Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E08779g2.306ON47544517450.0
ZYRO0A02398g2.306ON41036610451e-139
Ecym_33442.306ON4212058231e-105
AGR390C2.306ON3782037881e-100
SAKL0E07128g2.306ON4011827622e-96
KLTH0G10912g2.306ON4361847348e-92
Kwal_27.114472.306ON4391847349e-92
TBLA0B071702.306ON4701907282e-90
NCAS0B061402.306ON4431857183e-89
NDAI0B034402.306ON4991857162e-88
Suva_14.3302.306ON4572067107e-88
Kpol_1043.342.306ON4421857019e-87
TDEL0G023602.306ON4021836971e-86
Smik_14.3132.306ON4512096983e-86
CAGL0H10604g2.306ON4162076935e-86
Skud_14.3122.306ON4592136951e-85
YNL016W (PUB1)2.306ON4532066932e-85
TPHA0C035202.306ON4421846852e-84
KNAG0A054402.306ON4421896643e-81
KAFR0J012602.306ON3651826425e-79
NDAI0C061008.229ON5851972248e-19
TBLA0F037808.229ON5771792222e-18
KNAG0G018108.229ON5961812222e-18
Kpol_1032.498.229ON5801722203e-18
KAFR0B025008.229ON5821792194e-18
TDEL0A013508.229ON5881852186e-18
ZYRO0B11660g8.229ON5871852176e-18
Skud_5.3048.229ON5771782176e-18
Smik_5.3378.229ON5771782177e-18
YER165W (PAB1)8.229ON5771782177e-18
KLLA0C17600g8.229ON5921662169e-18
CAGL0L11792g8.229ON5791682151e-17
NCAS0A036808.229ON5751722132e-17
TPHA0B034208.229ON5791792132e-17
Ecym_55628.229ON5801782123e-17
Suva_5.2998.229ON5771782096e-17
SAKL0H17952g8.229ON5891862089e-17
SAKL0G08118g5.382ON5451762071e-16
KNAG0B044405.382ON3972102042e-16
Ecym_62014.61ON4481832042e-16
Kwal_55.201545.382ON5221762052e-16
CAGL0M03795g3.49ON5131862025e-16
CAGL0H02123g5.382ON5551832016e-16
Ecym_80105.382ON6021982001e-15
TDEL0E024505.382ON4721981981e-15
AGR122C8.229ON5851781991e-15
ADR307W5.382ON5661811972e-15
AFR107W4.61ON3961841943e-15
Kwal_56.234868.229ON5871851944e-15
NDAI0D028404.61ON4261771917e-15
KAFR0D048305.382ON4061651909e-15
KLTH0G14344g8.229ON5871791911e-14
KLTH0E03520g5.382ON5161721892e-14
TBLA0C043604.61ON4031811872e-14
CAGL0E03245g4.61ON4251791873e-14
KNAG0D032204.61ON3991831863e-14
SAKL0H23562g4.61ON4211801854e-14
TDEL0F029104.61ON4361791829e-14
TDEL0E006003.49ON5471741821e-13
NCAS0A058904.61ON4151781811e-13
NCAS0H018105.382ON4431901802e-13
KLLA0F14861g5.382ON5891771812e-13
KAFR0F031204.61ON4121811792e-13
ZYRO0G07326g4.61ON4681801793e-13
TBLA0H017905.382ON6741851793e-13
KLTH0D03916g4.61ON5051801784e-13
KAFR0C016803.49ON4791741774e-13
Skud_7.4834.61ON3931801765e-13
Suva_7.4504.61ON3911811757e-13
TPHA0K019104.61ON4161801758e-13
KNAG0A013703.49ON5451741759e-13
Smik_6.2644.61ON3951801712e-12
Skud_8.1475.382ON5131921722e-12
Ecym_20503.49ON5411881722e-12
KLLA0C11495g4.61ON4451761712e-12
YGR159C (NSR1)4.61ON4141781703e-12
TPHA0P013103.49ON5181711695e-12
YHR086W (NAM8)5.382ON5232271695e-12
TBLA0A078103.49ON4721661678e-12
NCAS0C046003.49ON5811751671e-11
ZYRO0C02574g3.49ON5431821661e-11
Smik_8.1645.382ON5241841661e-11
YBR212W (NGR1)6.104ON6721451633e-11
Suva_15.2805.382ON5412351623e-11
Skud_6.1071.357ON611721624e-11
Suva_4.4706.104ON6631641616e-11
Skud_2.3456.104ON6641641616e-11
Kwal_55.219603.49ON5971661607e-11
NDAI0C018205.382ON4981821597e-11
KLTH0F18766g3.49ON5881661608e-11
TBLA0B085903.49ON6231751608e-11
Smik_2.3556.104ON7361451608e-11
SAKL0C12672g3.49ON5511661591e-10
Kpol_1076.113.49ON5261671581e-10
NCAS0B072401.357ON610721572e-10
KLLA0C12925g3.49ON5701751562e-10
Kpol_1026.214.61ON4371791543e-10
Kpol_530.466.104ON5871421553e-10
Kpol_224.18.797ON2172121474e-10
TBLA0A099206.104ON5941651534e-10
Kwal_14.18516.104ON5351621535e-10
SAKL0A07370g6.104ON4901451535e-10
TDEL0G036706.104ON6171451536e-10
Skud_15.303.49ON5391911526e-10
Kwal_0.3701.357ON560801526e-10
Suva_15.373.49ON5511701527e-10
YOL123W (HRP1)3.49ON5341701527e-10
Smik_15.303.49ON5361701527e-10
NDAI0G039703.49ON6071661527e-10
Suva_6.951.357ON613721528e-10
TPHA0H015205.382ON4941961491e-09
NDAI0A061703.49ON5521371491e-09
ZYRO0A07018g5.382ON5581951491e-09
CAGL0K06655g6.104ON8021631492e-09
KLTH0H06842g6.104ON5471011482e-09
CAGL0I09900g8.797ON2111701422e-09
CAGL0E01947g3.49ON4521711463e-09
ZYRO0C05060g6.104ON7161451473e-09
NCAS0A100103.49ON5061721454e-09
CAGL0M12573g7.250ON2991171434e-09
KAFR0G023206.104ON6202621455e-09
ADL160W3.49ON5261841446e-09
AAR151W6.104ON4811631421e-08
Ecym_30826.104ON5861641421e-08
ABL059W8.797ON2041691351e-08
TBLA0D049401.357ON665701402e-08
AEL016C1.357ON678921402e-08
KLLA0C05522g6.104ON5401581392e-08
Ecym_27461.357ON681921402e-08
SAKL0D09680g1.357ON672921383e-08
Kpol_1018.1221.357ON6341861374e-08
TDEL0H032407.159ON1671391295e-08
Kpol_1008.231.357ON660721366e-08
KLTH0E14036g8.797ON2091801306e-08
TPHA0F028206.104ON6081451358e-08
NCAS0E038805.76ON7172021341e-07
SAKL0B06270g8.797ON2091971281e-07
NDAI0B045701.357ON4641081331e-07
YFR023W (PES4)1.357ON611721331e-07
AGL250W8.491ON7291031331e-07
KLLA0C14388g8.797ON2031751272e-07
AEL217W5.76ON8342161332e-07
Suva_16.2718.491ON686871322e-07
SAKL0D08558g1.408ON4641731312e-07
NCAS0C023808.491ON7021121303e-07
KLLA0A08338g1.357ON7661911304e-07
KAFR0C044101.357ON589801294e-07
Smik_16.1928.491ON6901231295e-07
ZYRO0G00814g1.357ON654801295e-07
TPHA0A022201.357ON713861295e-07
YPL043W (NOP4)8.491ON685791278e-07
Skud_16.2388.491ON680871278e-07
Kwal_26.7493singletonOFF2221381211e-06
KAFR0L009707.250ON285791231e-06
KAFR0H014508.491ON690931251e-06
KLTH0C04268g8.822ON4501901241e-06
Ecym_55745.76ON8712361251e-06
KLTH0E11418g8.491ON693961251e-06
Kwal_56.247095.76ON8282181242e-06
YIR005W (IST3)7.159ON1481161162e-06
TBLA0A033005.382ON362791222e-06
CAGL0B04807g1.408ON4191791222e-06
Smik_7.3341.357ON611721232e-06
YGR250C5.76ON7812341232e-06
TDEL0B014608.491ON692841223e-06
TDEL0B010108.797ON2101751173e-06
NDAI0E030708.491ON701791223e-06
Kpol_1075.1a8.229ON264891193e-06
TPHA0F023102.80ON4001001213e-06
KNAG0I020302.167ON229901183e-06
TDEL0B060601.408ON345751194e-06
Ecym_25418.491ON675791214e-06
NCAS0G042801.408ON4352111204e-06
Kwal_27.118328.491ON686851214e-06
ADR017W7.159ON1731081145e-06
CAGL0L12672g8.491ON6821001205e-06
ZYRO0G04862g2.80ON376821186e-06
CAGL0I08943g1.357ON602721196e-06
TDEL0D022501.357ON6221651198e-06
Kwal_23.58647.250ON2781091168e-06
Kwal_55.209727.159ON1351061109e-06
Suva_7.5465.76ON7792201189e-06
KLLA0C08019g7.250ON3011001161e-05
TBLA0A015708.491ON7421101171e-05
Ecym_74208.797ON2041681121e-05
Kpol_1002.696.183ON590871161e-05
TPHA0B043001.102ON3341291151e-05
NDAI0F033202.80ON3991151161e-05
KLLA0D05016g1.408ON4431751161e-05
Skud_7.5835.76ON7792201162e-05
Suva_9.2147.159ON1461231082e-05
KAFR0B044205.76ON6251941152e-05
AAL018W1.408ON3371731132e-05
Kpol_487.61.408ON376741132e-05
KAFR0B045402.167ON220771112e-05
KLTH0A04554g7.250ON2781091123e-05
SAKL0A05280g6.183ON582831143e-05
CAGL0L03806g2.167ON255741113e-05
Smik_16.575.76ON7822201143e-05
KAFR0A074902.80ON3811021123e-05
KLLA0D13420g7.159ON1661111074e-05
SAKL0H11330g8.491ON697791134e-05
CAGL0J11154g2.80ON3801131115e-05
KNAG0A022108.491ON682851125e-05
NCAS0C048301.408ON3772041105e-05
CAGL0J01914g7.159ON1691061066e-05
Ecym_22336.183ON576881116e-05
TPHA0G010808.797ON2201841086e-05
Suva_14.1662.80ON403851106e-05
KLLA0D11792g8.491ON6851011116e-05
YNL175C (NOP13)2.80ON403851106e-05
Skud_14.1592.80ON400851106e-05
Smik_14.1552.80ON403851106e-05
TPHA0J009207.250ON309991097e-05
Skud_8.671.357ON652561117e-05
AFL061C6.183ON5231871107e-05
Smik_9.2047.159ON1491161048e-05
ABL134C2.80ON375761098e-05
AFL224W2.167ON206831068e-05
Skud_7.2404.66ON318911098e-05
NDAI0F01720singletonON4741631108e-05
NDAI0A028107.159ON1691061049e-05
KLLA0E19031g6.183ON6521881101e-04
TDEL0F012202.167ON212731051e-04
KLLA0E11045g8.822ON4321901081e-04
TPHA0J022106.183ON593831091e-04
NDAI0G001801.408ON464901091e-04
Kpol_1041.42.80ON384851081e-04
AFR649W1.102ON310751071e-04
TPHA0B029502.167ON218731051e-04
KNAG0C020301.357ON3651011071e-04
ADR189W5.536ON269891061e-04
TBLA0B080105.76ON9391061091e-04
TPHA0C017408.491ON6972271081e-04
KLLA0F23650g2.167ON312731061e-04
Kpol_150.17.159ON1381081011e-04
TDEL0G016206.183ON584841082e-04
Ecym_13021.408ON288881062e-04
SAKL0E10604g2.167ON221861042e-04
KLTH0H12958g1.357ON639731072e-04
SAKL0H02332g5.76ON8172181072e-04
NDAI0D048104.33ON626891072e-04
YHR015W (MIP6)1.357ON659621072e-04
TBLA0C056002.167ON215771032e-04
KAFR0H031101.408ON441741062e-04
Kwal_33.144632.80ON393821062e-04
NCAS0H010406.183ON629881062e-04
ZYRO0F08294g8.491ON714781063e-04
Suva_16.1236.183ON596881063e-04
NCAS0G025802.167ON224731023e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08779g
         (475 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} simila...   676   0.0  
ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} simila...   407   e-139
Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar t...   321   e-105
AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}...   308   e-100
SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {...   298   2e-96
KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some s...   287   8e-92
Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {...   287   9e-92
TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa] ...   285   2e-90
NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa] ...   281   3e-89
NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {O...   280   2e-88
Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 ...   278   7e-88
Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {O...   274   9e-87
TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.3...   273   1e-86
Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016...   273   3e-86
CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]...   271   5e-86
Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016...   272   1e-85
YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly ...   271   2e-85
TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.3...   268   2e-84
KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.3...   260   3e-81
KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {...   251   5e-79
NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON}             91   8e-19
TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.2...    90   2e-18
KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.2...    90   2e-18
Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON} (1110...    89   3e-18
KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.2...    89   4e-18
TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {O...    89   6e-18
ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly...    88   6e-18
Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W ...    88   6e-18
Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W ...    88   7e-18
YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A...    88   7e-18
KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} simi...    88   9e-18
CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} hig...    87   1e-17
NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {O...    87   2e-17
TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {O...    87   2e-17
Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar...    86   3e-17
Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W ...    85   6e-17
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    85   9e-17
SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {...    84   1e-16
KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {O...    83   2e-16
Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar t...    83   2e-16
Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {...    84   2e-16
CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa] ...    82   5e-16
CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {...    82   6e-16
Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to ...    82   1e-15
TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {O...    81   1e-15
AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON} S...    81   1e-15
ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic ...    80   2e-15
AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic ho...    79   3e-15
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    79   4e-15
NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {O...    78   7e-15
KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.3...    78   9e-15
KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} high...    78   1e-14
KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {...    77   2e-14
TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa] ...    77   2e-14
CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {...    77   3e-14
KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.6...    76   3e-14
SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]...    76   4e-14
TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {O...    75   9e-14
TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.4...    75   1e-13
NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON}             74   1e-13
NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382     74   2e-13
KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some...    74   2e-13
KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.6...    74   2e-13
ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {...    74   3e-13
TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {O...    74   3e-13
KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some s...    73   4e-13
KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {O...    73   4e-13
Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON...    72   5e-13
Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON...    72   7e-13
TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {...    72   8e-13
KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49 ...    72   9e-13
Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON...    70   2e-12
Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W ...    71   2e-12
Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to ...    71   2e-12
KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {...    70   2e-12
YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}  ...    70   3e-12
TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {...    70   5e-12
YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA bi...    70   5e-12
TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3...    69   8e-12
NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49      69   1e-11
ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {...    69   1e-11
Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W ...    69   1e-11
YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA bi...    67   3e-11
Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086...    67   3e-11
Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W ...    67   4e-11
Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W ...    67   6e-11
Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W ...    67   6e-11
Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]...    66   7e-11
NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {O...    66   7e-11
KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]...    66   8e-11
TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa] ...    66   8e-11
Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W ...    66   8e-11
SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]...    66   1e-10
Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {O...    65   1e-10
NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON} Anc_1...    65   2e-10
KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weak...    65   2e-10
Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {O...    64   3e-10
Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {O...    64   3e-10
Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON} comp...    61   4e-10
TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON} Anc_6...    64   4e-10
Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {O...    64   5e-10
SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {...    64   5e-10
TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {O...    64   6e-10
Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W (...    63   6e-10
Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W (P...    63   6e-10
Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W (...    63   7e-10
YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit...    63   7e-10
Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W (...    63   7e-10
NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.4...    63   7e-10
Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W (...    63   8e-10
TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.3...    62   1e-09
NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa] ...    62   1e-09
ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {...    62   1e-09
CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} simil...    62   2e-09
KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {...    62   2e-09
CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar...    59   2e-09
CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some s...    61   3e-09
ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {...    61   3e-09
NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa] ...    60   4e-09
CAGL0M12573g Chr13 (1247678..1248577) [900 bp, 299 aa] {ON} simi...    60   4e-09
KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {O...    60   5e-09
ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic ho...    60   6e-09
AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic ho...    59   1e-08
Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}...    59   1e-08
ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic hom...    57   1e-08
TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON} Anc_1...    59   2e-08
AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON} S...    59   2e-08
KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some s...    58   2e-08
Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar...    59   2e-08
SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} simila...    58   3e-08
Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON} (325...    57   4e-08
TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON...    54   5e-08
Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON} (47628....    57   6e-08
KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa] ...    55   6e-08
TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.1...    57   8e-08
NCAS0E03880 Chr5 complement(761175..763328) [2154 bp, 717 aa] {O...    56   1e-07
SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {O...    54   1e-07
NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON} Anc_1...    56   1e-07
YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A...    56   1e-07
AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic ho...    56   1e-07
KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa] ...    54   2e-07
AEL217W Chr5 (225217..227721) [2505 bp, 834 aa] {ON} Syntenic ho...    56   2e-07
Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043...    55   2e-07
SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} simila...    55   2e-07
NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.4...    55   3e-07
KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} simila...    55   4e-07
KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {O...    54   4e-07
Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043...    54   5e-07
ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON...    54   5e-07
TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {O...    54   5e-07
YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}  NOP4Nucle...    54   8e-07
Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043...    54   8e-07
Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C...    51   1e-06
KAFR0L00970 Chr12 (181689..182546) [858 bp, 285 aa] {ON} Anc_7.2...    52   1e-06
KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.4...    53   1e-06
KLTH0C04268g Chr3 (367879..369231) [1353 bp, 450 aa] {ON} simila...    52   1e-06
Ecym_5574 Chr5 complement(1175694..1178309) [2616 bp, 871 aa] {O...    53   1e-06
KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]...    53   1e-06
Kwal_56.24709 s56 complement(1113983..1116469) [2487 bp, 828 aa]...    52   2e-06
YIR005W Chr9 (364889..365335) [447 bp, 148 aa] {ON}  IST3Compone...    49   2e-06
TBLA0A03300 Chr1 (785613..786701) [1089 bp, 362 aa] {ON} Anc_5.3...    52   2e-06
CAGL0B04807g Chr2 (460721..461980) [1260 bp, 419 aa] {ON} simila...    52   2e-06
Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W ...    52   2e-06
YGR250C Chr7 complement(991176..993521) [2346 bp, 781 aa] {ON} P...    52   2e-06
TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.4...    52   3e-06
TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON...    50   3e-06
NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.4...    52   3e-06
Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 ...    50   3e-06
TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.8...    51   3e-06
KNAG0I02030 Chr9 (396201..396890) [690 bp, 229 aa] {ON} Anc_2.16...    50   3e-06
TDEL0B06060 Chr2 complement(1071469..1072506) [1038 bp, 345 aa] ...    50   4e-06
Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {O...    51   4e-06
NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408     51   4e-06
Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {...    51   4e-06
ADR017W Chr4 (734484..735005) [522 bp, 173 aa] {ON} Syntenic hom...    49   5e-06
CAGL0L12672g Chr12 complement(1361933..1363981) [2049 bp, 682 aa...    51   5e-06
ZYRO0G04862g Chr7 complement(387238..388368) [1131 bp, 376 aa] {...    50   6e-06
CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} simila...    50   6e-06
TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {O...    50   8e-06
Kwal_23.5864 s23 (1347244..1348080) [837 bp, 278 aa] {ON} YIL061...    49   8e-06
Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W...    47   9e-06
Suva_7.546 Chr7 complement(946681..949020) [2340 bp, 779 aa] {ON...    50   9e-06
KLLA0C08019g Chr3 complement(704199..705104) [906 bp, 301 aa] {O...    49   1e-05
TBLA0A01570 Chr1 (364733..366961) [2229 bp, 742 aa] {ON} Anc_8.4...    50   1e-05
Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON} ...    48   1e-05
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...    49   1e-05
TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON} Anc_1...    49   1e-05
NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80      49   1e-05
KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [133...    49   1e-05
Skud_7.583 Chr7 complement(965719..968058) [2340 bp, 779 aa] {ON...    49   2e-05
Suva_9.214 Chr9 (351853..352293) [441 bp, 146 aa] {ON} YIR005W (...    46   2e-05
KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {O...    49   2e-05
AAL018W Chr1 (309542..310555) [1014 bp, 337 aa] {ON} Syntenic ho...    48   2e-05
Kpol_487.6 s487 (35743..36873) [1131 bp, 376 aa] {ON} (35743..36...    48   2e-05
KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.16...    47   2e-05
KLTH0A04554g Chr1 (380152..380988) [837 bp, 278 aa] {ON} weakly ...    48   3e-05
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...    49   3e-05
CAGL0L03806g Chr12 (440385..441152) [768 bp, 255 aa] {ON} simila...    47   3e-05
Smik_16.57 Chr16 (103313..105661) [2349 bp, 782 aa] {ON} YGR250C...    49   3e-05
KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2...    48   3e-05
KLLA0D13420g Chr4 complement(1157491..1157991) [501 bp, 166 aa] ...    46   4e-05
SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} simila...    48   4e-05
CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON} sim...    47   5e-05
KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.4...    48   5e-05
NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408     47   5e-05
CAGL0J01914g Chr10 complement(191912..192421) [510 bp, 169 aa] {...    45   6e-05
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...    47   6e-05
TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON...    46   6e-05
Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {...    47   6e-05
KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} simi...    47   6e-05
YNL175C Chr14 complement(307401..308612) [1212 bp, 403 aa] {ON} ...    47   6e-05
Skud_14.159 Chr14 complement(298222..299424) [1203 bp, 400 aa] {...    47   6e-05
Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {...    47   6e-05
TPHA0J00920 Chr10 (217471..218400) [930 bp, 309 aa] {ON} Anc_7.2...    47   7e-05
Skud_8.67 Chr8 (116061..118019) [1959 bp, 652 aa] {ON} YHR015W (...    47   7e-05
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...    47   7e-05
Smik_9.204 Chr9 (340893..341342) [450 bp, 149 aa] {ON} YIR005W (...    45   8e-05
ABL134C Chr2 complement(140623..141750) [1128 bp, 375 aa] {ON} S...    47   8e-05
AFL224W Chr6 (18862..19482) [621 bp, 206 aa] {ON} Syntenic homol...    45   8e-05
Skud_7.240 Chr7 complement(418142..419098) [957 bp, 318 aa] {ON}...    47   8e-05
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    47   8e-05
NDAI0A02810 Chr1 complement(633738..634247) [510 bp, 169 aa] {ON...    45   9e-05
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...    47   1e-04
TDEL0F01220 Chr6 complement(216951..217589) [639 bp, 212 aa] {ON...    45   1e-04
KLLA0E11045g Chr5 (968674..969972) [1299 bp, 432 aa] {ON} simila...    46   1e-04
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....    47   1e-04
NDAI0G00180 Chr7 complement(23120..24514) [1395 bp, 464 aa] {ON}...    47   1e-04
Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON} (12746.....    46   1e-04
AFR649W Chr6 (1619582..1620514) [933 bp, 310 aa] {ON} NOHBY659; ...    46   1e-04
TPHA0B02950 Chr2 complement(672465..673121) [657 bp, 218 aa] {ON...    45   1e-04
KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.3...    46   1e-04
ADR189W Chr4 (1034091..1034900) [810 bp, 269 aa] {ON} Syntenic h...    45   1e-04
TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5...    47   1e-04
TPHA0C01740 Chr3 (398136..400229) [2094 bp, 697 aa] {ON} Anc_8.4...    46   1e-04
KLLA0F23650g Chr6 (2210563..2211501) [939 bp, 312 aa] {ON} simil...    45   1e-04
Kpol_150.1 s150 (1938..2354) [417 bp, 138 aa] {ON} (1938..2354) ...    44   1e-04
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...    46   2e-04
Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON} ...    45   2e-04
SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar...    45   2e-04
KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} simi...    46   2e-04
SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some s...    46   2e-04
NDAI0D04810 Chr4 complement(1135992..1137872) [1881 bp, 626 aa] ...    46   2e-04
YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putati...    46   2e-04
TBLA0C05600 Chr3 complement(1357001..1357648) [648 bp, 215 aa] {...    44   2e-04
KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326...    45   2e-04
Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {...    45   2e-04
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...    45   2e-04
ZYRO0F08294g Chr6 complement(670688..672832) [2145 bp, 714 aa] {...    45   3e-04
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...    45   3e-04
NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON...    44   3e-04
SAKL0C03234g Chr3 complement(306710..307732) [1023 bp, 340 aa] {...    45   3e-04
Kpol_259.1 s259 (2949..3947) [999 bp, 332 aa] {ON} (2949..3947) ...    45   3e-04
Kpol_1062.7 s1062 (14539..16821) [2283 bp, 760 aa] {ON} (14539.....    45   3e-04
NCAS0G01950 Chr7 complement(348633..349847) [1215 bp, 404 aa] {O...    45   3e-04
Ecym_5419 Chr5 (864517..865164) [648 bp, 215 aa] {ON} similar to...    44   3e-04
TPHA0H01140 Chr8 complement(251773..254277) [2505 bp, 834 aa] {O...    45   3e-04
Suva_3.8 Chr3 complement(12157..13458) [1302 bp, 433 aa] {ON} YC...    45   3e-04
SAKL0E12738g Chr5 (1052695..1053885) [1191 bp, 396 aa] {ON} simi...    45   3e-04
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...    45   4e-04
Skud_9.182 Chr9 (335662..336111) [450 bp, 149 aa] {ON} YIR005W (...    43   4e-04
TDEL0H01940 Chr8 complement(334207..335163) [957 bp, 318 aa] {ON...    44   4e-04
KLTH0F13442g Chr6 (1103806..1104210) [405 bp, 134 aa] {ON} simil...    42   4e-04
CAGL0H04675g Chr8 complement(447256..448080) [825 bp, 274 aa] {O...    44   4e-04
NDAI0D02800 Chr4 (649804..650751) [948 bp, 315 aa] {ON} Anc_4.66       44   4e-04
KNAG0J00360 Chr10 (56847..58169) [1323 bp, 440 aa] {ON} Anc_8.82...    44   4e-04
Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W...    44   4e-04
ZYRO0G13706g Chr7 complement(1097882..1099144) [1263 bp, 420 aa]...    44   5e-04
Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa] ...    43   5e-04
NDAI0G04190 Chr7 (1005539..1006618) [1080 bp, 359 aa] {ON} Anc_1...    44   5e-04
KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {O...    45   5e-04
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183     45   5e-04
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...    45   5e-04
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...    44   5e-04
NDAI0E04860 Chr5 (1103131..1104102) [972 bp, 323 aa] {ON} Anc_7....    44   5e-04
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...    44   6e-04
KAFR0F02770 Chr6 complement(547451..549682) [2232 bp, 743 aa] {O...    44   6e-04
TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {O...    44   6e-04
NCAS0A05830 Chr1 complement(1146244..1147188) [945 bp, 314 aa] {...    44   6e-04
Kpol_1026.16 s1026 (34514..35347) [834 bp, 277 aa] {ON} (34514.....    44   6e-04
KLTH0D09262g Chr4 (769384..770055) [672 bp, 223 aa] {ON} similar...    43   6e-04
ZYRO0F12716g Chr6 (1035111..1035743) [633 bp, 210 aa] {ON} simil...    43   6e-04
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...    44   7e-04
Kpol_1029.3 s1029 complement(3577..4251) [675 bp, 224 aa] {ON} c...    43   7e-04
TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {O...    44   7e-04
KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} simila...    44   7e-04
KLTH0H00792g Chr8 (88079..90586) [2508 bp, 835 aa] {ON} some sim...    44   7e-04
Ecym_4467 Chr4 complement(951838..952359) [522 bp, 173 aa] {ON} ...    42   8e-04
Smik_7.239 Chr7 complement(407397..408296) [900 bp, 299 aa] {ON}...    43   8e-04
YGL044C Chr7 complement(416146..417036) [891 bp, 296 aa] {ON}  R...    43   8e-04
KAFR0K01050 Chr11 complement(216574..217038) [465 bp, 154 aa] {O...    42   8e-04
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...    44   8e-04
Smik_3.71 Chr3 complement(100547..101833) [1287 bp, 428 aa] {ON}...    44   8e-04
TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON} Anc_1...    43   9e-04
Skud_3.48 Chr3 complement(80985..82274) [1290 bp, 429 aa] {ON} Y...    44   0.001
KLLA0D13772g Chr4 (1185663..1186700) [1038 bp, 345 aa] {ON} some...    43   0.001
Suva_15.198 Chr15 (343049..345037) [1989 bp, 662 aa] {ON} YHR015...    44   0.001
KNAG0E03510 Chr5 complement(701816..702334) [519 bp, 172 aa] {ON...    42   0.001
YCL011C Chr3 complement(102075..103358) [1284 bp, 427 aa] {ON}  ...    43   0.001
KAFR0A00980 Chr1 complement(182578..184506) [1929 bp, 642 aa] {O...    44   0.001
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...    43   0.001
Suva_7.74 Chr7 complement(141302..142891) [1590 bp, 529 aa] {ON}...    43   0.001
TDEL0F02850 Chr6 (516483..517322) [840 bp, 279 aa] {ON} Anc_4.66...    42   0.001
TPHA0K01870 Chr11 (391768..392637) [870 bp, 289 aa] {ON} Anc_4.6...    42   0.001
YGL190C Chr7 complement(145809..147389) [1581 bp, 526 aa] {ON}  ...    43   0.001
TBLA0J01830 Chr10 complement(418200..418622) [423 bp, 140 aa] {O...    41   0.001
SAKL0D01958g Chr4 (151411..154248) [2838 bp, 945 aa] {ON} some s...    43   0.001
Kwal_0.250 s0 complement(122111..122758) [648 bp, 216 aa] {OFF} ...    42   0.001
Smik_7.83 Chr7 complement(140174..141754) [1581 bp, 526 aa] {ON}...    43   0.002
Kwal_YGOB_0.250 s0 complement(122081..122758) [678 bp, 226 aa] {...    42   0.002
Skud_7.83 Chr7 complement(151496..153076) [1581 bp, 526 aa] {ON}...    43   0.002
Kwal_26.8458 s26 (793431..794090) [660 bp, 219 aa] {ON} YNL110C ...    42   0.002
KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {...    42   0.002
Skud_13.439 Chr13 complement(776753..778090) [1338 bp, 445 aa] {...    42   0.002
NCAS0A02880 Chr1 complement(553819..555585) [1767 bp, 588 aa] {O...    42   0.002
NDAI0E00470 Chr5 complement(91514..92290) [777 bp, 258 aa] {ON} ...    42   0.002
Ecym_4446 Chr4 (912645..915212) [2568 bp, 855 aa] {ON} similar t...    43   0.002
TDEL0A03990 Chr1 complement(713693..714529) [837 bp, 278 aa] {ON...    42   0.002
Smik_8.80 Chr8 (114815..116827) [2013 bp, 670 aa] {ON} YHR015W (...    42   0.002
KLTH0F02838g Chr6 complement(245748..246740) [993 bp, 330 aa] {O...    42   0.002
ZYRO0G04004g Chr7 complement(327232..327735) [504 bp, 167 aa] {O...    40   0.003
Skud_16.399 Chr16 complement(714087..716726) [2640 bp, 879 aa] {...    42   0.003
TBLA0C02300 Chr3 (543570..546176) [2607 bp, 868 aa] {ON} Anc_3.4...    42   0.003
CAGL0D06182g Chr4 (581992..582834) [843 bp, 280 aa] {ON} similar...    41   0.003
NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167      41   0.003
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...    42   0.003
ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON} conse...    42   0.003
SAKL0F08866g Chr6 (678049..678054,678125..679027) [909 bp, 302 a...    41   0.003
Suva_7.231 Chr7 complement(407919..408848) [930 bp, 309 aa] {ON}...    41   0.003
CAGL0F08217g Chr6 complement(814508..816544) [2037 bp, 678 aa] {...    42   0.003
SAKL0F04400g Chr6 complement(355542..356108) [567 bp, 188 aa] {O...    40   0.003
CAGL0K00253g Chr11 complement(25117..25623) [507 bp, 168 aa] {ON...    40   0.004
YIL061C Chr9 complement(244657..245559) [903 bp, 300 aa] {ON}  S...    41   0.004
TDEL0G01000 Chr7 (206991..209408) [2418 bp, 805 aa] {ON} Anc_5.7...    42   0.004
KNAG0A07610 Chr1 complement(1194108..1196711) [2604 bp, 867 aa] ...    42   0.004
Suva_16.440 Chr16 complement(757046..759706) [2661 bp, 886 aa] {...    42   0.004
TBLA0D04850 Chr4 (1191350..1192639) [1290 bp, 429 aa] {ON} Anc_1...    41   0.004
YPR112C Chr16 complement(749256..751919) [2664 bp, 887 aa] {ON} ...    42   0.005
KNAG0B03650 Chr2 (702368..703207) [840 bp, 279 aa] {ON} Anc_5.53...    41   0.005
ZYRO0G19250g Chr7 (1595380..1596999) [1620 bp, 539 aa] {ON} high...    41   0.005
NDAI0A04750 Chr1 (1085815..1088346) [2532 bp, 843 aa] {ON} Anc_3...    41   0.005
KLTH0F13090g Chr6 complement(1079045..1079482) [438 bp, 145 aa] ...    39   0.006
KLLA0A05346g Chr1 (485886..488510) [2625 bp, 874 aa] {ON} some s...    41   0.006
