFW+ +VVLV G+ +YV+ PIGD VI++CFK+ WI  
Sbjct: 250 SVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILT 309

Query: 351 CNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQA 410
            N FN +   PSLNP K YPW+D F+DEI+RA  ACKVF FYPIYW  YGQM++ FVTQ 
Sbjct: 310 KNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQG 369

Query: 411 GTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSSAMV 470
             MELHGLPNDF Q I+SIA+IVFIP+ E  +YPFIR++TPFRP+TKI+ GF F S  M+
Sbjct: 370 SMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGCMI 429

Query: 471 YAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGLEYA 530
           +AAVLQ +IYKAGP Y +P+       + PNR+H+  QVPAYVL++ SEIFASITGLEYA
Sbjct: 430 WAAVLQSYIYKAGPHYKWPLE-----HDGPNRIHVALQVPAYVLLAFSEIFASITGLEYA 484

Query: 531 YSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLC 590
           YSKAPA+MK+FIMSIFLVTNA GSA+G ALSP +++P + W ++GLAVACFI+GCLFW+C
Sbjct: 485 YSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVC 544

Query: 591 FHHYNKDEEALNALDYKTEEQEQMLSGVGVTGEGAAL 627
           F  YN  EE +NA+DY  E    ML  V +  +  AL
Sbjct: 545 FRKYNDIEEEMNAMDY--EVDATMLKKVPIETDTVAL 579

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/565 (64%), Positives = 443/565 (78%), Gaps = 14/565 (2%)

Query: 51  EKKDEKFKNNTDIKVYISKD---HHASSDKIDFIG--AVDEDDNQNENGREPTEEELSTL 105
           +K      +N+  +VY  +D   HH   DK +     A+ EDD+       PTEEEL TL
Sbjct: 18  QKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDDD----FEAPTEEELKTL 73

Query: 106 RHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSY 165
           RHV+  IP  CWLIAIVEL+ERFSYYGLSAPFQNYMQNGPND PKG+L LKSQGAT LSY
Sbjct: 74  RHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGATGLSY 133

Query: 166 FFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFI 225
           FFQFWCYVTP+ GG+++DT+WGKYNTICVG   YV GI ILF+T+IP + + + +LGGFI
Sbjct: 134 FFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNSDGALGGFI 193

Query: 226 VSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMI 285
            ++I+IGI TG IK+NLSVLIADQ+P  +PR+ + K GE+VIEDPN+T+QNVFMFFY  I
Sbjct: 194 AAIILIGIATGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTI 253

Query: 286 NIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKI 345
           N+GSLSVMATT LE   GFWAAYLL FCFFWV + VLVFGR +Y++ P+GD VI++ FK+
Sbjct: 254 NVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFKV 313

Query: 346 CWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNN 405
            +I   N FN   A PS NP+K +PW+D F+DEI+RA +ACKVF FYP+YWV YG MLNN
Sbjct: 314 LYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLNN 373

Query: 406 FVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFG 465
           FVTQ GTMELH LPNDFLQA +SIALI+FIPI E+F+YPFIRR+TP RP+TKIF GF  G
Sbjct: 374 FVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMVG 433

Query: 466 SSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASIT 525
           S AMV+AAVLQHFIY  GP YD P+       +TPN +H+ WQ+PAYVLI++SEIFASIT
Sbjct: 434 SGAMVWAAVLQHFIYTKGPWYDHPLD-----HDTPNHIHVAWQIPAYVLIAISEIFASIT 488

Query: 526 GLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGC 585
           GLEYAYSKAP +MK+FIMSIFL+TNA GSA+G ALSP + +PK+VW ++GLA ACFIAG 
Sbjct: 489 GLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGW 548

Query: 586 LFWLCFHHYNKDEEALNALDYKTEE 610
           +FW  +   N +EEA+NALDY+ +E
Sbjct: 549 VFWFIYSGLNDEEEAMNALDYEHDE 573

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/565 (63%), Positives = 442/565 (78%), Gaps = 22/565 (3%)

Query: 51  EKKDEKFKNNTDIKVYISKDHHASSDKIDFIGAVDEDDNQNENGREPTEEELSTLRHVSE 110
           EK+D+KF+   +    I+                DE++   E+  EPTEEEL TL+HV  
Sbjct: 53  EKRDQKFETFQEDSSIIN----------------DENEVITEDFEEPTEEELRTLKHVGG 96

Query: 111 RIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFFQFW 170
           +IP  CWL+A++ELAERFSYYGLSAPFQNYMQNGPND+P G L L S GAT LSYFFQFW
Sbjct: 97  KIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLSYFFQFW 156

Query: 171 CYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVSLII 230
           CY+TP+  GY+ADT+WGK+ TIC+G   Y+VGI ILF+T++PSI   N+++GGFIV+LI+
Sbjct: 157 CYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGFIVTLIL 216

Query: 231 IGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSL 290
           +GI TG IKANLSV+IA+QIPK + R+   KNG +VIEDP++T+QNVFM FY MINIGSL
Sbjct: 217 VGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFMINIGSL 276

Query: 291 SVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICWIGL 350
           SV+ATT LEA  GFWAAYLL FCFFWV ++VL+ G K Y++ P+GD VI++CFK+  I +
Sbjct: 277 SVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFKVLRILM 336

Query: 351 CNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQA 410
            N FN + A P+ NP+K YPW+D F+DEI RA +ACKVF FYPIYWV YGQMLNNFV+Q 
Sbjct: 337 RNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQG 396

Query: 411 GTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSSAMV 470
           GTMELHGLPNDF QAI+SIALIVFIPI E+F+YPFIR++TPF+P+TKIF GF FG+ +M 
Sbjct: 397 GTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTFGALSMT 456

Query: 471 YAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGLEYA 530
           +A VLQHFIYKA PCYD P  C     N PN +H+  QVPAY L++LSEIFASITGLEYA
Sbjct: 457 WACVLQHFIYKAAPCYDHPSKC----DNGPNHIHVALQVPAYCLLALSEIFASITGLEYA 512

Query: 531 YSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLC 590
           YSKAPA+MKAFIMSIFLVTNA G+A+G ALSP +++PKYVW + GLAVACF+ GCLFW+ 
Sbjct: 513 YSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFWII 572