Smik_16.355 Chr16 complement(627408..630068) [2661 bp, 886 aa] {...    41   0.006
ZYRO0E04928g Chr5 complement(374326..375537,375710..375727) [123...    41   0.006
Ecym_4071 Chr4 complement(153279..154091) [813 bp, 270 aa] {ON} ...    40   0.006
CAGL0B04169g Chr2 complement(404713..407298) [2586 bp, 861 aa] {...    41   0.007
TPHA0I00420 Chr9 (82903..84300) [1398 bp, 465 aa] {ON} Anc_8.822...    40   0.008
ZYRO0G07216g Chr7 (568877..569692) [816 bp, 271 aa] {ON} similar...    40   0.008
TDEL0B04610 Chr2 complement(821716..823281) [1566 bp, 521 aa] {O...    40   0.008
Smik_9.126 Chr9 complement(219413..220315) [903 bp, 300 aa] {ON}...    40   0.009
Kpol_1023.95 s1023 (221318..222142) [825 bp, 274 aa] {ON} (22131...    40   0.009
KLTH0F11968g Chr6 (1008620..1011259) [2640 bp, 879 aa] {ON} simi...    40   0.009
NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797      39   0.009
ZYRO0C12452g Chr3 complement(983386..985986) [2601 bp, 866 aa] {...    40   0.010
Ecym_7289 Chr7 complement(608012..610132) [2121 bp, 706 aa] {ON}...    40   0.010
YNL110C Chr14 complement(417826..418488) [663 bp, 220 aa] {ON}  ...    39   0.010
AGL038C Chr7 complement(639306..641444) [2139 bp, 712 aa] {ON} S...    40   0.010
ADR035C Chr4 complement(768390..770906) [2517 bp, 838 aa] {ON} S...    40   0.010
KNAG0L01580 Chr12 (280914..281831) [918 bp, 305 aa] {ON} Anc_7.2...    40   0.010
SAKL0H25014g Chr8 (2178085..2179431) [1347 bp, 448 aa] {ON} high...    40   0.011
Smik_14.217 Chr14 complement(397474..398136) [663 bp, 220 aa] {O...    39   0.011
KLTH0D02640g Chr4 complement(261313..262701) [1389 bp, 462 aa] {...    40   0.012
CAGL0H03861g Chr8 complement(361189..362520) [1332 bp, 443 aa] {...    40   0.012
ADL063W Chr4 (569852..569854,569912..570871) [963 bp, 320 aa] {O...    40   0.013
Skud_9.178 Chr9 complement(326982..327734) [753 bp, 250 aa] {ON}...    39   0.013
Kwal_27.10364 s27 (303432..304763) [1332 bp, 443 aa] {ON} YMR268...    40   0.013
KLTH0B02992g Chr2 complement(234560..235174) [615 bp, 204 aa] {O...    39   0.013
Suva_14.344 Chr14 (602901..602930,603310..604644) [1365 bp, 454 ...    40   0.015
NCAS0A13220 Chr1 (2600885..2601400) [516 bp, 171 aa] {ON} Anc_7....    38   0.015
KLLA0F18216g Chr6 (1677731..1679857) [2127 bp, 708 aa] {ON} some...    40   0.015
Kpol_2000.44 s2000 (86199..87215) [1017 bp, 338 aa] {ON} (86199....    39   0.016
ZYRO0C08382g Chr3 (639267..640181) [915 bp, 304 aa] {ON} similar...    39   0.016
KNAG0F02200 Chr6 (422342..422980) [639 bp, 212 aa] {ON} Anc_6.17...    39   0.016
YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-sn...    39   0.016
KNAG0D03250 Chr4 complement(580147..580956) [810 bp, 269 aa] {ON...    39   0.017
SAKL0H05192g Chr8 (466582..466661,466747..467632) [966 bp, 321 a...    39   0.018
ZYRO0B09790g Chr2 (765258..765854) [597 bp, 198 aa] {ON} similar...    38   0.019
KLLA0D08206g Chr4 (700152..701327) [1176 bp, 391 aa] {ON} simila...    39   0.019
Skud_14.222 Chr14 complement(408018..408680) [663 bp, 220 aa] {O...    39   0.019
Suva_14.229 Chr14 complement(414648..415316) [669 bp, 222 aa] {O...    39   0.021
Smik_14.324 Chr14 (581702..582988) [1287 bp, 428 aa] {ON} YNL004...    39   0.022
KAFR0B03680 Chr2 (767040..768365) [1326 bp, 441 aa] {ON} Anc_8.8...    39   0.022
KNAG0F01320 Chr6 complement(237828..239075) [1248 bp, 415 aa] {O...    39   0.024
ZYRO0B00924g Chr2 complement(71856..74432) [2577 bp, 858 aa] {ON...    39   0.024
KLTH0E06534g Chr5 complement(600189..601571) [1383 bp, 460 aa] {...    39   0.024
Smik_15.500 Chr15 (862344..862985) [642 bp, 213 aa] {ON} YOR319W...    38   0.025
Suva_9.140 Chr9 complement(235080..235988) [909 bp, 302 aa] {ON}...    39   0.028
TPHA0D03960 Chr4 complement(829035..831653) [2619 bp, 872 aa] {O...    39   0.030
YIR001C Chr9 complement(356143..356895) [753 bp, 250 aa] {ON}  S...    38   0.030
ZYRO0D12782g Chr4 complement(1077736..1078557) [822 bp, 273 aa] ...    38   0.031
AER285C Chr5 complement(1162117..1163397) [1281 bp, 426 aa] {ON}...    39   0.031
Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to...    38   0.032
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...    39   0.034
KNAG0I01230 Chr9 (230872..232332) [1461 bp, 486 aa] {ON} Anc_1.4...    39   0.035
Ecym_6211 Chr6 complement(393887..395530) [1644 bp, 547 aa] {ON}...    39   0.038
AFR195W Chr6 (792029..793393) [1365 bp, 454 aa] {ON} Syntenic ho...    38   0.038
KAFR0F03150 Chr6 complement(624522..625349) [828 bp, 275 aa] {ON...    38   0.038
KLLA0D14949g Chr4 complement(1259860..1262496) [2637 bp, 878 aa]...    39   0.040
KLTH0D04158g Chr4 (394755..395537) [783 bp, 260 aa] {ON} similar...    38   0.042
Ecym_7344 Chr7 (717321..718130) [810 bp, 269 aa] {ON} similar to...    38   0.044
Smik_9.200 Chr9 complement(332149..332898) [750 bp, 249 aa] {ON}...    38   0.044
TBLA0C04320 Chr3 (1040065..1040874) [810 bp, 269 aa] {ON} Anc_4....    38   0.046
CAGL0E03630g Chr5 complement(335328..337568) [2241 bp, 746 aa] {...    38   0.049
YNL004W Chr14 (622915..622944,623287..624621) [1365 bp, 454 aa] ...    38   0.050
Kwal_26.7522 s26 (402305..403093) [789 bp, 262 aa] {ON} YGL044C ...    37   0.051
Kwal_23.3985 s23 (510995..513625) [2631 bp, 876 aa] {ON} YPR112C...    38   0.051
NDAI0G05970 Chr7 complement(1475760..1477595) [1836 bp, 611 aa] ...    38   0.052
Skud_9.111 Chr9 complement(215540..216442) [903 bp, 300 aa] {ON}...    38   0.052
NCAS0A11540 Chr1 complement(2283352..2285961) [2610 bp, 869 aa] ...    38   0.053
Kwal_27.11096 s27 complement(635969..636574) [606 bp, 201 aa] {O...    37   0.054
KAFR0A05510 Chr1 (1098387..1100939) [2553 bp, 850 aa] {ON} Anc_3...    38   0.054
SAKL0H23298g Chr8 complement(2021024..2021797) [774 bp, 257 aa] ...    37   0.055
TDEL0H03080 Chr8 complement(508090..508917) [828 bp, 275 aa] {ON...    37   0.057
TPHA0D02400 Chr4 complement(496366..497247) [882 bp, 293 aa] {ON...    37   0.059
AGR010C Chr7 complement(736603..737403) [801 bp, 266 aa] {ON} Sy...    37   0.062
Ecym_6416 Chr6 (811576..812748) [1173 bp, 390 aa] {ON} similar t...    37   0.063
KLLA0F09053g Chr6 (842591..843949) [1359 bp, 452 aa] {ON} simila...    38   0.063
KLLA0B00979g Chr2 (77439..78467) [1029 bp, 342 aa] {ON} weakly s...    37   0.065
Suva_8.370 Chr8 (653473..654114) [642 bp, 213 aa] {ON} YOR319W (...    37   0.065
Skud_14.323 Chr14 (589699..589728,590087..591421) [1365 bp, 454 ...    37   0.066
KAFR0I02240 Chr9 complement(459158..460426) [1269 bp, 422 aa] {O...    37   0.070
Kpol_1027.25 s1027 complement(50581..52407) [1827 bp, 608 aa] {O...    38   0.070
Suva_9.210 Chr9 complement(343096..343848) [753 bp, 250 aa] {ON}...    37   0.071
NCAS0I00520 Chr9 complement(83655..85001) [1347 bp, 448 aa] {ON}...    37   0.076
YLL046C Chr12 complement(46714..47463) [750 bp, 249 aa] {ON}  RN...    37   0.083
KLTH0H05214g Chr8 (465108..465710) [603 bp, 200 aa] {ON} highly ...    36   0.085
Kpol_365.5 s365 (9615..10148,10369..11028) [1194 bp, 397 aa] {ON...    37   0.087
TPHA0O00720 Chr15 complement(136275..137711) [1437 bp, 478 aa] {...    37   0.091
TDEL0F03140 Chr6 complement(574041..576608) [2568 bp, 855 aa] {O...    37   0.093
KLTH0E06226g Chr5 (568785..571112) [2328 bp, 775 aa] {ON} weakly...    37   0.11 
NCAS0H02590 Chr8 complement(514898..515710) [813 bp, 270 aa] {ON...    36   0.12 
NCAS0E03280 Chr5 complement(650337..651302) [966 bp, 321 aa] {ON...    37   0.12 
TBLA0D01550 Chr4 complement(387300..388562) [1263 bp, 420 aa] {O...    37   0.12 
NCAS0B05510 Chr2 complement(1038543..1040039) [1497 bp, 498 aa] ...    37   0.13 
TBLA0A08550 Chr1 (2112176..2114533) [2358 bp, 785 aa] {ON} Anc_4...    37   0.13 
TDEL0F01640 Chr6 complement(302376..304346) [1971 bp, 656 aa] {O...    37   0.14 
SAKL0F06160g Chr6 complement(462236..464878) [2643 bp, 880 aa] {...    37   0.14 
TPHA0C03940 Chr3 complement(844251..844688) [438 bp, 145 aa] {ON...    35   0.14 
Kpol_1066.35 s1066 complement(57266..58168) [903 bp, 300 aa] {ON...    36   0.15 
KLLA0F09383g Chr6 (865710..866486) [777 bp, 258 aa] {ON} similar...    36   0.15 
KNAG0L00570 Chr12 complement(86604..87899) [1296 bp, 431 aa] {ON...    36   0.15 
ADR183C Chr4 complement(1024790..1025752) [963 bp, 320 aa] {ON} ...    36   0.16 
Suva_13.452 Chr13 complement(782217..783551) [1335 bp, 444 aa] {...    36   0.16 
KAFR0C02950 Chr3 complement(589512..590963) [1452 bp, 483 aa] {O...    36   0.17 
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...    36   0.18 
Ecym_4324 Chr4 complement(697762..698754,698828..698830) [996 bp...    36   0.18 
SAKL0H25366g Chr8 complement(2212946..2214826) [1881 bp, 626 aa]...    36   0.18 
KNAG0G01320 Chr7 (295446..296891) [1446 bp, 481 aa] {ON} Anc_8.1...    36   0.18 
NDAI0B01910 Chr2 complement(463465..464985) [1521 bp, 506 aa] {O...    36   0.19 
KNAG0I03040 Chr9 complement(605783..607876) [2094 bp, 697 aa] {O...    36   0.19 
Kpol_322.1 s322 complement(711..974) [264 bp, 87 aa] {ON} comple...    33   0.19 
Kpol_1018.135 s1018 (361521..364112) [2592 bp, 863 aa] {ON} (361...    36   0.19 
TBLA0G00910 Chr7 (221951..222784) [834 bp, 277 aa] {ON} Anc_5.53...    36   0.19 
CAGL0H04763g Chr8 (454589..455740) [1152 bp, 383 aa] {ON} highly...    36   0.20 
ADL126C Chr4 complement(469989..471389) [1401 bp, 466 aa] {ON} S...    36   0.21 
TBLA0F03500 Chr6 complement(861480..863774) [2295 bp, 764 aa] {O...    36   0.22 
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...    36   0.23 
Smik_4.703 Chr4 complement(1245222..1246046) [825 bp, 274 aa] {O...    35   0.25 
Skud_4.704 Chr4 complement(1244854..1245678) [825 bp, 274 aa] {O...    35   0.25 
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...    36   0.26 
YDR429C Chr4 complement(1324477..1325301) [825 bp, 274 aa] {ON} ...    35   0.28 
NDAI0C01030 Chr3 (199929..200780) [852 bp, 283 aa] {ON} Anc_5.53...    35   0.28 
Kpol_246.2 s246 (4897..6507) [1611 bp, 536 aa] {ON} (4897..6507)...    35   0.29 
ZYRO0D09482g Chr4 complement(808223..809092) [870 bp, 289 aa] {O...    35   0.31 
ZYRO0D05654g Chr4 complement(485258..486583) [1326 bp, 441 aa] {...    35   0.32 
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...    35   0.32 
TPHA0O01260 Chr15 (250335..252413) [2079 bp, 692 aa] {ON} Anc_1....    35   0.33 
KLTH0D12540g Chr4 complement(1025489..1026407,1026476..1026555) ...    35   0.35 
Smik_8.17 Chr8 (40206..42356) [2151 bp, 716 aa] {ON} YHL024W (REAL)    35   0.36 
KNAG0H01710 Chr8 (304440..304469,304846..306099) [1284 bp, 427 a...    35   0.38 
Suva_2.605 Chr2 complement(1077179..1078003) [825 bp, 274 aa] {O...    35   0.40 
Suva_8.27 Chr8 (58726..60849) [2124 bp, 707 aa] {ON} YHL024W (REAL)    35   0.40 
NCAS0C00510 Chr3 (83308..84645) [1338 bp, 445 aa] {ON} Anc_8.822...    35   0.40 
AFL050W Chr6 (345624..346280) [657 bp, 218 aa] {ON} Syntenic hom...    34   0.42 
CAGL0G05401g Chr7 complement(508557..510572) [2016 bp, 671 aa] {...    35   0.42 
KAFR0E03720 Chr5 complement(744915..745358,746003..746269) [711 ...    34   0.47 
NCAS0B04470 Chr2 complement(811894..813396) [1503 bp, 500 aa] {O...    35   0.47 
KLTH0G04114g Chr7 (328845..330074) [1230 bp, 409 aa] {ON} weakly...    35   0.49 
TBLA0A01830 Chr1 complement(446153..446839) [687 bp, 228 aa] {ON...    34   0.50 
KAFR0A04360 Chr1 (869776..870402) [627 bp, 208 aa] {ON} Anc_6.17...    34   0.51 
SAKL0F07326g Chr6 complement(560379..561308) [930 bp, 309 aa] {O...    34   0.52 
Kwal_47.18572 s47 complement(878877..879968) [1092 bp, 363 aa] {...    34   0.61 
Kpol_1069.8 s1069 (14170..15519) [1350 bp, 449 aa] {ON} (14170.....    34   0.67 
Kpol_1002.79 s1002 (208736..209365) [630 bp, 209 aa] {ON} (20873...    33   0.67 
ABL142C Chr2 complement(130839..131462) [624 bp, 207 aa] {ON} Sy...    33   0.69 
Skud_8.20 Chr8 (44743..46833) [2091 bp, 696 aa] {ON} YHL024W (REAL)    34   0.70 
TBLA0D02160 Chr4 complement(544468..546117) [1650 bp, 549 aa] {O...    34   0.73 
TPHA0K00500 Chr11 (99226..100041) [816 bp, 271 aa] {ON} Anc_5.53...    34   0.73 
YHL024W Chr8 (56649..58790) [2142 bp, 713 aa] {ON}  RIM4Putative...    34   0.75 
Kpol_193.1 s193 (1..1776) [1776 bp, 591 aa] {ON} (1..1776) [1776...    34   0.86 
Skud_4.706 Chr4 (1249139..1250398) [1260 bp, 419 aa] {ON} YDR432...    34   0.86 
Kwal_33.13496 s33 complement(251014..252006) [993 bp, 330 aa] {O...    34   0.89 
Smik_4.705 Chr4 (1249525..1250769) [1245 bp, 414 aa] {ON} YDR432...    34   0.95 
Kpol_1040.23 s1040 complement(65741..67144) [1404 bp, 467 aa] {O...    34   0.98 
CAGL0C01529g Chr3 (167802..168512) [711 bp, 236 aa] {ON} similar...    33   1.00 
ZYRO0D15224g Chr4 (1279820..1280080) [261 bp, 86 aa] {ON} weakly...    31   1.00 
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...    34   1.0  
NCAS0A08980 Chr1 (1778830..1780647) [1818 bp, 605 aa] {ON} Anc_1...    34   1.0  
KAFR0E03240 Chr5 complement(645818..646963) [1146 bp, 381 aa] {O...    33   1.0  
Suva_10.24 Chr10 complement(50291..51052) [762 bp, 253 aa] {ON} ...    33   1.1  
Kpol_1023.90 s1023 complement(213517..214764) [1248 bp, 415 aa] ...    33   1.2  
TDEL0F01800 Chr6 (337313..337972) [660 bp, 219 aa] {ON} Anc_6.17...    33   1.3  
Smik_12.12 Chr12 complement(31593..32339) [747 bp, 248 aa] {ON} ...    33   1.3  
TDEL0B00750 Chr2 (139060..140316) [1257 bp, 418 aa] {ON} Anc_8.8...    33   1.3  
SAKL0G05126g Chr7 complement(423140..423985) [846 bp, 281 aa] {O...    33   1.4  
NDAI0H01670 Chr8 (404385..405596) [1212 bp, 403 aa] {ON} Anc_5.5...    33   1.4  
KLTH0G03960g Chr7 complement(314167..315009) [843 bp, 280 aa] {O...    33   1.4  
TPHA0J02110 Chr10 complement(472245..473024) [780 bp, 259 aa] {O...    33   1.4  
SAKL0F04774g Chr6 (381688..382542) [855 bp, 284 aa] {ON} similar...    33   1.5  
Kpol_1030.41 s1030 complement(91357..93168) [1812 bp, 603 aa] {O...    33   1.7  
NCAS0A14270 Chr1 (2808773..2810638) [1866 bp, 621 aa] {ON} Anc_7...    33   1.7  
SAKL0G03080g Chr7 (255941..256189,256954..257346) [642 bp, 213 a...    32   1.8  
KAFR0D01270 Chr4 complement(256417..257748) [1332 bp, 443 aa] {O...    33   1.9  
KLTH0B07084g Chr2 (569812..570441) [630 bp, 209 aa] {ON} some si...    32   2.0  
Kwal_55.20903 s55 complement(604836..605279) [444 bp, 147 aa] {O...    32   2.0  
Smik_13.481 Chr13 complement(785925..787286) [1362 bp, 453 aa] {...    33   2.0  
KLLA0C07194g Chr3 (624694..625587) [894 bp, 297 aa] {ON} conserv...    32   2.0  
Suva_2.607 Chr2 (1081506..1082435) [930 bp, 309 aa] {ON} YDR432W...    33   2.0  
KLLA0B14432g Chr2 (1267069..1267110,1267269..1267877) [651 bp, 2...    32   2.1  
Smik_11.9 Chr11 complement(15279..15887) [609 bp, 202 aa] {ON} Y...    32   2.2  
TDEL0E00830 Chr5 (169821..170693) [873 bp, 290 aa] {ON} Anc_3.74...    32   2.2  
KNAG0K00460 Chr11 (77388..79508) [2121 bp, 706 aa] {ON} Anc_5.76...    33   2.5  
NCAS0F01150 Chr6 (227262..228401) [1140 bp, 379 aa] {ON} Anc_5.5...    32   2.5  
TBLA0A02650 Chr1 complement(642309..642773,643714..643995) [747 ...    32   2.6  
CAGL0L06182g Chr12 (702461..703948) [1488 bp, 495 aa] {ON} highl...    32   2.7  
SAKL0G05258g Chr7 (432822..433937) [1116 bp, 371 aa] {ON} weakly...    32   2.8  
ZYRO0G19844g Chr7 (1642204..1642860) [657 bp, 218 aa] {ON} highl...    32   2.8  
Ecym_4483 Chr4 (978489..979556) [1068 bp, 355 aa] {ON} similar t...    32   2.9  
YMR268C Chr13 complement(802888..804222) [1335 bp, 444 aa] {ON} ...    32   3.0  
YDR432W Chr4 (1328783..1330027) [1245 bp, 414 aa] {ON}  NPL3RNA-...    32   3.0  
TPHA0F00350 Chr6 (75008..77479) [2472 bp, 823 aa] {ON} Anc_4.33 ...    32   3.3  
ZYRO0D12892g Chr4 (1087239..1088474) [1236 bp, 411 aa] {ON} weak...    32   3.3  
Kwal_30.12890 s30 (3814..4656) [843 bp, 280 aa] {ON} YDR429C (TI...    32   3.5  
NCAS0A01520 Chr1 (296107..298764) [2658 bp, 885 aa] {ON} Anc_5.2...    32   3.5  
TPHA0K00460 Chr11 complement(92204..93433) [1230 bp, 409 aa] {ON...    32   3.5  
Ecym_2246 Chr2 (485381..486091) [711 bp, 236 aa] {ON} similar to...    32   3.8  
Ecym_6424 Chr6 (824599..825249) [651 bp, 216 aa] {ON} similar to...    31   4.1  
NDAI0A08510 Chr1 (1960682..1962106) [1425 bp, 474 aa] {ON} Anc_7...    32   4.1  
NDAI0B02680 Chr2 (668741..670354) [1614 bp, 537 aa] {ON}               32   4.3  
KLTH0D00946g Chr4 (89863..92082) [2220 bp, 739 aa] {ON} similar ...    32   4.4  
Kwal_26.7179 s26 complement(251330..252700) [1371 bp, 456 aa] {O...    32   4.6  
TDEL0A04050 Chr1 (722870..724075) [1206 bp, 401 aa] {ON} Anc_5.5...    32   5.0  
SAKL0G12474g Chr7 complement(1060462..1061016) [555 bp, 184 aa] ...    31   5.0  
TBLA0C04680 Chr3 complement(1139364..1140479) [1116 bp, 371 aa] ...    32   5.2  
SAKL0C03388g Chr3 complement(318605..320548) [1944 bp, 647 aa] {...    32   5.6  
SAKL0A05588g Chr1 (505510..506133) [624 bp, 207 aa] {ON} highly ...    31   5.7  
TDEL0H03570 Chr8 (590287..591546) [1260 bp, 419 aa] {ON} Anc_7.9...    31   5.8  
SAKL0F03982g Chr6 complement(319563..319895) [333 bp, 110 aa] {O...    30   5.8  
Kpol_478.5 s478 (22217..24601) [2385 bp, 794 aa] {ON} (22217..24...    32   6.0  
CAGL0A04213g Chr1 (416929..418848) [1920 bp, 639 aa] {ON} simila...    31   6.7  
CAGL0F01023g Chr6 complement(108155..109345) [1191 bp, 396 aa] {...    31   7.1  
SAKL0F11924g Chr6 (925625..927466) [1842 bp, 613 aa] {ON} some s...    31   7.9  
NCAS0A11840 Chr1 (2349268..2349549,2350293..2350700) [690 bp, 22...    30   7.9  
Ecym_4077 Chr4 (162858..163817) [960 bp, 319 aa] {ON} similar to...    31   7.9  

>KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 475

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/445 (76%), Positives = 341/445 (76%)

Query: 1   MSAEESQQAQTETXXXXXXXXXXXEQDHSNEATTTVEEKXXXXXXXXXXXXXXXXXXXXX 60
           MSAEESQQAQTET           EQDHSNEATTTVEEK                     
Sbjct: 1   MSAEESQQAQTETAAPVPVPAPAVEQDHSNEATTTVEEKSPGAATTAPATEEAPASEKPA 60

Query: 61  XQDNNXXXXXXXXXXXXXXXSAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIG 120
            QDNN               SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIG
Sbjct: 61  SQDNNGDGEKQQEEGDEEDDSAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIG 120

Query: 121 GSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNS 180
           GSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNS
Sbjct: 121 GSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNS 180

Query: 181 DETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQV 240
           DETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQV
Sbjct: 181 DETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQV 240

Query: 241 AMETKQGFELNGRALRINWASKREPQQSQQGQRRFNGPASGRGGFRXXXXXXXXXXXXXG 300
           AMETKQGFELNGRALRINWASKREPQQSQQGQRRFNGPASGRGGFR             G
Sbjct: 241 AMETKQGFELNGRALRINWASKREPQQSQQGQRRFNGPASGRGGFRNNNNQNQNHHNHNG 300

Query: 301 INRHAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMMRRAPPRVTT 360
           INRHAG                                           MMRRAPPRVTT
Sbjct: 301 INRHAGPPPHHQMQSHLPPQLQQQPPIGIPPIHQAPLVPPPVDPEAVEDMMRRAPPRVTT 360

Query: 361 AYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNFPFQ 420
           AYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNFPFQ
Sbjct: 361 AYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNFPFQ 420

Query: 421 GRNLRTGWGKEKPTFIRPQQQMGPI 445
           GRNLRTGWGKEKPTFIRPQQQMGPI
Sbjct: 421 GRNLRTGWGKEKPTFIRPQQQMGPI 445

>ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 410

 Score =  407 bits (1045), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 209/366 (57%), Positives = 245/366 (66%), Gaps = 13/366 (3%)

Query: 82  AAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAF 141
             P  AT+GGRE SD++LYVGNL KSI +++L+QYFQ+GG IS+VK++ DKN+   NYAF
Sbjct: 41  VVPANATKGGRETSDRVLYVGNLDKSITEEVLRQYFQVGGQISNVKVMIDKNNARANYAF 100

Query: 142 VEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDE-TFNLFVGDLNVDVDDATL 200
           VEYF+ HDAN+A QTLNGK++E  V++INWAFQSQQ   DE T+NLFVGDL+VDVDD TL
Sbjct: 101 VEYFKSHDANIALQTLNGKQIENNVVRINWAFQSQQALPDENTYNLFVGDLSVDVDDETL 160

Query: 201 AGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
              F+ FPSFIQ HVMWDMQ+G SRGYGFVSFG+Q+QAQ+AM++ Q  ELNGR LRINWA
Sbjct: 161 CNAFRSFPSFIQGHVMWDMQTGGSRGYGFVSFGDQEQAQLAMDSMQSQELNGRPLRINWA 220

Query: 261 SKREPQQSQQGQRRFNGPASGRGGFRXXXXXXXXXXXXXGINRHAGXXXXXXXXXXXXXX 320
           SKRE      G RR     +  GG R             G  R                 
Sbjct: 221 SKRE--NHHNGNRRGGLAGNRNGGMR------LFPNNNNGFGRGMPMPPPNSMGIPLGGT 272

Query: 321 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXMMRRAPP-RVTTAYIGNIPHFAQEHDLIPLL 379
                                         M R  P RVTT+YIGNIPHFA + DLIPLL
Sbjct: 273 LPPNAQPMGAPPSGPAPTVPPPVNPQAVEAMIRRAPPRVTTSYIGNIPHFATDSDLIPLL 332

Query: 380 QNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNFPFQGRNLRTGWGKEKPTFI--- 436
           QNFGFI+DFKHYPEKGCCF+KYDTHEQAA+CIVAL NF FQGRNLRTGWGKE+ TF+   
Sbjct: 333 QNFGFILDFKHYPEKGCCFVKYDTHEQAAVCIVALANFFFQGRNLRTGWGKERTTFVPMA 392

Query: 437 RPQQQM 442
           +PQQ M
Sbjct: 393 QPQQPM 398

>Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar to
           Ashbya gossypii AGR390C
          Length = 421

 Score =  321 bits (823), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 176/205 (85%), Gaps = 6/205 (2%)

Query: 82  AAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAF 141
             PVLAT+GGRE SD+ILYVGNL K+I++D LKQYFQ+GG I++VK++ DKN++E NYAF
Sbjct: 48  VTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAF 107

Query: 142 VEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLA 201
           VEY +PHDANVA+QTL+GK++EG V+KINWAFQSQ V+SD+TFNLFVGDLNVDVDD TL 
Sbjct: 108 VEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLT 167

Query: 202 GTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWAS 261
           GTFKEFPSFIQAHVMWDM SGRSRGYGFVSF EQD AQ AME+KQGF LNGRA+RINWAS
Sbjct: 168 GTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227

Query: 262 KREPQQSQQGQRRFNGPASGRGGFR 286
           KREPQQ Q        P S RGGFR
Sbjct: 228 KREPQQHQP------RPRSNRGGFR 246

 Score =  184 bits (467), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 88/101 (87%), Gaps = 6/101 (5%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           M+RRAP RVTTAYIGNIPHFAQE DLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAA+
Sbjct: 305 MIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAV 364

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFI------RPQQQMGP 444
           CIVAL NFPFQGRNLRTGWGKEKP FI       PQQ + P
Sbjct: 365 CIVALANFPFQGRNLRTGWGKEKPAFIPNGMVPPPQQLLHP 405

>AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL016W
           (PUB1)
          Length = 378

 Score =  308 bits (788), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 175/203 (86%), Gaps = 7/203 (3%)

Query: 84  PVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVE 143
           PVLAT+GGRE SD+ILYVGNL K+I++  LKQYFQ+GG I++VK++ DKN++E NYAFVE
Sbjct: 22  PVLATKGGRETSDRILYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFVE 81

Query: 144 YFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGT 203
           Y +P DANVA+QTL+GK++E  V+KINWAFQSQQV+SD+TFNLFVGDLNVDVDD TL+ T
Sbjct: 82  YRQPRDANVAFQTLDGKQIENNVIKINWAFQSQQVSSDDTFNLFVGDLNVDVDDETLSST 141

Query: 204 FKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           FKEFP+FIQAHVMWDMQSGRSRGYGFVSFGEQ++AQ AM+ KQGF LNGRA+R+NWA+KR
Sbjct: 142 FKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAKR 201

Query: 264 EPQQSQQGQRRFNGPASGRGGFR 286
           E Q + +       P S RGGFR
Sbjct: 202 ESQHAAR-------PRSNRGGFR 217

 Score =  178 bits (451), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 78/87 (89%), Positives = 82/87 (94%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           M+RRAP RVTTAYIGNIPHFAQE DLIPLLQNFGFIIDFKHY EKGCCFIKYDTH+QAAL
Sbjct: 262 MIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYAEKGCCFIKYDTHDQAAL 321

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFI 436
           CIVAL NFPFQGR LRTGWGKEKP+F+
Sbjct: 322 CIVALANFPFQGRTLRTGWGKEKPSFV 348

>SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {ON}
           some similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 401

 Score =  298 bits (762), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 158/182 (86%)

Query: 83  APVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFV 142
            P    +GGRE SDKILYVGNL KSI +DLLKQYFQ+GG +++VKI+ DKN+QE NYAFV
Sbjct: 30  TPANVARGGRETSDKILYVGNLDKSITEDLLKQYFQVGGPVANVKILVDKNNQEANYAFV 89

Query: 143 EYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAG 202
           EY +PHDANVA+QTL+GK +E   +KINWAFQS QV SDE+FNLFVGDLNVDVDD TLA 
Sbjct: 90  EYHKPHDANVAFQTLDGKTIENNQIKINWAFQSHQVASDESFNLFVGDLNVDVDDETLAN 149

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F EF +FIQAHVMWDMQSGRSRGYGFVSFGEQ+QAQ AMETKQGFELNGRA+RINWASK
Sbjct: 150 AFSEFSAFIQAHVMWDMQSGRSRGYGFVSFGEQEQAQKAMETKQGFELNGRAIRINWASK 209

Query: 263 RE 264
           RE
Sbjct: 210 RE 211

 Score =  194 bits (492), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 85/96 (88%), Positives = 90/96 (93%), Gaps = 1/96 (1%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           M+RRAPPR+TTAYIGNIPHFA E DLIPLLQNFGFI+DFKHYPEKGCCFIKYDTHEQAA+
Sbjct: 289 MIRRAPPRITTAYIGNIPHFATEPDLIPLLQNFGFIVDFKHYPEKGCCFIKYDTHEQAAV 348

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFIRPQQQMGPI 445
           CIVAL NFPFQGRNLRTGWGKEKPTFI PQ Q GP+
Sbjct: 349 CIVALANFPFQGRNLRTGWGKEKPTFI-PQHQQGPV 383

>KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some
           similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 436

 Score =  287 bits (734), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 162/184 (88%)

Query: 81  SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYA 140
           +  P  A++GGRE SD+ILYVGNL  ++ +++LKQYFQ+GGSI++VKI+ DKN+++ NYA
Sbjct: 51  TVTPANASRGGRETSDRILYVGNLDLAVTEEMLKQYFQVGGSIANVKILMDKNNKQANYA 110

Query: 141 FVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATL 200
           FVE+ +PHDANVA+QTL+GK++E  V+KINWAFQSQQV+S++TFNLFVGDLNVDVDD TL
Sbjct: 111 FVEFHQPHDANVAFQTLDGKQIENHVIKINWAFQSQQVSSEDTFNLFVGDLNVDVDDETL 170

Query: 201 AGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
           A TFK+ P+FIQAHVMWDMQ+GRSRGYGFVSFGEQ QAQ AME  QG  +NGRA+RINWA
Sbjct: 171 ARTFKDIPTFIQAHVMWDMQTGRSRGYGFVSFGEQTQAQKAMEDNQGAVVNGRAIRINWA 230

Query: 261 SKRE 264
           SKRE
Sbjct: 231 SKRE 234

 Score =  175 bits (444), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 76/94 (80%), Positives = 84/94 (89%), Gaps = 1/94 (1%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           MMR APPRVTT YIGNIPHFA E DLIPLLQNFGFI+DFKHYP++GCCFIKY THEQAA+
Sbjct: 312 MMRSAPPRVTTVYIGNIPHFATEQDLIPLLQNFGFIVDFKHYPDRGCCFIKYGTHEQAAV 371

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFIRPQQQMG 443
           CI+ L NFPFQGRNLRTGWGKEKP++I PQ + G
Sbjct: 372 CILTLGNFPFQGRNLRTGWGKEKPSYI-PQPKPG 404

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 22/46 (47%)

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           D +    RG  F+ +G  +QA V + T   F   GR LR  W  ++
Sbjct: 349 DFKHYPDRGCCFIKYGTHEQAAVCILTLGNFPFQGRNLRTGWGKEK 394

>Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {ON}
           YNL016W (PUB1) - poly(A)+ RNA-binding protein [contig
           27] FULL
          Length = 439

 Score =  287 bits (734), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 132/184 (71%), Positives = 162/184 (88%)

Query: 81  SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYA 140
           +  P  AT+GGRE SD+ILYVGNL  ++ +D+LKQYFQ+GG+I++VKI+ DKN++E NYA
Sbjct: 46  AVTPANATRGGRETSDRILYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEANYA 105

Query: 141 FVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATL 200
           FVE+ +PHDA+VA+QTL+GK++E  V+KIN+AFQSQQV+S++TFNLFVGDLNVDVDD TL
Sbjct: 106 FVEFHQPHDASVAFQTLDGKQIENHVIKINYAFQSQQVSSEDTFNLFVGDLNVDVDDETL 165

Query: 201 AGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
           A TFK  P+FIQAHVMWDMQ+GRSRGYGFVSFGEQ QAQ AME KQG  +NGRA+RINWA
Sbjct: 166 ANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRINWA 225

Query: 261 SKRE 264
           SKRE
Sbjct: 226 SKRE 229

 Score =  172 bits (435), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 1/93 (1%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           M+R AP RVTT YIGNIPHFA E DLIPLLQNFGFI+DFKHYP++GCCFIKY THEQAA+
Sbjct: 315 MIRSAPSRVTTVYIGNIPHFASEQDLIPLLQNFGFIVDFKHYPDRGCCFIKYGTHEQAAI 374

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFIRPQQQM 442
           CI+ L NFPFQGRNLRTGWGKEKPT++ PQ ++
Sbjct: 375 CILTLGNFPFQGRNLRTGWGKEKPTYV-PQPKL 406

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 22/46 (47%)