Query: 591 FHHYNKDEEALNALDYKTEEQEQML 615
           F  YN  EE LN LD+  EE + ML
Sbjct: 573 FKKYNDMEEELNNLDF--EEGDDML 595

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/520 (68%), Positives = 425/520 (81%), Gaps = 7/520 (1%)

Query: 96  EPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQL 155
           EPTEEE+ TL+HV+  IPF CWLIA+VEL+ERF+YYGLS PFQNYMQNGP+DTP G+L L
Sbjct: 46  EPTEEEMKTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNL 105

Query: 156 KSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSIN 215
           KSQGAT LSYFFQFWCYVTP+ GG+L+DT+ GKYNTIC G   YV+GILILF+T+IPSI 
Sbjct: 106 KSQGATGLSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSIT 165

Query: 216 DKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQ 275
            +N++ GGFI ++I+IGI TG IK+N+SVLIADQ PK R R+   K+G +VIEDPN+T+Q
Sbjct: 166 TQNAATGGFIAAIILIGIATGMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQ 225

Query: 276 NVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIG 335
           NVFM FYLMINIGSLSV+ATT LEA  GFWAAYLL FCFFW+ ++VL  G+  YV+ P+G
Sbjct: 226 NVFMIFYLMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVG 285

Query: 336 DHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIY 395
           D VI++CFK+  I + N FN   A PS++P++ +PW D F+DEI R+  ACKVF FYP+Y
Sbjct: 286 DKVISKCFKVVGIAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVY 345

Query: 396 WVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPV 455
           WV YGQMLN FV+  GTMELHGLPNDF QAI+SIALIVFIPI E F+YP+IR+FTPFRP+
Sbjct: 346 WVCYGQMLNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPI 405

Query: 456 TKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLI 515
           TKIF GF FG++AMV+AAVLQHFIYK+GP Y +PM+      NTPN +HI WQVPAYVLI
Sbjct: 406 TKIFWGFMFGAAAMVWAAVLQHFIYKSGPWYKYPMA-----ENTPNHIHIAWQVPAYVLI 460

Query: 516 SLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSG 575
           + SEIFASITGLEYAYSKAP TMK+FIM+IFL+TNA GSA+G ALSP  ++P YVW + G
Sbjct: 461 AFSEIFASITGLEYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVG 520

Query: 576 LAVACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQEQML 615
           L VACF AG LFW CF HYN  EEA+NALDY  +E   ML
Sbjct: 521 LGVACFAAGWLFWFCFKHYNDTEEAMNALDY--DEDPTML 558

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/533 (65%), Positives = 422/533 (79%), Gaps = 6/533 (1%)

Query: 88  DNQNENGRE-PTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPN 146
           D + E G E PTEE++ TLRHVS +IP  CWLIA+VELAERFSYYGLSAPFQNYM+NGPN
Sbjct: 58  DEECEPGYEIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPN 117

Query: 147 DTPKGVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILIL 206
           DTP GVL+L S GAT LSYFFQFWCYVTP+ GG++ADT+WGKYNTICVG   Y+ GI IL
Sbjct: 118 DTPAGVLELNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFIL 177

Query: 207 FMTAIPSINDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKV 266
           F+T+IPSI  K++SLGGFI ++I+IGI TG IKANLSVLIADQ+PK +PR+K LK+GE+V
Sbjct: 178 FITSIPSIASKDTSLGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPRVKTLKSGERV 237

Query: 267 IEDPNVTMQNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGR 326
           +EDPN+T+QNVFM+FYLM+N+GSLSV+ATT LE    FWAA+LL FCFFW+ +VVLV GR
Sbjct: 238 VEDPNITLQNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGR 297

Query: 327 KKYVRRPIGDHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKAC 386
            +YV+    +  I + FKI WI   N F+L  A PS +PEK YPW D F+DE  RA  AC
Sbjct: 298 NQYVKEGKREKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSAC 357

Query: 387 KVFAFYPIYWVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFI 446
           KVF FYPIYWV+YG M++ FVTQ   MELHGLPND  QAI+S ALI+FIPI E+FIYPFI
Sbjct: 358 KVFLFYPIYWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFI 417

Query: 447 RRFTPFRPVTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIG 506
           RRFTPF+P+TKIF GF F + AMV++ VLQ FIYKAGP YD P++        PNR+H+G
Sbjct: 418 RRFTPFKPITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLN-----GGGPNRIHVG 472

Query: 507 WQVPAYVLISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAEN 566
           WQVPAYVLI+ SEI ASITGLEYAYSKAP +MK+FIMS+FL +NA GS LGIALSP + +
Sbjct: 473 WQVPAYVLIAFSEILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVD 532

Query: 567 PKYVWTFSGLAVACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQEQMLSGVG 619
           PK+ W F GL VACFI GC+FW+ F  YN  EE +NA+DY+ EE  + +   G
Sbjct: 533 PKFTWLFGGLGVACFIGGCIFWIIFRKYNDTEEEMNAMDYEDEEDLREMESAG 585

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/563 (63%), Positives = 427/563 (75%), Gaps = 20/563 (3%)

Query: 58  KNNTDIKVYISKDHHASSDKI-DFIGAVDEDDNQ--------NENGRE-PTEEELSTLRH 107
           KNN D+K    K   +S D+I D      ++DN+         E G E PTEEEL TLRH
Sbjct: 20  KNNIDLK----KTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRH 75

Query: 108 VSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFF 167
           VS RIPF C+LIA+VEL+ERFSYYGLSAPFQNYM N P+D+P GVLQL S GAT LSYFF
Sbjct: 76  VSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFF 135

Query: 168 QFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVS 227
           QFWCY+TP+LGGYLADT WG+YNTI VG   Y+VGI +LF+T+  SI  KN +LGGFIV+
Sbjct: 136 QFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVA 195

Query: 228 LIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINI 287
           LI+IGIGTGFIKANLSVLIADQIP  RPR+K LK+GE+VIED ++T+QNVFMFFYLMINI
Sbjct: 196 LILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINI 255

Query: 288 GSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICW 347
           GSLSV+ATT LE   GFWAAYLL FCFFW+ ++VLV GR+ Y  +P  D VI + FK CW
Sbjct: 256 GSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCW 315

Query: 348 IGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFV 407
               N FN +   P+ NPE  + W+D F++EIR A  ACKVF FYPIYW  YGQM NNFV
Sbjct: 316 ALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFV 375

Query: 408 TQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSS 467
           T    ++LHGLPND  QAI+SIALIVFIPI E+F YPFIRRFTPFRP+TKI  GF   S+
Sbjct: 376 TMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASA 435

Query: 468 AMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGL 527
           +MV+A VLQ+FIYK GP Y  P+      A+ PN VH+ WQVPAYVLI+ SEIFASITGL
Sbjct: 436 SMVWACVLQYFIYKTGPNYKHPL------ADGPNNVHVAWQVPAYVLIAFSEIFASITGL 489

Query: 528 EYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLF 587
           EYAYSKAPA+MK+FIM++FL  NA GSA+G ALSP +++P Y W + GLAV  FI GC F
Sbjct: 490 EYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAF 549

Query: 588 WLCFHHYNKDEEALNALDYKTEE 610
           W CF HYN  E+ +NAL+Y+ E+
Sbjct: 550 WFCFRHYNDIEDEMNALNYEDED 572

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/531 (63%), Positives = 419/531 (78%), Gaps = 6/531 (1%)

Query: 85  DEDDNQNENGREPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNG 144
           D +D Q E    PT++E+ TLR V  RIPF C+L+A+VELAERFSYYGLSAPFQNYMQNG
Sbjct: 53  DHEDYQEEGYEIPTQDEMKTLRRVGGRIPFRCFLVALVELAERFSYYGLSAPFQNYMQNG 112

Query: 145 PNDTPKGVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGIL 204
           P D+P GVLQL S GAT LSYFFQFWCY+TP+ GGYLADT WG+YNTI VG   Y++GI 
Sbjct: 113 PTDSPPGVLQLNSSGATGLSYFFQFWCYITPIFGGYLADTKWGRYNTIGVGTVIYIIGIF 172

Query: 205 ILFMTAIPSINDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGE 264
           ILF+T+  ++  ++ +L GFI++LI+IG  TG IK+NLSVLIADQIP  RPR+K LK+GE
Sbjct: 173 ILFITSFKTVAGRDGALAGFILALILIGFATGLIKSNLSVLIADQIPAKRPRVKTLKSGE 232

Query: 265 KVIEDPNVTMQNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVF 324
           +VIED +VT+QNVFMFFYLMINIGSLSV+ATT LE + GFWAAYLL FCFFW+ ++V+V 
Sbjct: 233 RVIEDHDVTIQNVFMFFYLMINIGSLSVIATTELELNVGFWAAYLLPFCFFWIAVIVIVA 292

Query: 325 GRKKYVRRPIGDHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFK 384
           G+++Y+ +P GD VIA+ FK+CWI   N F++  A PS +PE E+PW D F+DEI+RA  
Sbjct: 293 GKRQYIIKPTGDRVIAKSFKVCWILCKNKFDITSAKPSYHPESEFPWEDKFVDEIQRALA 352

Query: 385 ACKVFAFYPIYWVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYP 444
           ACKVF FYPIYW  YGQM+NNF+T    M+LHGLPND  QAINSI+LI+FIPI E+F+YP
Sbjct: 353 ACKVFLFYPIYWTCYGQMVNNFITMGSMMQLHGLPNDIFQAINSISLIIFIPICEKFLYP 412

Query: 445 FIRRFTPFRPVTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVH 504
           FIRRFTP RPVT+IF GF F + AMV++ VLQHFIY  GP Y+ P+          N +H
Sbjct: 413 FIRRFTPLRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTGPNYNRPLELG------ANDIH 466

Query: 505 IGWQVPAYVLISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTA 564
           +GWQVPAYV I+ SEIFASITGLEYAYSKAPA MK+FIM++FL  NA GSA+G ALSP +
Sbjct: 467 VGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKSFIMALFLFMNAFGSAIGCALSPVS 526

Query: 565 ENPKYVWTFSGLAVACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQEQML 615
           ++P Y W +  LAVACF++G +FWLCF  YNK E+ +NALD+   E++++L
Sbjct: 527 KDPDYTWLYGSLAVACFLSGLIFWLCFRKYNKIEDEMNALDFTDSEEDEIL 577

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/519 (66%), Positives = 424/519 (81%), Gaps = 5/519 (0%)

Query: 96  EPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQL 155
           EPTEEEL TL   +  IPF CWL+AI+ELAERFSYYGLSAPFQNYMQN P+D P G L L
Sbjct: 66  EPTEEELKTLPREAGHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALSL 125

Query: 156 KSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSIN 215
            S GAT LSYFFQFWCYVTP+  G++ADT+WGK+NT+C+G   Y++GI ILF+T++P+I 
Sbjct: 126 NSTGATGLSYFFQFWCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAIT 185

Query: 216 DKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLK-NGEKVIEDPNVTM 274
             N++LGGFIV++I+IGI TG IKANLSV+IADQ+PK + R+   K +G++VIEDP +T+
Sbjct: 186 SYNTALGGFIVAIILIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTI 245

Query: 275 QNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPI 334
           QNVFM FY MIN+GSLSV+ATT LE   GFWAAYLL FCFFW+ ++VL FG +K+V++PI
Sbjct: 246 QNVFMAFYFMINVGSLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPI 305

Query: 335 GDHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPI 394
           GD VI++CF I  I + N FN  +A P+ NPEK YPW+D F+DEI+R+ KACKVF FYPI
Sbjct: 306 GDRVISKCFTIIGILIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPI 365

Query: 395 YWVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRP 454
           YWV YGQMLNNFVTQ  TM+LHGLPNDF QAINSIALIVFIPI+E+F+YPFIR+FTP +P
Sbjct: 366 YWVCYGQMLNNFVTQGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKP 425

Query: 455 VTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVL 514
           +TK+ IGF FGS AMV+AAVLQHFIY+AGPCYD P+ C     N PN VH+ WQVPAY L
Sbjct: 426 ITKVTIGFVFGSLAMVWAAVLQHFIYQAGPCYDHPVKC----PNGPNHVHVAWQVPAYCL 481

Query: 515 ISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFS 574
           ISLSEIFASITGLE AYSKAP +MK+FIMS+FLVTNA G+A+G ALS  +E+PKYVW ++
Sbjct: 482 ISLSEIFASITGLEIAYSKAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYT 541