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           D +    RG  F+ +G  +QA + + T   F   GR LR  W  ++
Sbjct: 352 DFKHYPDRGCCFIKYGTHEQAAICILTLGNFPFQGRNLRTGWGKEK 397

>TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa]
           {ON} Anc_2.306 YNL016W
          Length = 470

 Score =  285 bits (728), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 131/190 (68%), Positives = 159/190 (83%)

Query: 81  SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYA 140
           +  P  A +GGRE SDKILYVGNL KSI++D LKQYFQ+GG I++VKII DKN++ CNYA
Sbjct: 67  NVVPANAIRGGRETSDKILYVGNLDKSINEDSLKQYFQVGGPIANVKIIVDKNNKYCNYA 126

Query: 141 FVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATL 200
           FVEY + HDANVA QTLNGK +E K++KINWAFQSQQ ++D+TFNLF+GDLN+DV+D +L
Sbjct: 127 FVEYLKHHDANVALQTLNGKHIEKKIVKINWAFQSQQSSNDDTFNLFIGDLNIDVNDESL 186

Query: 201 AGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
              FK+FPSF+QAHVMWDMQ+GRSRGYGF SF  Q+ AQ+AM+  QG ELNGR +RINWA
Sbjct: 187 TAAFKDFPSFVQAHVMWDMQTGRSRGYGFASFSTQNDAQLAMDQMQGKELNGRPIRINWA 246

Query: 261 SKREPQQSQQ 270
           SKR+ QQ QQ
Sbjct: 247 SKRDNQQGQQ 256

 Score =  173 bits (439), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 73/87 (83%), Positives = 81/87 (93%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           M+RRAPPRVTTAYIGN+P FA E DLIPLLQNFGFI+DFKHYP++G CFIKYDTHEQAA+
Sbjct: 330 MIRRAPPRVTTAYIGNLPRFATEADLIPLLQNFGFILDFKHYPDRGICFIKYDTHEQAAV 389

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFI 436
           CIVAL NFP QGRNL+TGWGKEKPTF+
Sbjct: 390 CIVALANFPLQGRNLKTGWGKEKPTFM 416

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 6/77 (7%)

Query: 187 FVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQ 246
           ++G+L     +A L    + F  FI      D +    RG  F+ +   +QA V +    
Sbjct: 342 YIGNLPRFATEADLIPLLQNF-GFI-----LDFKHYPDRGICFIKYDTHEQAAVCIVALA 395

Query: 247 GFELNGRALRINWASKR 263
            F L GR L+  W  ++
Sbjct: 396 NFPLQGRNLKTGWGKEK 412

>NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa]
           {ON} Anc_2.306
          Length = 443

 Score =  281 bits (718), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 129/185 (69%), Positives = 154/185 (83%), Gaps = 1/185 (0%)

Query: 81  SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYA 140
           S  P  ATQGGRE SD++LYVGNL KSI++DLLKQYFQ+GG I+ VKI+ DK +   NYA
Sbjct: 67  SVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYA 126

Query: 141 FVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQV-NSDETFNLFVGDLNVDVDDAT 199
           F+EY + HDANVA QTLNG ++EGK ++INWAFQSQQ  NSD+TFNLFVGDLNVDVDD T
Sbjct: 127 FIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDET 186

Query: 200 LAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINW 259
           L+  F +FPS++QAHVMWDMQ+GRSRGYGFVSF +Q+QAQ AM   QG  +NGRA+RINW
Sbjct: 187 LSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINW 246

Query: 260 ASKRE 264
           A+KRE
Sbjct: 247 ATKRE 251

 Score =  182 bits (462), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 78/87 (89%), Positives = 82/87 (94%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           M+RRAPPRVTTAYIGNIPHFA E DLIPLLQNFGFI+DF HYPEKGCCFIKYDTHEQAA+
Sbjct: 316 MIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTHEQAAV 375

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFI 436
           CIVAL NFPFQGRNLRTGWGKE+ TFI
Sbjct: 376 CIVALANFPFQGRNLRTGWGKERNTFI 402

>NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {ON}
           Anc_6.104 YBR212W
          Length = 499

 Score =  280 bits (716), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 129/185 (69%), Positives = 156/185 (84%), Gaps = 1/185 (0%)

Query: 81  SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYA 140
           +  P  AT GGRE SD++LYVGNL KSI++DLLKQYFQ+GG I+ VKI+ DK +Q  NYA
Sbjct: 71  NVVPASATHGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNQNVNYA 130

Query: 141 FVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQ-VNSDETFNLFVGDLNVDVDDAT 199
           FVEY + HDANVA QTLNG ++E K++KINWAFQSQQ +NS++TFNLFVGDLN+DVDD T
Sbjct: 131 FVEYLKSHDANVALQTLNGIQIENKIIKINWAFQSQQNLNSNDTFNLFVGDLNIDVDDET 190

Query: 200 LAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINW 259
           L+  FK FPS+IQAHVMWDMQ+ RSRGYGFVSF ++DQAQ AM+T QG E+NGR +RINW
Sbjct: 191 LSSNFKNFPSYIQAHVMWDMQTSRSRGYGFVSFADRDQAQNAMDTMQGKEINGRPIRINW 250

Query: 260 ASKRE 264
           A+KRE
Sbjct: 251 ATKRE 255

 Score =  181 bits (458), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 77/87 (88%), Positives = 81/87 (93%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           M+RRAPPRVTTAYIGNIPHFA E DLIPLLQ FGFI+DF HYPEKGCCFIKYDTHEQAA+
Sbjct: 357 MIRRAPPRVTTAYIGNIPHFATEADLIPLLQTFGFILDFSHYPEKGCCFIKYDTHEQAAV 416

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFI 436
           CIVAL NFPFQGRNLRTGWGKE+ TFI
Sbjct: 417 CIVALANFPFQGRNLRTGWGKERTTFI 443

>Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 aa]
           {ON} YNL016W (REAL)
          Length = 457

 Score =  278 bits (710), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 129/206 (62%), Positives = 161/206 (78%)

Query: 81  SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYA 140
           S  P  A  GGRE SD++LYVGNL K+I +D+LKQYFQ+GG I+++KI+ DKN++  NYA
Sbjct: 60  SVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYA 119

Query: 141 FVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATL 200
           FVEY + HDAN+A QTLNGK++E  V+KINWAFQSQQ +SD+TFNLFVGDLNV+VDD TL
Sbjct: 120 FVEYHQSHDANIALQTLNGKQIENNVVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETL 179

Query: 201 AGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
              FK+FPS++  HVMWDMQ+G SRGYGFVSF  QD AQ AM++ QG +LNGR LRINWA
Sbjct: 180 RNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWA 239

Query: 261 SKREPQQSQQGQRRFNGPASGRGGFR 286
           +KR+   +    +R N   + RGGFR
Sbjct: 240 AKRDNNNTNNYPQRRNYGNNNRGGFR 265

 Score =  174 bits (441), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (91%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           ++R APPRVTTAYIGNIPHFA E DLIPL QNFGFI+DFKHYPEKGCCFIKYDTHEQAA+
Sbjct: 334 IIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAV 393

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFI 436
           CIVAL NFPFQGRNLRTGWGKE+  F+
Sbjct: 394 CIVALANFPFQGRNLRTGWGKERSNFM 420

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 6/77 (7%)

Query: 187 FVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQ 246
           ++G++     +A L   F+ F  FI      D +    +G  F+ +   +QA V +    
Sbjct: 346 YIGNIPHFATEADLIPLFQNF-GFI-----LDFKHYPEKGCCFIKYDTHEQAAVCIVALA 399

Query: 247 GFELNGRALRINWASKR 263
            F   GR LR  W  +R
Sbjct: 400 NFPFQGRNLRTGWGKER 416

>Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {ON}
           complement(70168..71496) [1329 nt, 443 aa]
          Length = 442

 Score =  274 bits (701), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 152/185 (82%), Gaps = 2/185 (1%)

Query: 81  SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYA 140
           S  P  A  GGRE SDKILYVGNL KSI++D+LKQYFQ+GG I++VK+I DKN+ E NYA
Sbjct: 61  SIVPANAINGGRETSDKILYVGNLDKSINEDILKQYFQVGGPITNVKVINDKNN-EANYA 119

Query: 141 FVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQ-VNSDETFNLFVGDLNVDVDDAT 199
           FVEY + HDA++A +TLNGK++E   LKINWAFQSQQ   SDETFNLF+GDLNVDVDD T
Sbjct: 120 FVEYSQHHDASIALKTLNGKQIENNTLKINWAFQSQQNTTSDETFNLFIGDLNVDVDDET 179

Query: 200 LAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINW 259
           L   FK+F SFIQAHVMWDMQ+GRSRGYGFVSF   D AQVAM+T QG ELNGR LRINW
Sbjct: 180 LVAAFKDFKSFIQAHVMWDMQTGRSRGYGFVSFSNLDDAQVAMDTMQGSELNGRQLRINW 239

Query: 260 ASKRE 264
           ASKRE
Sbjct: 240 ASKRE 244

 Score =  171 bits (432), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 83/100 (83%), Gaps = 5/100 (5%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           M+RRAP RVTT YIGNIPHFA E DLIPLLQNFGFI+DFKHYPEKG CFIKYDTHEQAA+
Sbjct: 315 MIRRAPQRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKHYPEKGNCFIKYDTHEQAAV 374

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFI-----RPQQQMGP 444
           CIV L NFPFQGRNL+TGWGKEK TF+      P  QM P
Sbjct: 375 CIVVLANFPFQGRNLKTGWGKEKSTFMPMPPQDPNGQMPP 414

>TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.306
           YNL016W
          Length = 402

 Score =  273 bits (697), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 128/183 (69%), Positives = 152/183 (83%), Gaps = 1/183 (0%)

Query: 81  SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYA 140
           S  P  A +GGRE SDK+LYVGNL  SI++++LKQYFQ+GG I++VKI+ DKN+   NYA
Sbjct: 28  SVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNANYA 87

Query: 141 FVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDE-TFNLFVGDLNVDVDDAT 199
           FVEYF+ HDAN+A QTLNGK++E  V+KINWAFQSQQV+ DE TFNLFVGDLNVDVDD T
Sbjct: 88  FVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVDDET 147

Query: 200 LAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINW 259
           L   FKEFP+++Q HVMWDMQ+G SRGYGFVSFG Q++AQ AM+  QG ELNGR LRINW
Sbjct: 148 LRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLRINW 207

Query: 260 ASK 262
           ASK
Sbjct: 208 ASK 210

 Score =  181 bits (459), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 78/87 (89%), Positives = 83/87 (95%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           M+RRAPPRVTTAYIGNIPHFA E DLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAA+
Sbjct: 284 MIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAV 343

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFI 436
           CIVAL NFPFQGRNLRTGWGKE+ +F+
Sbjct: 344 CIVALANFPFQGRNLRTGWGKERTSFV 370

>Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016W
           (REAL)
          Length = 451

 Score =  273 bits (698), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 131/209 (62%), Positives = 162/209 (77%), Gaps = 4/209 (1%)

Query: 81  SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYA 140
           S  P  A  GGRE SDK+LYVGNL K+I +D+LKQYFQ+GG I+++KI+ DKN++  NYA
Sbjct: 57  SVVPANAITGGRETSDKVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYA 116

Query: 141 FVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATL 200
           FVEY + HDAN+A QTLNGK++E  ++KINWAFQSQQ +SD+TFNLFVGDLNV+VDD TL
Sbjct: 117 FVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETL 176

Query: 201 AGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
              FK+FPS++  HVMWDMQ+G SRGYGFVSF  QD AQ AM++ QG +LNGR LRINWA
Sbjct: 177 RNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWA 236

Query: 261 SKREPQQSQQG---QRRFNGPASGRGGFR 286
           +KR+   +      QRR  G  + RGGFR
Sbjct: 237 AKRDNNNNNNNNYPQRRNYG-NNNRGGFR 264

 Score =  174 bits (441), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (91%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           ++R APPRVTTAYIGNIPHFA E DLIPL QNFGFI+DFKHYPEKGCCFIKYDTHEQAA+
Sbjct: 332 IIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAV 391

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFI 436
           CIVAL NFPFQGRNLRTGWGKE+  F+
Sbjct: 392 CIVALANFPFQGRNLRTGWGKERSNFM 418

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 6/77 (7%)

Query: 187 FVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQ 246
           ++G++     +A L   F+ F  FI      D +    +G  F+ +   +QA V +    
Sbjct: 344 YIGNIPHFATEADLIPLFQNF-GFI-----LDFKHYPEKGCCFIKYDTHEQAAVCIVALA 397

Query: 247 GFELNGRALRINWASKR 263
            F   GR LR  W  +R
Sbjct: 398 NFPFQGRNLRTGWGKER 414

>CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]
           {ON} similar to uniprot|P32588 Saccharomyces cerevisiae
           YNL016w PUB1
          Length = 416

 Score =  271 bits (693), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 158/207 (76%), Gaps = 4/207 (1%)

Query: 81  SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYA 140
           S  P  AT+GGRE SD++LYVGNL KSI +DLLKQYFQ GG I +VKII D  ++  NYA
Sbjct: 42  SVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYA 101

Query: 141 FVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQV-NSDETFNLFVGDLNVDVDDAT 199
           FVEY   HDANVA QTLNG ++E K LKINWAF++QQ   +D+TFNLFVGDLNVDVDD T
Sbjct: 102 FVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDET 161

Query: 200 LAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINW 259
           LAGTF+EFP+FIQAHVMWDMQ+GRSRGYGFVSF  Q++AQ AM+  QG +L+GR +RINW
Sbjct: 162 LAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINW 221

Query: 260 ASKREPQQSQQGQRRFNGPASGRGGFR 286
           A+KRE      G    N   S  G FR
Sbjct: 222 ATKRE---RNMGNNFGNNRGSRGGNFR 245

 Score =  180 bits (457), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 86/97 (88%), Gaps = 4/97 (4%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           M+RRAPPRVTTAYIGNIPH+A E DLIPLLQNFGFI+DF HYPEKGCCFIKYDTHEQAA+
Sbjct: 306 MIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAV 365

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFIRPQ----QQM 442
           CIVAL NFPFQGRNLRTGWGKE+  F+ PQ    QQM
Sbjct: 366 CIVALANFPFQGRNLRTGWGKERTNFMPPQGAPGQQM 402

>Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016W
           (REAL)
          Length = 459

 Score =  272 bits (695), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 132/213 (61%), Positives = 162/213 (76%), Gaps = 8/213 (3%)

Query: 81  SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYA 140
           S  P  A  GGRE SD++LYVGNL K+I +D+LKQYFQ+GG I+++KI+ DKN++  NYA
Sbjct: 59  SVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYA 118

Query: 141 FVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATL 200
           FVEY + HDAN+A QTLNGK++E  ++KINWAFQSQQ +SD+TFNLFVGDLNV+VDD TL
Sbjct: 119 FVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETL 178

Query: 201 AGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
              FK+FPS++  HVMWDMQ+G SRGYGFVSF  QD AQ AM+T QG +LNGR LRINWA
Sbjct: 179 RNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDTMQGQDLNGRPLRINWA 238

Query: 261 SKREPQQSQQG-------QRRFNGPASGRGGFR 286
           +KR+   S          QRR  G  + RGGFR
Sbjct: 239 AKRDNNNSNNNNNNNNYPQRRNYG-NNNRGGFR 270

 Score =  174 bits (442), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (91%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           ++R APPRVTTAYIGNIPHFA E DLIPL QNFGFI+DFKHYPEKGCCFIKYDTHEQAA+
Sbjct: 338 IIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAV 397

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFI 436
           CIVAL NFPFQGRNLRTGWGKE+  F+
Sbjct: 398 CIVALANFPFQGRNLRTGWGKERSNFM 424

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 6/77 (7%)

Query: 187 FVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQ 246
           ++G++     +A L   F+ F  FI      D +    +G  F+ +   +QA V +    
Sbjct: 350 YIGNIPHFATEADLIPLFQNF-GFI-----LDFKHYPEKGCCFIKYDTHEQAAVCIVALA 403

Query: 247 GFELNGRALRINWASKR 263
            F   GR LR  W  +R
Sbjct: 404 NFPFQGRNLRTGWGKER 420

>YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly
           (A)+ RNA-binding protein, abundant mRNP-component
           protein that binds mRNA and is required for stability of
           many mRNAs; component of glucose deprivation induced
           stress granules, involved in P-body-dependent granule
           assembly
          Length = 453

 Score =  271 bits (693), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 129/206 (62%), Positives = 162/206 (78%)

Query: 81  SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYA 140
           S  P  A  GGRE SD++LYVGNL K+I +D+LKQYFQ+GG I+++KI+ DKN++  NYA
Sbjct: 59  SVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYA 118

Query: 141 FVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATL 200
           FVEY + HDAN+A QTLNGK++E  ++KINWAFQSQQ +SD+TFNLFVGDLNV+VDD TL
Sbjct: 119 FVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETL 178

Query: 201 AGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
              FK+FPS++  HVMWDMQ+G SRGYGFVSF  QD AQ AM++ QG +LNGR LRINWA
Sbjct: 179 RNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWA 238

Query: 261 SKREPQQSQQGQRRFNGPASGRGGFR 286
           +KR+   +   Q+R N   + RGGFR
Sbjct: 239 AKRDNNNNNNYQQRRNYGNNNRGGFR 264

 Score =  175 bits (443), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (91%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           ++R APPRVTTAYIGNIPHFA E DLIPL QNFGFI+DFKHYPEKGCCFIKYDTHEQAA+
Sbjct: 332 IIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAV 391

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFI 436
           CIVAL NFPFQGRNLRTGWGKE+  F+
Sbjct: 392 CIVALANFPFQGRNLRTGWGKERSNFM 418

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 6/77 (7%)