Query: 575 GLAVACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQEQ 613
           GLAV CF AG  FW  F HYN +E+A+N +D++++ + +
Sbjct: 542 GLAVTCFCAGIAFWFTFKHYNDEEDAMNNIDFESDNENE 580

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/510 (66%), Positives = 409/510 (80%), Gaps = 4/510 (0%)

Query: 96  EPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQL 155
           EPTEEE+ TL+ V   IP  CWL+A++EL+ERFSYYGLSAPFQNYMQNGP DTP G L L
Sbjct: 70  EPTEEEMRTLKRVGGYIPARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSL 129

Query: 156 KSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSIN 215
            +QGAT LSYFFQFWCY+TP+ GGY+ADT+WGKYNTI VG   Y+ GI ILFMT++P + 
Sbjct: 130 NTQGATGLSYFFQFWCYITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLT 189

Query: 216 DKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQ 275
             ++++GGFIVS+IIIG+GTG IKANLSV+IA+Q+PK + RI   K+G +VIEDP++T+Q
Sbjct: 190 SYSAAMGGFIVSIIIIGLGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQ 249

Query: 276 NVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIG 335
           NVFM FY MIN+GSLSVMATT LEA  GFWAAYLL FCFFWV +VVL+ G K++++ PIG
Sbjct: 250 NVFMAFYFMINVGSLSVMATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIG 309

Query: 336 DHVIARCFKICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIY 395
           D  I++ FK+  I + N FN   A PS++PE  YPW D F++EIRRA KAC VF FYPIY
Sbjct: 310 DKTISKSFKVVGILIKNKFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIY 369

Query: 396 WVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPV 455
           WV YGQMLNNFVTQ G MELH LPNDFLQ I+SIALIVFIPI E+ IYPF+RRFTP RP+
Sbjct: 370 WVCYGQMLNNFVTQGGQMELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPI 429

Query: 456 TKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLI 515
           TKI IGF FGS +MV+AAVLQ F+Y+  PCY  P +C     N PN +H+ WQVPAY LI
Sbjct: 430 TKITIGFFFGSFSMVWAAVLQWFVYQKPPCYYHPTNC----PNGPNHIHVCWQVPAYCLI 485

Query: 516 SLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSG 575
           +LSEIFASITGLEYAYSKAPA+MK+FIMSIFL T A+GSALG ALSP + +PK+ W + G
Sbjct: 486 ALSEIFASITGLEYAYSKAPASMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVG 545

Query: 576 LAVACFIAGCLFWLCFHHYNKDEEALNALD 605
           LAV+CFIAG  FWLCF  YN +E+ LN +D
Sbjct: 546 LAVSCFIAGIAFWLCFSRYNDEEDELNNID 575

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/374 (68%), Positives = 311/374 (83%), Gaps = 5/374 (1%)

Query: 238 IKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSLSVMATTH 297
           IKANLSVLIADQ+PK +P IKVLK+GE+V+ DPN+T+QNVFMFFY MIN+GSLS+MATT 
Sbjct: 2   IKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTE 61

Query: 298 LEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFKICWIGLCNGFNLN 357
           LE   GFWAAYLL FCFFW+ +V L+ G+K+Y++RPIGD VIA+ F++CWI   N F+ N
Sbjct: 62  LEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDFN 121

Query: 358 RAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQAGTMELHG 417
            A PS++PE++YPWND F+DEI+RA  ACKVF FYPIYW  YG M+++F+TQA  MELHG
Sbjct: 122 AAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHG 181

Query: 418 LPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCFGSSAMVYAAVLQH 477
           +PNDFLQA +SIALI+FIPI E+FIYPFIRR+TPF+P+TKIF GF FGS AM +AAVLQ 
Sbjct: 182 IPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQS 241

Query: 478 FIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASITGLEYAYSKAPAT 537
           FIYKAGP YD P+       NTPNRVH+ WQ+PAYVLIS SEIFASITGLEYAYSKAPA+
Sbjct: 242 FIYKAGPWYDEPLG-----HNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPAS 296

Query: 538 MKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLCFHHYNKD 597
           MK+FIMSIFL+T A GSA+G ALSP   +PK+ W F+GLAVACFI+GCLFW CF  YN  
Sbjct: 297 MKSFIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDT 356

Query: 598 EEALNALDYKTEEQ 611
           EE +NA+DY+ E++
Sbjct: 357 EEEMNAMDYEEEDE 370

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  251 bits (642), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 167/564 (29%), Positives = 270/564 (47%), Gaps = 44/564 (7%)

Query: 85  DEDDNQNENGREPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQN- 143
           D D+   +   EPTE E S LR V     +  + I ++E +ER SYYG      N++Q  
Sbjct: 20  DFDELDTQTFPEPTERERSELRRVLGHPKWYVYFICLIEFSERASYYGTGDRLNNFIQKP 79

Query: 144 ------------GPNDTPKGVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNT 191
                         ++   G L +  Q ATAL+    F  Y  PL+ GY+AD +WG+   
Sbjct: 80  LPAGGNGAGAPAPGSEATAGALGMGLQVATALNLLLTFLAYCFPLITGYVADRYWGRMRM 139

Query: 192 ICVGASFYVVGILILFMTAIPSI-NDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQI 250
           + +G    +V  ++  + ++P +    +++L   I+ +I + I T F+K  L   +  Q 
Sbjct: 140 LWIGVFVGIVSHVVFIIGSLPVVLGHGSAALAPCIIGIITLAIATAFVKPILLPTLLSQY 199

Query: 251 PKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLL 310
           P     +K L +GE+VI D + ++Q + M FY  IN+GS   +AT++     G+W A+L+
Sbjct: 200 PHATDVVKTLPSGERVIIDRDASLQRMTMTFYWSINVGSFLSVATSYSARDVGYWLAFLI 259

Query: 311 TFCFFWVGIVVLVFGRKKYVRR--PIGDHVIARCFKIC--------WIGLCNGFNLNRAV 360
               F +   VL+  R +Y++   P G  +IA C K+         W     G   + A 
Sbjct: 260 PLALFMIMPAVLLVLR-RYIKDEPPSGRSLIADCLKVLKVCFERNWWSRYRAGTFWDYAK 318