Query: 187 FVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQ 246
           ++G++     +A L   F+ F  FI      D +    +G  F+ +   +QA V +    
Sbjct: 344 YIGNIPHFATEADLIPLFQNF-GFI-----LDFKHYPEKGCCFIKYDTHEQAAVCIVALA 397

Query: 247 GFELNGRALRINWASKR 263
            F   GR LR  W  +R
Sbjct: 398 NFPFQGRNLRTGWGKER 414

>TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  268 bits (685), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 130/184 (70%), Positives = 148/184 (80%), Gaps = 2/184 (1%)

Query: 82  AAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAF 141
             P  A  GGRE SDKILYVGNL KSI+++ LKQYFQIGG IS+VK+I DKN+   NYAF
Sbjct: 64  VVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN-SVNYAF 122

Query: 142 VEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDET-FNLFVGDLNVDVDDATL 200
           VEY + HDA+VA++ LNGK +E KVLKINWAFQSQQ  SDE+ FNLFVGDLNVDVDD TL
Sbjct: 123 VEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETL 182

Query: 201 AGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
              F EFPSF+QAHVMWDMQ+GRSRGYGF+SF  Q+ AQ AM+  Q  ELNGR +RINWA
Sbjct: 183 GHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWA 242

Query: 261 SKRE 264
           SKRE
Sbjct: 243 SKRE 246

 Score =  169 bits (428), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 75/94 (79%), Positives = 81/94 (86%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           M+RRAP RVTT YIGNIPHFA E DLIPLLQNFGFI+DFK+YPEKG CFIKYDTHEQAA+
Sbjct: 316 MIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAV 375

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFIRPQQQMG 443
           CIV L N+PFQGRNL+TGWGKEK  FI   QQ G
Sbjct: 376 CIVVLANYPFQGRNLKTGWGKEKAVFIPMGQQQG 409

>KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  260 bits (664), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 124/189 (65%), Positives = 150/189 (79%), Gaps = 1/189 (0%)

Query: 82  AAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAF 141
             P  AT GGRE SD++LYVGNL KSI +D+LKQYFQ+ G I  VK++ DK S   NYAF
Sbjct: 64  VVPANATHGGRETSDRVLYVGNLDKSITEDILKQYFQVAGQIVDVKVMIDKKSNYVNYAF 123

Query: 142 VEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDE-TFNLFVGDLNVDVDDATL 200
           VEY + HDA+VA QTLNG ++E   +KIN AFQSQQ  +D+ TFNLFVGDLN+D+DD TL
Sbjct: 124 VEYAKAHDASVALQTLNGIQIENNKVKINRAFQSQQSTTDDSTFNLFVGDLNIDIDDDTL 183

Query: 201 AGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
           + +FK+FPS+IQAHVMWDMQ+GRSRGYGFVSF +Q+QAQ AME  QG ELNGR +RINWA
Sbjct: 184 SRSFKDFPSYIQAHVMWDMQTGRSRGYGFVSFADQEQAQKAMEEMQGKELNGRPIRINWA 243

Query: 261 SKREPQQSQ 269
           +KR+  Q Q
Sbjct: 244 TKRDNNQQQ 252

 Score =  173 bits (439), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 80/86 (93%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           M+RRAPPRV+TAYIGNIPHFA E DLIPLLQ+FGFI+DF HYPEKGCCFIKYDTHEQAA+
Sbjct: 330 MIRRAPPRVSTAYIGNIPHFATEADLIPLLQSFGFILDFTHYPEKGCCFIKYDTHEQAAV 389

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTF 435
           CIVAL NF FQGRNLRTGWGKE+ TF
Sbjct: 390 CIVALANFNFQGRNLRTGWGKERNTF 415

>KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {ON}
           Anc_2.306 YNL016W
          Length = 365

 Score =  251 bits (642), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 141/182 (77%), Gaps = 1/182 (0%)

Query: 84  PVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVE 143
           P  A +GGRE SDK+LY+GNL KSI++D LKQYFQ+ G I  VK++ DK +   NYAF+E
Sbjct: 18  PASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIVDVKVMVDKKNNHVNYAFIE 77

Query: 144 YFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQ-QVNSDETFNLFVGDLNVDVDDATLAG 202
           Y   HDANVA QTLNG ++E K +KINWAFQSQ  +N D +FNLF+GDLNV+VDD TLA 
Sbjct: 78  YSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTLAN 137

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            FK  P F+QAHVMWDMQ+ RSRGYGFVSF   + AQ AM+  QG E+NGRA+RINWA+K
Sbjct: 138 AFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATK 197

Query: 263 RE 264
           RE
Sbjct: 198 RE 199

 Score =  178 bits (452), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 77/87 (88%), Positives = 82/87 (94%)

Query: 350 MMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL 409
           M+RRAPPRVTTAYIGNIPHFA E DLIPLLQNFGFI+DF HYPEKGCCFIKYDTHEQAA+
Sbjct: 251 MIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHEQAAV 310

Query: 410 CIVALTNFPFQGRNLRTGWGKEKPTFI 436
           CIVAL+NF FQGRNLRTGWGKE+ TFI
Sbjct: 311 CIVALSNFQFQGRNLRTGWGKERSTFI 337

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 5/78 (6%)

Query: 362 YIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEK-----GCCFIKYDTHEQAALCIVALTN 416
           YIGN+     E  L    Q  G I+D K   +K        FI+Y T+  A + +  L  
Sbjct: 34  YIGNLDKSINEDALKQYFQVAGQIVDVKVMVDKKNNHVNYAFIEYSTNHDANVALQTLNG 93

Query: 417 FPFQGRNLRTGWGKEKPT 434
              + +N++  W  +  T
Sbjct: 94  IQIENKNIKINWAFQSQT 111

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 19/39 (48%)

Query: 225 RGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           +G  F+ +   +QA V +     F+  GR LR  W  +R
Sbjct: 295 KGCCFIKYDTHEQAAVCIVALSNFQFQGRNLRTGWGKER 333

>NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score = 90.9 bits (224), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 105/197 (53%), Gaps = 5/197 (2%)

Query: 81  SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNY 139
           ++ P  AT    E S   LYVG+L  S+ + LL   F   GS+SS+++  D  ++    Y
Sbjct: 27  TSTPSSATT---ENSSASLYVGDLDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGY 83

Query: 140 AFVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDAT 199
           A+V + +      A + LN   ++G++ +I W+ +   +    + N+F+ +L+ D+D+  
Sbjct: 84  AYVNFNDHEAGKKAIEKLNYTPIKGRLCRIMWSQRDPALRKKGSANIFIKNLHSDIDNKA 143

Query: 200 LAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINW 259
           L  TF  F + + + +  D ++G+S+G+GFV F +   A+ A++   G  LNG+ + +  
Sbjct: 144 LYDTFSVFGNILSSKIATD-ETGKSKGFGFVHFEDDTAAKEAIDALNGMLLNGQEIFVGP 202

Query: 260 ASKREPQQSQQGQRRFN 276
              R+ + SQ  + + N
Sbjct: 203 HLSRKERDSQLEESKAN 219

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 82/178 (46%), Gaps = 7/178 (3%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +++ NL   ID+  L   F + G+I S KI  D+  +   + FV + +   A 
Sbjct: 123 RKKGSANIFIKNLHSDIDNKALYDTFSVFGNILSSKIATDETGKSKGFGFVHFEDDTAAK 182

Query: 152 VAYQTLNGKEVEGKVLKINWAFQ-----SQQVNSDETF-NLFVGDLNVDVDDATLAGTFK 205
            A   LNG  + G+ + +          SQ   S   F N++V ++N++  D      F 
Sbjct: 183 EAIDALNGMLLNGQEIFVGPHLSRKERDSQLEESKANFTNIYVKNINLETTDEEFTELFS 242

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           ++   + A  +   + G+ +G+GFV F   + A  A+E   G +   + L ++ A K+
Sbjct: 243 KYGKVLSA-ALEKTEDGKLKGFGFVDFENHEDAAKAVEELNGSQFKDQELFVSRAQKK 299

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 90/191 (47%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +YV N+     D+   + F   G + S  +   ++ +   + FV++    DA  A + LN
Sbjct: 223 IYVKNINLETTDEEFTELFSKYGKVLSAALEKTEDGKLKGFGFVDFENHEDAAKAVEELN 282

Query: 159 GKEVEGKVLKINWA-------------FQSQQVNSDETF---NLFVGDLNVDVDDATLAG 202
           G + + + L ++ A             +++ ++     +   NLF+ +L+  +DD  L  
Sbjct: 283 GSQFKDQELFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFIKNLDDSIDDEKLKE 342

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  + +     VM   ++G+SRG+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 343 EFAPYGNITSVRVMR-TENGKSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 263 REPQQSQQGQR 273
           ++ ++SQ  Q+
Sbjct: 402 KDVRRSQLAQQ 412

>TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.229
           YER165W
          Length = 577

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 98/179 (54%), Gaps = 2/179 (1%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDANVAYQTL 157
           LYVG L  S+ + LL   F   GS+SS+++  D  ++    YA+V + +      A + L
Sbjct: 45  LYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKTAIEKL 104

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           N   ++G+  +I W+ +   +    + N+F+ +L+ D+D+ TL  TF  F + +   +  
Sbjct: 105 NYTAIKGRPCRIMWSQRDPSMRKKGSGNIFIKNLHPDIDNKTLYETFSVFGNILSCKIAN 164

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFN 276
           D ++G+S+G+GFV F  ++ A+ A++   G  LNG+ + +     ++ +QS+  + R N
Sbjct: 165 D-ETGKSKGFGFVHFENEEAAREAIDAINGMLLNGQEVYVAPHVSKKDRQSKLDEARAN 222

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 93/191 (48%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +YV NL     ++  +  F+  G+I+SV +  D   +   + FV++    DA  A + LN
Sbjct: 226 VYVKNLDLEATEEDFENLFKPYGTITSVALEKDAEGKSRGFGFVDFENHEDAVKAVEALN 285

Query: 159 GKEVEGKVLKINWA-------------FQSQQVNSDETF---NLFVGDLNVDVDDATLAG 202
             E +G+ L +  A             +Q+ ++     +   NLF+ +L+  +DD  L  
Sbjct: 286 DTEYKGQTLYVGRAQKKYERLQELKKQYQASKLEKLAKYQGINLFIKNLDDSIDDEKLKE 345

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  F +   A VM   ++G+S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 346 EFAPFGTITSARVMR-TENGKSKGFGFVCFSTPEEATRAITEKNQQIVAGKPLYVAIAQR 404

Query: 263 REPQQSQQGQR 273
           ++ ++SQ  Q+
Sbjct: 405 KDVRRSQLAQQ 415

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 85/178 (47%), Gaps = 7/178 (3%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +++ NL   ID+  L + F + G+I S KI  D+  +   + FV +     A 
Sbjct: 126 RKKGSGNIFIKNLHPDIDNKTLYETFSVFGNILSCKIANDETGKSKGFGFVHFENEEAAR 185

Query: 152 VAYQTLNGKEVEGKVLKI--NWAFQSQQVNSDET----FNLFVGDLNVDVDDATLAGTFK 205
            A   +NG  + G+ + +  + + + +Q   DE      N++V +L+++  +      FK
Sbjct: 186 EAIDAINGMLLNGQEVYVAPHVSKKDRQSKLDEARANFTNVYVKNLDLEATEEDFENLFK 245

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            + +     +  D + G+SRG+GFV F   + A  A+E     E  G+ L +  A K+
Sbjct: 246 PYGTITSVALEKDAE-GKSRGFGFVDFENHEDAVKAVEALNDTEYKGQTLYVGRAQKK 302

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 183 TFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAM 242
           T +L+VG+L+  V +A L   F    S     V  D  +  S GY +V+F + +  + A+
Sbjct: 42  TASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKTAI 101

Query: 243 ETKQGFELNGRALRINWASKREPQQSQQG 271
           E      + GR  RI W S+R+P   ++G
Sbjct: 102 EKLNYTAIKGRPCRIMW-SQRDPSMRKKG 129

>KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.229
           YER165W
          Length = 596

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 96/181 (53%), Gaps = 2/181 (1%)

Query: 90  GGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPH 148
           G  + +   LYVG L  S+ + LL   F   GS++S+++  D  ++    YA+V + +  
Sbjct: 40  GDNDVTSTSLYVGELDPSVSEALLYDLFSPIGSVASIRVCRDAITKTSLGYAYVNFSDHE 99

Query: 149 DANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFP 208
               A + LN   ++GK+ +I W+ +   +      N+F+ +LN D+D+  L  TF  F 
Sbjct: 100 AGKQAIEKLNYTPIKGKLCRIMWSQRDPSLRKKGHGNIFIKNLNQDIDNKALFDTFSVFG 159

Query: 209 SFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQS 268
           + + + +  D ++G+S+G+GFV F E+  A  A++   G  LNG+ + +     R+ + S
Sbjct: 160 NILSSKIATD-ETGKSKGFGFVHFEEESAANEAIDALNGMLLNGQEIYVAPHLTRKERDS 218

Query: 269 Q 269
           Q
Sbjct: 219 Q 219

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 93/191 (48%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +YV N+     D+  K++F   G+++SV +    + +   + FV Y + +DA  A + LN
Sbjct: 230 VYVKNIDLETTDEEFKEFFGKIGTVTSVALERGPDGKLKGFGFVNYEDHNDAVKAVEELN 289

Query: 159 GKEVEGKVLKINWA------FQSQQVNSDET----------FNLFVGDLNVDVDDATLAG 202
           G E + + L +  A       QS +   + T           NLFV +L+  +DD  L  
Sbjct: 290 GAEFKDQELFVGRAQKKYERIQSLKKQYESTRLEKMAKYQGVNLFVKNLDDSIDDEKLQE 349

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  F +     VM   ++G+S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 350 EFAPFGNITSVKVMR-TENGKSKGFGFVCFSSPEEATKAITEKNQQIVAGKPLYVAIAQR 408

Query: 263 REPQQSQQGQR 273
           ++ ++SQ  Q+
Sbjct: 409 KDVRRSQLAQQ 419

>Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON}
           (111076..112818) [1743 nt, 581 aa]
          Length = 580

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 92/172 (53%), Gaps = 2/172 (1%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDANVAYQTL 157
           LYVG L  S+ + LL   F   G +SS+++  D  ++    YA+V + +     VA + L
Sbjct: 53  LYVGELDPSVSEALLYDIFSPIGPVSSIRVCRDAVTKTSLGYAYVNFNDHDSGKVAIEKL 112

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           N   ++GK  +I W+ +   +  + + N+F+ +L+ D+D+  L  TF  F + +   +  
Sbjct: 113 NYTPIKGKPCRIMWSQRDPSMRKNGSGNIFIKNLHADIDNKALHDTFSVFGNILSCKIAT 172

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ 269
           D ++G+S+G+GFV F E   A  A++   G  LNG  + +     R+ ++S+
Sbjct: 173 D-ETGKSKGFGFVHFEEDTAASEAIDAINGMMLNGLEVYVAAHVSRKDRESK 223

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 77/169 (45%), Gaps = 17/169 (10%)

Query: 121 GSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINWA------FQ 174
           G I+S+ +  D   +   + FV Y     A  A   LN  E + + L +  A       Q
Sbjct: 256 GPITSISMEKDSEGKFRGFGFVNYENHESAAKAVDELNDLEFKSQKLYVGRAQKKYERLQ 315

Query: 175 SQQVNSDET----------FNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRS 224
             +   +E            NLFV +L+  +DD  L   F+ F +     VM + ++G+S
Sbjct: 316 ELKKQYEEAKLEKMAKYQGVNLFVKNLDDTIDDELLKKEFESFGTITSVKVMRN-ETGKS 374

Query: 225 RGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQR 273
           +G+GFV F   ++A  A+  K    + G+ L +  A +++ ++SQ  Q+
Sbjct: 375 KGFGFVCFSSPEEATRAITEKNQQIVAGKPLYVALAQRKDVRRSQLAQQ 423

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           L+V NL  +IDD+LLK+ F+  G+I+SVK++ ++  +   + FV +  P +A  A    N
Sbjct: 337 LFVKNLDDTIDDELLKKEFESFGTITSVKVMRNETGKSKGFGFVCFSSPEEATRAITEKN 396

Query: 159 GKEVEGKVLKINWA 172
            + V GK L +  A
Sbjct: 397 QQIVAGKPLYVALA 410

>KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.229
           YER165W
          Length = 582

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 98/179 (54%), Gaps = 2/179 (1%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDANVAYQTL 157
           LYVG+L  S+ + LL   F   GS++S+++  D  ++    YA+V + +     VA + L
Sbjct: 42  LYVGDLDPSVSEALLYDIFSPIGSVTSIRVCRDAITKTSLGYAYVNFADHEAGKVAIERL 101

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           N   ++G++ +I W+ +   +      N+F+ +LN D+D+  L  TF  F + + + +  
Sbjct: 102 NYTPIKGRLCRIMWSQRDPALRKKGNGNIFIKNLNADIDNKALYDTFSVFGNILSSKIAT 161

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFN 276
           D ++G S+G+GFV F E+  A+ A++   G  LNG+ + +     R+ + SQ  + R N
Sbjct: 162 D-ENGNSKGFGFVHFEEEAAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEKTRAN 219

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 91/191 (47%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +YV N+P    ++  K+ F+  G  SS+ +   ++ +   + FV Y    DA  A + LN
Sbjct: 223 VYVKNVPLDTTEEEFKELFEKPGKTSSIVLEKGEDGKLKGFGFVNYENHEDALKAVEELN 282

Query: 159 GKEVEGKVLKINWAFQS----------------QQVNSDETFNLFVGDLNVDVDDATLAG 202
             E +G+ L +  A +                 +++   +  NLF+ +L+  +DD  L  
Sbjct: 283 NTEFKGQELYVGRAQKKYERMQALKQQYEATRLEKMAKYQGVNLFIKNLDDSIDDEKLKE 342

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  F +     VM   ++G+S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 343 EFAPFGTITSTKVMR-TENGKSKGFGFVCFSSPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 263 REPQQSQQGQR 273
           +E ++SQ  Q+
Sbjct: 402 KEVRRSQLAQQ 412

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 52/98 (53%), Gaps = 2/98 (2%)

Query: 174 QSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFG 233
           + QQ +S+ T +L+VGDL+  V +A L   F    S     V  D  +  S GY +V+F 
Sbjct: 31  EGQQSDSNST-SLYVGDLDPSVSEALLYDIFSPIGSVTSIRVCRDAITKTSLGYAYVNFA 89

Query: 234 EQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQG 271
           + +  +VA+E      + GR  RI W S+R+P   ++G
Sbjct: 90  DHEAGKVAIERLNYTPIKGRLCRIMW-SQRDPALRKKG 126

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 84/178 (47%), Gaps = 7/178 (3%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K +  +++ NL   ID+  L   F + G+I S KI  D+N     + FV + E   A 
Sbjct: 123 RKKGNGNIFIKNLNADIDNKALYDTFSVFGNILSSKIATDENGNSKGFGFVHFEEEAAAK 182

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNS--DET----FNLFVGDLNVDVDDATLAGTFK 205
            A   LNG  + G+ + +      ++ +S  ++T     N++V ++ +D  +        
Sbjct: 183 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEKTRANFTNVYVKNVPLDTTEEEFKEL-F 241

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           E P    + V+   + G+ +G+GFV++   + A  A+E     E  G+ L +  A K+
Sbjct: 242 EKPGKTSSIVLEKGEDGKLKGFGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKK 299

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 394 KGCCFIKYDTHEQAALCIVALTNFPFQGRNLRTGWGKEK 432
           KG  F+ Y+ HE A   +  L N  F+G+ L  G  ++K
Sbjct: 261 KGFGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKK 299

>TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {ON}
           Anc_8.229 YER165W
          Length = 588

 Score = 88.6 bits (218), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 97/185 (52%), Gaps = 2/185 (1%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDAN 151
           E S   LYVG L  S+ + LL   F   GS+SS+++  D  ++    YA+V + +     
Sbjct: 38  ETSSASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGK 97

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFI 211
            A + LN   ++G   +I W+ +   +    + N+F+ +L+ D+D+  L  TF  F + +
Sbjct: 98  TAIEKLNYAPIKGVPCRIMWSQRDPSMRKKGSGNIFIKNLHPDIDNKALHDTFSVFGNIL 157

Query: 212 QAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQG 271
              +  D ++G SRG+GFV F + + A+ A++   G  LNG+ + +     ++ +QS+  
Sbjct: 158 SCKIATD-EAGNSRGFGFVHFEDDEAAKEAIDAINGMLLNGQEVYVAQHVSKKDRQSKLD 216

Query: 272 QRRFN 276
           + + N
Sbjct: 217 EAKAN 221

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 91/191 (47%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +YV N+     D+  +++F   G I+S  +  D   +   + FV Y   +DA  A + LN
Sbjct: 225 VYVKNIHPDTGDEEFEEFFTKVGPITSAHLEKDNEGKLRGFGFVNYENHNDAAKAVEELN 284

Query: 159 GKEVEGKVLKINWA----------------FQSQQVNSDETFNLFVGDLNVDVDDATLAG 202
             + +G+ L +  A                F+ +++   +  NLFV +L+  +DD  L  
Sbjct: 285 ETDFKGQTLHVGRAQKKHERLQELKKQYEAFRLEKLEKYQGVNLFVKNLDDTIDDQKLEE 344

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  + +     VM   ++G+S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 345 EFAPYGTITSVKVMRS-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 403

Query: 263 REPQQSQQGQR 273
           ++ ++SQ  Q+
Sbjct: 404 KDVRRSQLAQQ 414

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 82/178 (46%), Gaps = 7/178 (3%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +++ NL   ID+  L   F + G+I S KI  D+      + FV + +   A 
Sbjct: 125 RKKGSGNIFIKNLHPDIDNKALHDTFSVFGNILSCKIATDEAGNSRGFGFVHFEDDEAAK 184

Query: 152 VAYQTLNGKEVEGKVLKI--NWAFQSQQVNSDET----FNLFVGDLNVDVDDATLAGTFK 205
            A   +NG  + G+ + +  + + + +Q   DE      N++V +++ D  D      F 
Sbjct: 185 EAIDAINGMLLNGQEVYVAQHVSKKDRQSKLDEAKANFTNVYVKNIHPDTGDEEFEEFFT 244

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           +      AH+  D   G+ RG+GFV++   + A  A+E     +  G+ L +  A K+
Sbjct: 245 KVGPITSAHLEKD-NEGKLRGFGFVNYENHNDAAKAVEELNETDFKGQTLHVGRAQKK 301

>ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 88.2 bits (217), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 96/185 (51%), Gaps = 1/185 (0%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDAN 151
           E S   LYVG L  ++ + LL   F   GS+SS+++  D  ++    YA+V + +     
Sbjct: 36  ETSTASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDYEAGR 95

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFI 211
            A + LN   ++G+  +I W+ +   +    + N+F+ +L+ D+D+  L  TF  F + +
Sbjct: 96  QAIEKLNYTPIKGQPCRIMWSQRDPSLRKKGSGNIFIKNLHADIDNKALHDTFSVFGNIL 155

Query: 212 QAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQG 271
              +  D  +G S+G+GFV F   + A+ A++   G  LNG+ + +     R+ +QS+  
Sbjct: 156 SCKIATDEVTGNSKGFGFVHFESDEAAREAIDAINGMLLNGQEVYVAPHVSRKDRQSKLE 215

Query: 272 QRRFN 276
           + + N
Sbjct: 216 EAKAN 220

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 89/191 (46%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +Y+ N+     +   +++F+    ++SV +  D   +   + FV Y     A  A + LN
Sbjct: 224 VYIKNISLETPEQEFEEFFKKVAPVTSVHLEKDSEGKLRGFGFVNYETHAGAAKAVEELN 283

Query: 159 GKEVEGKVLKINWA-------------FQSQQVNSDETF---NLFVGDLNVDVDDATLAG 202
           G E  G+ L +  A             ++  ++   E +   NLF+ +L+  +DD  L  
Sbjct: 284 GVEFHGQQLHVGRAQKKYERQQELRRQYEQSKLEKMEKYQGVNLFIKNLDDSIDDERLRE 343

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  F +     VM   ++G+S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 344 EFSPFGTITSVKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 402

Query: 263 REPQQSQQGQR 273
           ++ ++SQ  Q+
Sbjct: 403 KDVRRSQLAQQ 413

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 87/185 (47%), Gaps = 8/185 (4%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDK-NSQECNYAFVEYFEPHDA 150
           R+K    +++ NL   ID+  L   F + G+I S KI  D+       + FV +     A
Sbjct: 123 RKKGSGNIFIKNLHADIDNKALHDTFSVFGNILSCKIATDEVTGNSKGFGFVHFESDEAA 182

Query: 151 NVAYQTLNGKEVEGKVLKI--NWAFQSQQVNSDET----FNLFVGDLNVDVDDATLAGTF 204
             A   +NG  + G+ + +  + + + +Q   +E      N+++ +++++  +      F
Sbjct: 183 REAIDAINGMLLNGQEVYVAPHVSRKDRQSKLEEAKANFTNVYIKNISLETPEQEFEEFF 242

Query: 205 KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKRE 264
           K+       H+  D + G+ RG+GFV++     A  A+E   G E +G+ L +  A K+ 
Sbjct: 243 KKVAPVTSVHLEKDSE-GKLRGFGFVNYETHAGAAKAVEELNGVEFHGQQLHVGRAQKKY 301

Query: 265 PQQSQ 269
            +Q +
Sbjct: 302 ERQQE 306

>Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 88.2 bits (217), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 96/178 (53%), Gaps = 2/178 (1%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDAN 151
           E S   LYVG+L  S+ +  L   F   GS+SS+++  D  ++    YA+V + +     
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFI 211
            A + LN   ++G++ +I W+ +   +    + N+F+ +L+ D+D+  L  TF  F   +
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDIL 153

Query: 212 QAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ 269
            + +  D ++G+S+G+GFV F E+  A+ A++   G  LNG+ + +     R+ + SQ
Sbjct: 154 SSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQ 210

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 85/178 (47%), Gaps = 7/178 (3%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +++ NL   ID+  L   F + G I S KI  D+N +   + FV + E   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNS--DET----FNLFVGDLNVDVDDATLAGTFK 205
            A   LNG  + G+ + +      ++ +S  +ET     NL+V ++N +  D      F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQDLFI 240

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           +F   + A +  D   G+ +G+GFV++   + A  A+E     +LNG  L +  A K+
Sbjct: 241 QFGPIVSASLEKDA-DGKLKGFGFVNYENHEDAVKAVEALNESDLNGEKLYVGRAQKK 297

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 91/191 (47%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           LYV N+     D+  +  F   G I S  +  D + +   + FV Y    DA  A + LN
Sbjct: 221 LYVKNINSETTDEQFQDLFIQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVEALN 280

Query: 159 GKEVEGK---------------VLKINW-AFQSQQVNSDETFNLFVGDLNVDVDDATLAG 202
             ++ G+               VLK  + A++ +++   +  NLFV +L+  VDD  L  
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  + +   A VM   ++G+S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 341 EFTPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 263 REPQQSQQGQR 273
           ++ ++SQ  Q+
Sbjct: 400 KDVRRSQLAQQ 410

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           +L+VGDL   V +A L   F    S     V  D  +  S GY +V+F + +  + A+E 
Sbjct: 39  SLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQ 98

Query: 245 KQGFELNGRALRINWASKREPQQSQQG 271
                + GR  RI W S+R+P   ++G
Sbjct: 99  LNYTPIKGRLCRIMW-SQRDPSLRKKG 124

>Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 88.2 bits (217), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 96/178 (53%), Gaps = 2/178 (1%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDAN 151
           E S   LYVG+L  S+ +  L   F   GS+SS+++  D  ++    YA+V + +     
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFI 211
            A + LN   ++G++ +I W+ +   +    + N+F+ +L+ D+D+  L  TF  F   +
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDIL 153

Query: 212 QAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ 269
            + +  D ++G+S+G+GFV F E+  A+ A++   G  LNG+ + +     R+ + SQ
Sbjct: 154 SSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQ 210

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 86/178 (48%), Gaps = 7/178 (3%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +++ NL   ID+  L   F + G I S KI  D+N +   + FV + E   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNS--DET----FNLFVGDLNVDVDDATLAGTFK 205
            A   LNG  + G+ + +      ++ +S  +ET     NL+V ++N +  D      F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHFTNLYVKNINSETTDEQFQELFA 240

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           +F   + A +  D   G+ +G+GFV++   + A  A+ET    ELNG  L +  A K+
Sbjct: 241 QFGPIVSASLEKDA-DGKLKGFGFVNYENHEDAVKAVETLNDSELNGEKLYVGRAQKK 297

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 93/191 (48%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           LYV N+     D+  ++ F   G I S  +  D + +   + FV Y    DA  A +TLN
Sbjct: 221 LYVKNINSETTDEQFQELFAQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVETLN 280

Query: 159 GKEVEGK---------------VLKINW-AFQSQQVNSDETFNLFVGDLNVDVDDATLAG 202
             E+ G+               VLK  + A++ +++   +  NLFV +L+  VDD  L  
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  + +   A VM   ++G+S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 263 REPQQSQQGQR 273
           ++ ++SQ  Q+
Sbjct: 400 KDVRRSQLAQQ 410

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           +L+VGDL   V +A L   F    S     V  D  +  S GY +V+F + +  + A+E 
Sbjct: 39  SLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQ 98

Query: 245 KQGFELNGRALRINWASKREPQQSQQG 271
                + GR  RI W S+R+P   ++G
Sbjct: 99  LNYTPIKGRLCRIMW-SQRDPSLRKKG 124

>YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A)
           binding protein, part of the 3'-end RNA-processing
           complex, mediates interactions between the 5' cap
           structure and the 3' mRNA poly(A) tail, involved in
           control of poly(A) tail length, interacts with
           translation factor eIF-4G
          Length = 577

 Score = 88.2 bits (217), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 96/178 (53%), Gaps = 2/178 (1%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDAN 151
           E S   LYVG+L  S+ +  L   F   GS+SS+++  D  ++    YA+V + +     
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFI 211
            A + LN   ++G++ +I W+ +   +    + N+F+ +L+ D+D+  L  TF  F   +
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDIL 153

Query: 212 QAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ 269
            + +  D ++G+S+G+GFV F E+  A+ A++   G  LNG+ + +     R+ + SQ
Sbjct: 154 SSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQ 210

 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 86/178 (48%), Gaps = 7/178 (3%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +++ NL   ID+  L   F + G I S KI  D+N +   + FV + E   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNS--DET----FNLFVGDLNVDVDDATLAGTFK 205
            A   LNG  + G+ + +      ++ +S  +ET     NL+V ++N +  D      F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           +F   + A +  D   G+ +G+GFV++ + + A  A+E     ELNG  L +  A K+
Sbjct: 241 KFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKK 297

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 93/191 (48%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           LYV N+     D+  ++ F   G I S  +  D + +   + FV Y +  DA  A + LN
Sbjct: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280

Query: 159 GKEVEGK---------------VLKINW-AFQSQQVNSDETFNLFVGDLNVDVDDATLAG 202
             E+ G+               VLK  + A++ +++   +  NLFV +L+  VDD  L  
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  + +   A VM   ++G+S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 263 REPQQSQQGQR 273
           ++ ++SQ  Q+
Sbjct: 400 KDVRRSQLAQQ 410

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 49/98 (50%), Gaps = 2/98 (2%)

Query: 174 QSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFG 233
           +SQ V  + + +L+VGDL   V +A L   F    S     V  D  +  S GY +V+F 
Sbjct: 29  ESQSV-ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFN 87

Query: 234 EQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQG 271
           + +  + A+E      + GR  RI W S+R+P   ++G
Sbjct: 88  DHEAGRKAIEQLNYTPIKGRLCRIMW-SQRDPSLRKKG 124

>KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} similar
           to uniprot|P04147 Saccharomyces cerevisiae YER165W PAB1
           Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 592

 Score = 87.8 bits (216), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 86/166 (51%), Gaps = 2/166 (1%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDAN 151
           E ++  LYVG L  +I + LL   F   G ISS+++  D  ++    YA+V Y +     
Sbjct: 46  ENNNASLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGK 105

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFI 211
            A Q LN  E+ G+  +I W+ +   +    + N+F+ +L+  +D+  L  TF  F   +
Sbjct: 106 KAIQELNYAEINGRPCRIMWSERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEVL 165

Query: 212 QAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRI 257
              V  D ++G SRG+GFV F E+  A+ A+E   G  +NG  + +
Sbjct: 166 SCKVALD-ENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGLEVYV 210

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 90/191 (47%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +YV N+     D+  +Q F   G I S  +  D   +   + FV + + + A  A + LN
Sbjct: 233 IYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELN 292

Query: 159 GKEVEGKVLKINWA----------------FQSQQVNSDETFNLFVGDLNVDVDDATLAG 202
           GKE + + L +  A                ++ +++   +  NLF+ +L+  +DD  L  
Sbjct: 293 GKEFKSQALYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKE 352

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  + +   A VM D Q G S+G+GFV F   ++A  AM  K    + G+ L +  A +
Sbjct: 353 EFAPYGTITSARVMRD-QEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQR 411

Query: 263 REPQQSQQGQR 273
           ++ ++SQ  Q+
Sbjct: 412 KDVRRSQLAQQ 422

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 89/179 (49%), Gaps = 9/179 (5%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +++ NL  +ID+  L + F   G + S K+  D+N     + FV + E  DA 
Sbjct: 133 RKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGNSRGFGFVHFKEESDAK 192

Query: 152 VAYQTLNGKEVEG-------KVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF 204
            A + +NG  + G        V K +   + ++  ++ T N++V +++V+  D      F
Sbjct: 193 DAIEAVNGMLMNGLEVYVAMHVPKKDRISKLEEAKANFT-NIYVKNIDVETTDEEFEQLF 251

Query: 205 KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            ++   + A +  D + G+ +G+GFV+F + + A  A+E   G E   +AL +  A K+
Sbjct: 252 SQYGEIVSAALEKDAE-GKPKGFGFVNFVDHNAAAKAVEELNGKEFKSQALYVGRAQKK 309

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 46/87 (52%), Gaps = 1/87 (1%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           +L+VG+L+ ++ +A L   F          V  D  +  S GY +V++ + +  + A++ 
Sbjct: 51  SLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQE 110

Query: 245 KQGFELNGRALRINWASKREPQQSQQG 271
               E+NGR  RI W S+R+P   ++G
Sbjct: 111 LNYAEINGRPCRIMW-SERDPAIRKKG 136

>CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165w PAB1 mRNA polyadenylate-binding protein
          Length = 579

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 93/168 (55%), Gaps = 3/168 (1%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDANVAYQTL 157
           LYVG+L  S+ +  L   F   G++SS+++  D  ++    YA+V + +   A  A + L
Sbjct: 37  LYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKL 96

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           N   ++GK+ +I W+ +   +      N+F+ +L+ D+D+  L  TF  F + + + V  
Sbjct: 97  NFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVAT 156