Query: 361 PS-LNPEKEYPWN--------DLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQAG 411
           PS L       W         +  + + R    AC +F +Y IY +  G + +   +Q  
Sbjct: 319 PSNLRSLGRQGWRKSKPGFYPESLVQDARVTISACTIFLYYVIYNINDGGIGSIMNSQTA 378

Query: 412 TMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFT-PFRPVTKIFIGFCFGSSAMV 470
           ++   G+PND +   N + +IVF+PI+++ +YP +R+    FRPV +IF GF   + A  
Sbjct: 379 SLTSKGVPNDLMSNFNPLCIIVFMPILDRVVYPLLRKLRWNFRPVFRIFAGFMVAALASA 438

Query: 471 YAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVP-AYVLISLSEIFASITGLEY 529
             A++QH IY+  PC ++   C  E   +P  +   W V   Y L   SE  A  TG E 
Sbjct: 439 VGAIIQHAIYQTSPCGNYATEC--EKGVSPISM---WVVAIEYALTGFSECLAMTTGYEI 493

Query: 530 AYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTF---SGLAVACFIAGCL 586
           A+ ++P  MK F+M++FL  +A+ +ALG  ++P+  +P  V  F   +GL  A   A   
Sbjct: 494 AFERSPPHMKTFVMALFLFMSALSAALGEIVTPSLVDPHLVIPFGVLAGLGAAVAFAFLW 553

Query: 587 FWLCFHHYNKDEEALNALDYKTEE 610
            +   HH  + E        K EE
Sbjct: 554 RYWNLHHVMEQERIEREALAKQEE 577

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  249 bits (636), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 171/596 (28%), Positives = 280/596 (46%), Gaps = 52/596 (8%)

Query: 69  KDHHASSDKIDFIGAVDEDDNQNENGR-------EPTEEELSTLRHVSERIPFTCWLIAI 121
            DH   S       AV E D  +E G        EPTE E +TLR V E   +  + I +
Sbjct: 2   SDHEKLSSVEKSQVAVLETDTYSEGGSGTPLSLPEPTEHERTTLRRVLEHPKWYVYFICL 61

Query: 122 VELAERFSYYGLSAPFQNYMQN----------------GPNDTPKGVLQLKSQGATALSY 165
           +E +ER SYYG      N++Q                   +    G L +  Q ATAL+ 
Sbjct: 62  IEFSERASYYGTGDRLNNFIQQPLPAGGNGAGAPAHGAAGDSATAGALGMGLQTATALNL 121

Query: 166 FFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSI-NDKNSSLGGF 224
              F  Y  PL+ GY+AD +W +   + +G    ++  +I  + A+P +  +  ++L   
Sbjct: 122 LLTFLAYCFPLVTGYIADRYWSRMRMLWIGVFVGIISHVIFIIGALPPVLGNGQAALAPC 181

Query: 225 IVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLM 284
           ++ +I + I T F+K  L   +  Q P     ++ L +GE+V+ D + ++Q + M FY  
Sbjct: 182 VIGIITLAIATSFVKPVLLPTLLSQYPHETDVVRTLASGERVLVDRDASLQRMTMTFYWS 241

Query: 285 INIGSLSVMATTHLEASYGFWAAYLLTFCFFWV-GIVVLVFGRKKYVRRPIGDHVIARC- 342
           INIGS   +AT++     G+W A+L+    + +   V+LV GR      P G  ++A C 
Sbjct: 242 INIGSFLSVATSYAARDIGYWLAFLIPLILYLIMPAVLLVLGRYLRDEPPSGRSMLADCC 301

Query: 343 --FKIC-----WIGLCNGFNLNRAVPS-LNPEKEYPWN---------DLFIDEIRRAFKA 385
              ++C     W    +G   N A PS L       W          +  + + R    A
Sbjct: 302 KVLRVCFERGWWRRYRSGDFWNYARPSRLRQAGRAGWRRKGAGGFYAESLVQDTRVTLSA 361

Query: 386 CKVFAFYPIYWVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPF 445
             +F +Y IY +  G + +   +Q  ++  +G+PND +   N + +IVF+P+++  +YP 
Sbjct: 362 SAIFLYYVIYNINDGGIGSIMNSQTASLTSNGVPNDLISNFNPLCIIVFMPVLDHVLYPV 421

Query: 446 IRRFT-PFRPVTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVH 504
           +R+    F+PV +IF GF   + A    A++Q  IY   PC  +   C  +   +P  + 
Sbjct: 422 LRKMRWNFKPVYRIFCGFMIAALASAVGAIIQTVIYNTSPCGRYATEC--DKGVSPVSM- 478

Query: 505 IGWQVPA-YVLISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPT 563
             W V   Y L  LSE  A  TG E A+ ++PA MK+F+M++FL T+A+ +ALG  ++P+
Sbjct: 479 --WVVAVEYALTGLSECLAMTTGYEIAFERSPAHMKSFVMALFLFTSALSAALGEIVTPS 536

Query: 564 AENPKYVWTFSGLA-VACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQEQMLSGV 618
             +P  V  F  LA +  F+A    W  +   +K  E   A     E +E  +  +
Sbjct: 537 LVDPHLVIPFGVLAGLGAFMAFVFLWR-YWSLDKTMELERAERRALEAEEGAMPAI 591

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  238 bits (606), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 164/554 (29%), Positives = 269/554 (48%), Gaps = 38/554 (6%)

Query: 97  PTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQ-------NGPNDTP 149
           PTEEE  TLR +     +  +LI  +ELAER SYYG      NY         NG   T 
Sbjct: 44  PTEEEERTLRRIVVHPSWYVYLICFIELAERASYYGTGDRLNNYYTYPLPEGGNGAGATA 103

Query: 150 ------KGVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGI 203
                  G L      AT+L    +F  Y  PL+ GYL D + G   T+  G    V   
Sbjct: 104 HGSEANSGALGKGLATATSLGLLLKFTSYFFPLVTGYLCDMYMGHVRTLWYGIWTGVASH 163

Query: 204 LILFMTAIPSI-NDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKN 262
           +I  ++A+P +    ++++   ++ LI + + T F+K  L  L+  Q P     +K L+ 
Sbjct: 164 IIFILSALPVVLKHPDAAMALSLIGLITLSVCTAFVKPVLLPLLLQQYPHETNVVKTLET 223

Query: 263 GEKVIEDPNVTMQNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVL 322
           GE+VI D + ++Q + M FY  INIG+   +AT++     GFW A+L+    +    VV 
Sbjct: 224 GERVIIDRDASLQRMTMTFYWAINIGAFMSLATSYAAKEVGFWLAFLIPLIIYMAMPVVF 283

Query: 323 VFGRKKYV-RRPIGDHVIARCFKICWIGLCNGFNLNR--------AVPSLNPE------- 366
              +     R P G  ++A C K+ ++    G+N  R        A+PS   +       
Sbjct: 284 SLVQPHIKDRAPSGYSLLADCMKVLYVAFGKGWNARRKEGVFWDYALPSNQRQMGKVGWR 343

Query: 367 KEYP-WNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQAGTMELHGLPNDFLQA 425
           K+ P + +  + + +    AC +F +Y IY +   Q+     +Q G+M  +G+PND +  
Sbjct: 344 KKSPFYKESLVQDTKITLSACFIFCYYIIYNMNDNQLTTIINSQTGSMTKNGVPNDVISN 403

Query: 426 INSIALIVFIPIMEQFIYPFIRRFT-PFRPVTKIFIGFCFGSSAMVYAAVLQHFIYKAGP 484
            N +++IV IPI++  +YP +RR    F+PV +IF GF    ++ V  A++Q  IY+   
Sbjct: 404 FNPLSIIVLIPILDYGLYPLLRRLRINFKPVYRIFTGFMLAVASSVAGALIQWRIYETSS 463

Query: 485 CYDFPMSCAPEYANTPNRVHIGWQVPA-YVLISLSEIFASITGLEYAYSKAPATMKAFIM 543
           C     +C+ +           W V   Y L   SE  A  T  E AY ++P  MK+F++
Sbjct: 464 CGYHATTCSEKGLGVSPLS--SWIVAVEYTLSGASECLAMTTAYEIAYDRSPEHMKSFVL 521

Query: 544 SIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLCFHHYNKD---EEA 600
           ++FL T+AV +A+   ++P  ++P  +  F+  A   FI+GC F   F + +K+   E+ 
Sbjct: 522 ALFLFTSAVSAAITQIVNPILKDPLLIVPFALFAGIGFISGCHFLWKFRNLDKEMLQEKR 581

Query: 601 LNALDYKTEEQEQM 614
              L  ++ E +++
Sbjct: 582 ERELLQESSESDEL 595

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  230 bits (587), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 162/530 (30%), Positives = 258/530 (48%), Gaps = 39/530 (7%)

Query: 105 LRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQ-----------NGPNDTPKGVL 153
           LRHV     +T ++I ++ELAER SYYG      N+ Q            GP+D   G L
Sbjct: 46  LRHVVAAPKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPGAL 105

Query: 154 QLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPS 213
               Q AT+L+   +F  Y  PL+ GY+AD + G+   + +G    VV  +I  + A+P+
Sbjct: 106 GRGLQVATSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAALPA 165

Query: 214 -INDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNV 272
            I   N  +   ++ L+ + + T F+K  L  ++  Q P     +K L  GE+VI + + 
Sbjct: 166 VIKHNNLCMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILNRDA 225

Query: 273 TMQNVFMFFYLMINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRR 332
           ++Q + M FY  IN+GS   +AT +     G+W ++L+    F +   +L+  +   V  
Sbjct: 226 SLQRMSMTFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKVTP 285

Query: 333 PIGDHVIARCFKICWIGLC----------NGFNLNRAVPS---------LNPEKEYPWND 373
           P+G+ + A C K+  I +C          +G     A PS             KE  + +
Sbjct: 286 PLGESLFAECLKV--IKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGFYKE 343

Query: 374 LFIDEIRRAFKACKVFAFYPIYWVVYGQMLNNFVTQAGTMELHGLPNDFLQAINSIALIV 433
             +++ R    AC +F +Y IY +   Q+ +    QAG+M   G+PND +   N +A+I+
Sbjct: 344 SLVEDTRITLAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAIII 403

Query: 434 FIPIMEQFIYPFIRRFT-PFRPVTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSC 492
            +PI++  + P +RR    F+PV +IF GF     A V  A++Q  IY   PC     +C
Sbjct: 404 TMPIIDYGLNPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGKHASTC 463

Query: 493 APEYANTP--NRVHIGWQVPAYVLISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTN 550
           +         +R  +G +   YVL  +SE FA  TG E A+ ++P  MKAF+MS+FLVT 
Sbjct: 464 SETIRQVSPLSRWLVGVE---YVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFLVTT 520

Query: 551 AVGSALGIALSPTAENPKYVWTFSGLAVACFIAGCLFWLCFHHYNKDEEA 600
           A+ S L    +    +P  V  F   AV   +   LF   + + +K  EA
Sbjct: 521 ALSSILTQIFNGIMTDPYLVIPFILFAVLGTLFAILFLYRYWNLDKVMEA 570

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  194 bits (492), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 150/569 (26%), Positives = 267/569 (46%), Gaps = 47/569 (8%)

Query: 70  DHHASSDKIDFIGAVDEDD--NQNENGREPTEEELSTLRHVSERIPFTCWLIAIVELAER 127
           +    + K++F+  ++++    + E  + PTE E  TLR +        + I ++E AER
Sbjct: 2   NEEKETAKVNFVQDLEKEKYITETETLQIPTEHEELTLRRIVTSPKIHLYFICLIEFAER 61

Query: 128 FSYYGLSAPFQNYMQ------------NGPNDTPKGVLQLKSQGATALSYFFQFWCYVTP 175
            S+YG      N+ Q             GP +   G L      ATA+    +F  Y   
Sbjct: 62  GSFYGTGNRMGNFYQYPLPIGGNGAGAPGPGEQDPGALGKGLAVATAMGLLLKFTSYTFS 121

Query: 176 LLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSI-NDKNSSLGGFIVSLIIIGIG 234
           ++ GY++D + G+   + +G    V   ++  + A+PS+    N +    +V+L+ + + 
Sbjct: 122 IITGYISDVYIGQIKMLWIGVWLGVGSHILFIIAALPSVLAHTNVAYALSVVALLSLSLC 181

Query: 235 TGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMINIGSLSVMA 294
           T F+K  L  L+  Q P     +K L +GE+VI D + ++Q + M FY  IN+G+   +A
Sbjct: 182 TSFVKPVLLPLLLQQYPYKTNIVKTLLSGERVIVDRDASLQRMTMVFYWAINVGAFLSLA 241

Query: 295 TTHLEASYGFWAAYLLTF-CFFWVGIVVLVFGRKKYVRRPIGDHVIA---RCFKIC---- 346
           T +     G+W A+ +    +  + IV+           P  + V+A   +  K+C    
Sbjct: 242 TAYSAQRVGYWLAFTVPLIIYLLMPIVLWKLQEDIKTNEPSRESVLAESLKVLKVCYEWG 301

Query: 347 WIG-LCNGFNLNRAVPS-LNPEKEYPW--------NDLFIDEIRRAFKACKVFAFYPIYW 396
           WI    +G   + A P+ L  +    W        ++ ++ + +    AC +F +Y IY 
Sbjct: 302 WIKRYWSGQFWDYAKPTNLIQQGRIGWRKKKAGFYDEKYVYDTKLTISACTIFLYYVIY- 360

Query: 397 VVYGQMLNNF----VTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFT-P 451
               QM +N      +QAG+ME  G+PND     N I++IV +PI++  +YP +RR+   
Sbjct: 361 ----QMHSNLDEPMRSQAGSMEGEGVPNDLFSNFNPISIIVVMPILDYVLYPLLRRYRIN 416

Query: 452 FRPVTKIFIGFCFGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPA 511
           F+PV +IF GF  G       A++Q  +Y   PC     +  PE  +  + +        
Sbjct: 417 FKPVYRIFCGFMIGCLGSTVGAIIQWRVYNTSPCGYMGATTCPELHHKKSPLSRWLVAIE 476

Query: 512 YVLISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVW 571
           Y L   SE  A  TG E A+ ++P  MK F++++F+ T A+ SA+ + ++P  ++P  + 
Sbjct: 477 YALGGTSECLAMTTGYEIAFERSPKKMKGFVLALFMFTVAISSAIILPITPFFKDPYLIQ 536

Query: 572 TFSGLA-VACFIAGCLFWLCFHHYNKDEE 599
            F+  A V    A    W    +++ D++
Sbjct: 537 PFAVCAGVGALTAIIFLW---RYWDLDKQ 562

>NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 51/114 (44%), Gaps = 9/114 (7%)

Query: 139 NYMQNGPNDTPKGVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASF 198
           +Y+    +  P G   +       L   F   C +  +  G L D+  G+   I VGAS 
Sbjct: 88  DYINRFGSTHPSGTKYMSKVRTGLLVSIFNVGCAIGSVFLGRLGDSI-GRRKGIVVGASI 146

Query: 199 YVVGILILFMTAIPSINDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPK 252
           Y+VGI+I     I SI+        + +  II G+G+G I     +LI++  PK
Sbjct: 147 YIVGIVI----QIASIDKWFQ----YFIGRIIGGLGSGAIAVLSPMLISEVSPK 192

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 9/114 (7%)

Query: 139 NYMQNGPNDTPKGVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASF 198
           +++Q        GVL L +     L   F   C +  +  G L D +  ++  I  G S 
Sbjct: 102 DFIQRFGTKNEDGVLYLSTIRMGLLVSIFNIGCAIGSVFLGKLGDLYGRRWGLI-FGTSI 160

Query: 199 YVVGILILFMTAIPSINDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPK 252
           +VVG++I     I S+    S    + +  II GIG G I     +LI++  PK
Sbjct: 161 FVVGVII----QIASV----SKWFQYFIGRIIAGIGMGVIAVLSPMLISEVAPK 206

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 87/210 (41%), Gaps = 23/210 (10%)

Query: 55  EKFKNNTDIKVYISKDHHASSDKIDFIGAVDEDDNQNENG--REPTEEELSTLRHVSERI 112
           E+ + +T + V    D+  S+D +  +      + + E G  + P+E+E  T   VS  +
Sbjct: 5   EQERASTAVDVSRKSDNKISNDSVSLLSTPSNKELEEEKGDLQRPSEDE--TPASVSPLV 62

Query: 113 PFTC-WLIAIVELAERFSYY------GLSAPFQ---NYMQNGPNDTPKGVLQLKSQGATA 162
           P    W I I+ L   F  Y      G    F+   +++    + + +G   L       
Sbjct: 63  PSGINWGICILCLMVAFGGYISGWDSGTIGGFEAHTDFLARFGSTSGEGKRYLSKVRTGL 122

Query: 163 LSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLG 222
           L+  F     +     G L D + G+   + V +  +++G +I     I S+     +  
Sbjct: 123 LTSMFNVGQAIGSFFLGRLGDIY-GRRIGLIVASVIFIIGTVI----QIASVK----AWY 173

Query: 223 GFIVSLIIIGIGTGFIKANLSVLIADQIPK 252
            +++  II G+G G I     +LI++  PK
Sbjct: 174 QYMIGRIIAGLGCGLIAILSPMLISEVSPK 203

>KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 458

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 51/114 (44%), Gaps = 7/114 (6%)

Query: 508 QVPAYVLISLSEIFASITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSP---TA 564
            V A VL+ L   F     L    ++AP T  A +  +F V  +VGS +G ++S    T 
Sbjct: 329 MVAAVVLLGLGRTFTQFPLLTTMQARAPHTKMATVTGLFHVWGSVGSVVGASISGAVWTQ 388

Query: 565 ENPKYVWTF---SGLAVACFIAGCLFWLCFHHYNKDEEALNALDYKTEEQEQML 615
           + PK +      +GLA A + +   F +  + +   E     L YK  +++  L
Sbjct: 389 KMPKKLLKMLGSNGLATAAYASPYTF-IISYPWGTSERLAVVLAYKNVQKDTPL 441

>TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 75/205 (36%), Gaps = 25/205 (12%)

Query: 64  KVYISKDHHASS--DKIDFIGAVDEDDNQNEN-----GREPTEEELSTLRHVSERIPFTC 116
           K  I +  H+S+  D  D         N+NE      G   TE E +T        P T 
Sbjct: 4   KSTIVEQEHSSNLLDNTDITSVASTPSNKNETDITPEGDPKTESENATNIAAPPSPPGTN 63

Query: 117 WLIAIVELAERFSYY---------GLSAPFQNYMQNGPNDTPKGVLQLKSQGATALSYFF 167
           W I ++ L   F  Y         G      ++++   +    G   L       L+  F
Sbjct: 64  WGICVLCLMVAFGGYISGWDSGTIGGYESQTDFLKRFGSKRSDGTYYLSKVRTGLLTSMF 123

Query: 168 QFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIVS 227
                +     G L D + G+   + V A  ++VG +I     I SI         +++ 
Sbjct: 124 NIGNAIGCFFLGRLGDMY-GRRIGLIVAAVIFIVGNII----QIASIRAWYQ----YMIG 174

Query: 228 LIIIGIGTGFIKANLSVLIADQIPK 252
            I+ G+G G I     +LI++  PK
Sbjct: 175 RIVAGVGAGLIAILSPMLISEVAPK 199

>NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 40/86 (46%), Gaps = 9/86 (10%)

Query: 167 FQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFIV 226
           F   C +  +  G L DT  G+   I V  S Y+VGI+I     I S+      L G I+
Sbjct: 103 FNIGCAIGSVFLGRLGDTI-GRRKGIVVAVSIYMVGIVI----QIASVKKWFQYLIGRII 157

Query: 227 SLIIIGIGTGFIKANLSVLIADQIPK 252
           S    G+G G I     +LI++  PK
Sbjct: 158 S----GLGAGCIAVLSPMLISEVSPK 179

>NCAS0I03160 Chr9 (587668..589395) [1728 bp, 575 aa] {ON} 
          Length = 575

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 47/222 (21%), Positives = 81/222 (36%), Gaps = 24/222 (10%)

Query: 36  LNVDSTVSSDDEFTGEKKDEKFKNNTDIKVYISKDH---HASSDKIDFIGAVDEDDNQNE 92
           +N D++V+  +  T    DE   ++       S  H    A S+K D     +E  N  E
Sbjct: 1   MNTDNSVADPNVATEHINDEPLNDSA------SGSHSVLEAQSNKDD----DEEIKNYGE 50

Query: 93  NGREPTEEELSTLRHVSERIPFTCWLIAIVELAERFSYYGLSA--PFQNYMQNGPNDTPK 150
           +G     E           +   C +IA       +    +S      +Y++        
Sbjct: 51  DGEIAPAEMPKKPASAYVTVSILCLMIAFGGYVYGWDTGTISGFVAQTDYVRRYGQKKKD 110

Query: 151 GVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTA 210
           G   L       L   F   C +  LL   L D  WG+   +    + Y++G++I    +
Sbjct: 111 GTYYLSKVRTGLLLAIFNIGCAIGGLLWSRLGD-MWGRRKALVFVTTVYMIGLII----S 165

Query: 211 IPSINDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPK 252
           I ++         + +  II G+G G I     +LI++  PK
Sbjct: 166 IAAVKHWYQ----YFIGRIISGLGVGGIAVYSPLLISEVAPK 203

>ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} similar
           to uniprot|P36029 Saccharomyces cerevisiae YKL174C TPO5
           Protein involved in excretion of putrescine and
           spermidine putative polyamine transporter in the Golgi
           or post-Golgi vesicles
          Length = 591

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 72/164 (43%), Gaps = 23/164 (14%)

Query: 166 FFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGFI 225
           +++ W YV P      +++   KY+ +   +  Y++G+L LF          N++   FI
Sbjct: 383 YYRLWTYVDPQ-----SESRVPKYSILLSMSISYILGLLPLF---------SNAAFNAFI 428

Query: 226 VSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLMI 285
              ++       I   L VL+         R +VLKN    I+     + N+    +L++
Sbjct: 429 GCAVLCLCSATLIPL-LLVLVT--------RRRVLKNAPVKIKYKLGWIANIGSVCWLLL 479

Query: 286 NIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKY 329
           ++ S+ +     + A    +A  +  FCFF + I+   +GRK +
Sbjct: 480 SMFSVCLPPQIPVTAKTMNYALLVFLFCFFIICILYYKWGRKHF 523

>YPL224C Chr16 complement(126634..128088) [1455 bp, 484 aa] {ON}
           MMT2Putative metal transporter involved in mitochondrial
           iron accumulation; closely related to Mmt1p
          Length = 484

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 221 LGGFIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIED 269
           LGG +VS +II  G   I ++L  L+   IP T PR   +   E VI+D
Sbjct: 326 LGGLVVSGLIIKTGGQGILSSLKELVDQSIPPTDPRYLEI---ESVIKD 371

>SAKL0G19844g Chr7 (1708176..1709894) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P23585 Saccharomyces cerevisiae
           YMR011W HXT2 High-affinity glucose transporter of the
           major facilitator superfamily expression is induced by
           low levels of glucose and repressed by high levels of
           glucose
          Length = 572

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 46/116 (39%), Gaps = 15/116 (12%)

Query: 137 FQNYMQNGPNDTPKGVLQLKSQGATALSYFFQFWCYVTPLLGGYLADTFWGKYNTICVGA 196
           F NY Q+      +G   L +     +   F   C    L  G L D +  +   +CV  
Sbjct: 103 FGNYSQS------EGTYYLSNVRTGLIVAIFNIGCAFGGLTLGRLGDIYGRRLGLMCV-V 155

Query: 197 SFYVVGILILFMTAIPSINDKNSSLGGFIVSLIIIGIGTGFIKANLSVLIADQIPK 252
             YVVGI+I   T      DK      + +  II G+G G I      LI++  PK
Sbjct: 156 CVYVVGIIIQIATG-----DKWYQ---YFIGRIISGLGVGGIAVLSPTLISETAPK 203

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.140    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,916,631
Number of extensions: 3044313
Number of successful extensions: 12867
Number of sequences better than 10.0: 58
Number of HSP's gapped: 13319
Number of HSP's successfully gapped: 58
Length of query: 654
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 538
Effective length of database: 40,180,143
Effective search space: 21616916934
Effective search space used: 21616916934
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)