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRIN-WASKRE 264
           D ++G+S+G+G+V F E + A  A++   G  LNG+ + +    SK+E
Sbjct: 157 D-ETGKSKGFGYVHFEEDESASEAIDALNGMLLNGQEIYVGPHLSKKE 203

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 86/191 (45%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +Y+ N+     D   ++     G   SV +      +   + FV +    DA    + LN
Sbjct: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277

Query: 159 GKEVEGKVLKINWA---FQSQQ-------------VNSDETFNLFVGDLNVDVDDATLAG 202
             E +G+ L +N A   ++ QQ             +   +  NLF+ +L+  +DD  L  
Sbjct: 278 NTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEE 337

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  + +   A VM   ++G+S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 338 EFAPYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

Query: 263 REPQQSQQGQR 273
           ++ ++SQ  Q+
Sbjct: 397 KDVRRSQLAQQ 407

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 82/184 (44%), Gaps = 7/184 (3%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +++ NL   ID+  L   F + G+I S K+  D+  +   + +V + E   A+
Sbjct: 118 RKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESAS 177

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNSD------ETFNLFVGDLNVDVDDATLAGTFK 205
            A   LNG  + G+ + +      ++  S          N+++ ++N +  D        
Sbjct: 178 EAIDALNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVA 237

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREP 265
           +F     + V+     G ++G+GFV+F   + A   +E     E  G+ L +N A K+  
Sbjct: 238 KFGK-TDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYE 296

Query: 266 QQSQ 269
           +Q +
Sbjct: 297 RQQE 300

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 8/109 (7%)

Query: 170 NWAFQSQQVNSDE-------TFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSG 222
           N + Q +Q  ++E       + +L+VGDL+  V +A L   F    +     V  D  + 
Sbjct: 14  NLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITK 73

Query: 223 RSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQG 271
            S GY +V+F + D A+ A+E      + G+  RI W S+R+P   ++G
Sbjct: 74  TSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMW-SQRDPSLRKKG 121

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 5/79 (6%)

Query: 359 TTAYIGNIPHFAQEHDLIPLLQNFGFI--IDFKHYPE---KGCCFIKYDTHEQAALCIVA 413
           T  YI NI     + +   L+  FG    +  +  PE   KG  F+ +  HE A  C+  
Sbjct: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275

Query: 414 LTNFPFQGRNLRTGWGKEK 432
           L N  F+G+ L     ++K
Sbjct: 276 LNNTEFKGQPLYVNRAQKK 294

>NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {ON}
           Anc_8.229
          Length = 575

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 94/172 (54%), Gaps = 2/172 (1%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDANVAYQTL 157
           LYVG L  ++ + LL   F   GS+SS+++  D  ++    YA+V + +      A + L
Sbjct: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           N   ++G++ +I W+ +   +    + N+F+ +L+ D+D+  L  TF  F + + + +  
Sbjct: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ 269
           D ++G+S+G+GFV F  +  A+ A++   G  LNG+ + +     R+ + SQ
Sbjct: 157 D-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQ 207

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 91/191 (47%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +YV N+     D+   + F   G++ S  +   ++ +   + FV++ +  DA  A + LN
Sbjct: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277

Query: 159 GKEVEGKVLKINWA-------------FQSQQVNSDETF---NLFVGDLNVDVDDATLAG 202
           G E + + L ++ A             +++ ++     +   NLFV +L+  +DD  L  
Sbjct: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKE 337

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  + +     VM    +G+S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 338 EFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

Query: 263 REPQQSQQGQR 273
           ++ ++SQ  Q+
Sbjct: 397 KDVRRSQLAQQ 407

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           +L+VG+L+  V +A L   F    S     V  D  +  S GY +V+F + +  + A+E 
Sbjct: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95

Query: 245 KQGFELNGRALRINWASKREPQQSQQG 271
                + GR  RI W S+R+P   ++G
Sbjct: 96  LNYTPIKGRLCRIMW-SQRDPALRKKG 121

>TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {ON}
           Anc_8.229 YER165W
          Length = 579

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 94/179 (52%), Gaps = 2/179 (1%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDANVAYQTL 157
           LYVG L  S+ + LL   F   G ++S+++  D  ++    YA+V + +      A + L
Sbjct: 52  LYVGELDPSVSEALLYDIFSPIGPVTSIRVCRDAITKTSLGYAYVNFNDHESGRTAIEKL 111

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           N   ++GK  +I W+ +   +      N+F+ +L+ D+D+  L  TF  F + +   +  
Sbjct: 112 NYSPIKGKPCRIMWSQRDPALRKKGAGNIFIKNLHPDIDNKALHDTFSVFGNILSCKIAT 171

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFN 276
           D ++G+S+G+GFV F E + A  A++   G  LNGR + +     ++ ++S+  + + N
Sbjct: 172 D-ETGKSKGFGFVHFEEDNAAVEAVDAINGMMLNGREVYVAQHVSKKDRESKLEEVKAN 229

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 86/179 (48%), Gaps = 9/179 (5%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +++ NL   ID+  L   F + G+I S KI  D+  +   + FV + E + A 
Sbjct: 133 RKKGAGNIFIKNLHPDIDNKALHDTFSVFGNILSCKIATDETGKSKGFGFVHFEEDNAAV 192

Query: 152 VAYQTLNGKEVEGK-------VLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF 204
            A   +NG  + G+       V K +   + ++V ++ T N++V +++VD  +      F
Sbjct: 193 EAVDAINGMMLNGREVYVAQHVSKKDRESKLEEVKANFT-NVYVKNVDVDTPEDEFTALF 251

Query: 205 KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            ++   I +  M     G+ RG+GF++F   D A  A+E     E  G+ L +  A K+
Sbjct: 252 SKYGP-ITSIAMEKDSEGKFRGFGFINFENHDDAAKAVEELNDLEFKGQKLYVGRAQKK 309

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 87/191 (45%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +YV N+     +D     F   G I+S+ +  D   +   + F+ +    DA  A + LN
Sbjct: 233 VYVKNVDVDTPEDEFTALFSKYGPITSIAMEKDSEGKFRGFGFINFENHDDAAKAVEELN 292

Query: 159 GKEVEGKVLKINWAFQS----------------QQVNSDETFNLFVGDLNVDVDDATLAG 202
             E +G+ L +  A +                 +++   +  NLFV +L+  +DD  L  
Sbjct: 293 DLEFKGQKLYVGRAQKKYERLQELKKQYEASRLEKLAKYQGVNLFVKNLDDSIDDEKLEA 352

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  F S   A VM + + G+S+ +GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 353 EFAPFGSITSAKVMRN-EEGKSKNFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 411

Query: 263 REPQQSQQGQR 273
           ++ ++SQ  Q+
Sbjct: 412 KDVRRSQLAQQ 422

>Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar to
           Ashbya gossypii AGR122C
          Length = 580

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 92/178 (51%), Gaps = 2/178 (1%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDK-NSQECNYAFVEYFEPHDAN 151
           E S   LYVG L  S+ + LL   F   GS+SS+++  D   +    YA+V + +     
Sbjct: 34  ETSGASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGR 93

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFI 211
            A + LN   ++GK  +I W+ +   +    + N+++ +L+  +D+ +L  TF  F + +
Sbjct: 94  KAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNIL 153

Query: 212 QAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ 269
              V  D  +G SRG+GFV F  +  A+ A+E   G  +N + + + W   ++ +QS+
Sbjct: 154 SCKVATD-DNGVSRGFGFVHFENESDARDAIEAVNGMLMNDQEVYVAWHVSKKDRQSK 210

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 84/191 (43%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +YV N+      +  +Q F   G I+S  +  D   +   + F+ + +   A  A   LN
Sbjct: 221 IYVKNIDLETSQEEFEQLFSKYGKITSAVLEKDSEGKLRGFGFINFEDHSTAARAVDELN 280

Query: 159 GKEVEGKVLKINWAFQSQQVNSD----------------ETFNLFVGDLNVDVDDATLAG 202
             +  G+ L +  A +  +   +                +  NLF+ +L+  +DD  L  
Sbjct: 281 ESDFRGQTLYVGRAQKKHERQQELKKQYETARLEKLAKYQGVNLFIKNLDDSIDDEKLKD 340

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  F +     VM D ++G SRG+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 341 EFAPFGTITSVKVMKD-EAGSSRGFGFVCFSTPEEATKAITEKNQQLVAGKPLYVAIAQR 399

Query: 263 REPQQSQQGQR 273
           +E +++Q  Q+
Sbjct: 400 KEVRRNQLAQQ 410

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 85/184 (46%), Gaps = 7/184 (3%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +Y+ NL  +ID+  L + F   G+I S K+  D N     + FV +    DA 
Sbjct: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDDNGVSRGFGFVHFENESDAR 180

Query: 152 VAYQTLNGKEVEGKVLKINWAF-----QSQQVNSDETF-NLFVGDLNVDVDDATLAGTFK 205
            A + +NG  +  + + + W       QS+       F N++V +++++         F 
Sbjct: 181 DAIEAVNGMLMNDQEVYVAWHVSKKDRQSKLEEVKAKFTNIYVKNIDLETSQEEFEQLFS 240

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREP 265
           ++     A +  D + G+ RG+GF++F +   A  A++     +  G+ L +  A K+  
Sbjct: 241 KYGKITSAVLEKDSE-GKLRGFGFINFEDHSTAARAVDELNESDFRGQTLYVGRAQKKHE 299

Query: 266 QQSQ 269
           +Q +
Sbjct: 300 RQQE 303

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           +L+VG+L+  V +A L   F    S     V  D  +  S GY +V+F + +  + A+E 
Sbjct: 39  SLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGRKAIEQ 98

Query: 245 KQGFELNGRALRINWASKREPQQSQQG 271
                + G+  RI W S+R+P   ++G
Sbjct: 99  LNYTLIKGKPCRIMW-SQRDPSLRKKG 124

>Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 85.1 bits (209), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 95/178 (53%), Gaps = 2/178 (1%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDAN 151
           E S   LYVG+L  ++ +  L   F   GS+SS+++  D  ++    YA+V + +     
Sbjct: 34  ENSSASLYVGDLEPAVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFI 211
            A + LN   ++G++ +I W+ +   +    + N+F+ +L+ D+D+  L  TF  F   +
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDIL 153

Query: 212 QAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ 269
            + +  D ++G S+G+GFV F E+  A+ A++   G  LNG+ + +     R+ + SQ
Sbjct: 154 SSKIATD-ENGNSKGFGFVHFEEEVAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQ 210

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 92/191 (48%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           LYV N+     D+  ++ F   G I S  +  D + Q   + FV Y    DA  A + LN
Sbjct: 221 LYVKNINSETTDEQFQEMFVKFGPIVSASLEKDADGQLKGFGFVNYENHEDAVKAVEALN 280

Query: 159 GKEVEGK---------------VLKINW-AFQSQQVNSDETFNLFVGDLNVDVDDATLAG 202
             ++ G+               VLK  + A++ +++   +  NLFV +L+  VDD  L  
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDTVDDEKLEE 340

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  + +   A VM   ++G+S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 341 EFAPYGTITSAKVMRS-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 263 REPQQSQQGQR 273
           ++ ++SQ  Q+
Sbjct: 400 KDVRRSQLAQQ 410

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 84/178 (47%), Gaps = 7/178 (3%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +++ NL   ID+  L   F + G I S KI  D+N     + FV + E   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGNSKGFGFVHFEEEVAAK 180

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNS--DET----FNLFVGDLNVDVDDATLAGTFK 205
            A   LNG  + G+ + +      ++ +S  +ET     NL+V ++N +  D      F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQEMFV 240

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           +F   + A +  D   G+ +G+GFV++   + A  A+E     +LNG  L +  A K+
Sbjct: 241 KFGPIVSASLEKDA-DGQLKGFGFVNYENHEDAVKAVEALNESDLNGEKLYVGRAQKK 297

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 84.7 bits (208), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 99/186 (53%), Gaps = 4/186 (2%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDA- 150
           + S   LYVG L  ++ + LL   F   GS+SS+++  D  ++    YA+V  F  HDA 
Sbjct: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVN-FHDHDAG 94

Query: 151 NVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSF 210
             A Q LN   ++G+  +I W+ +   +    + N+F+ +L+  +D+  L  TF  F + 
Sbjct: 95  RTAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNI 154

Query: 211 IQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQ 270
           +   +  D ++G S+G+GFV F E+  A+ A++   G  LNG+ + +     ++ +QS+ 
Sbjct: 155 LSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKL 213

Query: 271 GQRRFN 276
            + + N
Sbjct: 214 EEAKSN 219

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 85/179 (47%), Gaps = 9/179 (5%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +++ NL  +ID+  L   F + G+I S KI  D+      + FV + E + A 
Sbjct: 123 RKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAK 182

Query: 152 VAYQTLNGKEVEGK-------VLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF 204
            A   +NG  + G+       V K +   + ++  S+ T N++V +++++         F
Sbjct: 183 EAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFT-NIYVKNIDLETTQEEFEALF 241

Query: 205 KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            +F     A +  D + G+ RG+GF++F + + A  A++     +   + L +  A K+
Sbjct: 242 TQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKK 299

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 84/191 (43%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +YV N+      +  +  F   G I+S  +  D   +   + F+ + +   A  A   LN
Sbjct: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282

Query: 159 GKEVEGKVLKINWAFQS----------------QQVNSDETFNLFVGDLNVDVDDATLAG 202
             + + + L +  A +                 +++   +  NLFV +L+  +DD  L  
Sbjct: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD 342

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  F +   A VM D  +G S+G+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 343 EFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 263 REPQQSQQGQR 273
           ++ ++SQ  Q+
Sbjct: 402 KDVRRSQLAQQ 412

>SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q759G9 Ashbya gossypii ADR307W
           ADR307Wp and some similarites with YHR086W
           uniprot|Q00539 Saccharomyces cerevisiae YHR086W NAM8 RNA
           binding protein component of the U1 snRNP protein
           mutants are defective in meiotic recombination and in
           formation of viable spores involved in the formation of
           DSBs through meiosis-specific splicing of MER2 pre-mRNA
          Length = 545

 Score = 84.3 bits (207), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 94/176 (53%), Gaps = 12/176 (6%)

Query: 99  LYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKNSQECN--YAFVEYFEPHDANVAYQ 155
           LY+G+L  S D+  +K  +  +G     VK+I +  +   N  + FVE+  P   N +  
Sbjct: 57  LYMGDLDPSWDESSIKSIWSSLGEQNILVKLIRNAGTTTTNSGFCFVEF--PSHLNASNA 114

Query: 156 TL-NGKEVEGKV---LKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF-KEFPSF 210
            L NG  V   V   LK+NWA  S        +++FVGDL  +V +A L   F   + S 
Sbjct: 115 LLKNGLPVPNAVNKFLKLNWA--SISTTPGNEYSIFVGDLAPNVTEAQLFELFISRYSST 172

Query: 211 IQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQ 266
           + + +++D  +G S+GYGFV FG + +   A+   QG  LNGRA+R++  SK +P+
Sbjct: 173 LNSKIVFDQLTGVSKGYGFVKFGNEAEQHRALLEMQGVFLNGRAIRVSTTSKNKPK 228

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 278 PNNTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGKGCGFVQYIDRISAETAIAKMQ 337

Query: 416 NFPFQGRNLRTGWGKE 431
            FP     +R  WG+ 
Sbjct: 338 GFPIGNSRIRLSWGRS 353

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  +++G L   + +D L+ YFQ  GSI  VKI   K    C   FV+Y +   A  
Sbjct: 277 DPNNTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGKG---C--GFVQYIDRISAET 331

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQV 178
           A   + G  +    ++++W   ++Q 
Sbjct: 332 AIAKMQGFPIGNSRIRLSWGRSAKQT 357

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 12/99 (12%)

Query: 167 LKINWAFQSQQVNSDETFN------LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQ 220
           L+  + F  QQ  S   F       +F+G L+  V +  L   F+ F S +   +     
Sbjct: 258 LQSQFVFPVQQTPSINQFTDPNNTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKI----- 312

Query: 221 SGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINW 259
               +G GFV + ++  A+ A+   QGF +    +R++W
Sbjct: 313 -PVGKGCGFVQYIDRISAETAIAKMQGFPIGNSRIRLSW 350

>KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {ON}
           Anc_5.382 YHR086W
          Length = 397

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 104/210 (49%), Gaps = 28/210 (13%)

Query: 99  LYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKNSQECN--------YAFVEYFEPHD 149
           LY+G+L  S D++++K+ +  IG    SVK++   N+   N        Y F+++  P  
Sbjct: 56  LYMGDLEPSWDENVIKRIWSSIGEDNISVKMMWQNNNYMGNESGPRNQGYCFIDF--PTH 113

Query: 150 ANVAYQTLNGK-EVEG---KVLKINWAFQSQ------QVNSDETFNLFVGDLNVDVDDAT 199
            N +   L  K  + G   K LK+NWA  S              F++FVGDL  +V +A 
Sbjct: 114 FNASNALLKNKMSIPGHPHKKLKLNWASSSAPSTAGVSTTGGNNFSIFVGDLAPNVTEAQ 173

Query: 200 LAGTF-KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRIN 258
           L   F   +PS   A V+ D+ +G S+GYGF+ F +    Q A+   QG  LNGRAL++ 
Sbjct: 174 LFDLFISRYPSTEHAKVVIDLSTGVSKGYGFIRFRDPADQQTALAEMQGVFLNGRALKVG 233

Query: 259 WASKREPQQS----QQGQRRFNG--PASGR 282
            +S +    +    Q G  R+ G  PA G+
Sbjct: 234 MSSGQSNSGAGGSRQVGHDRYGGSKPAGGK 263

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 34/76 (44%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +    +E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 291 PNNTTVFIGGLSPLVKEEELRQYFQPFGEIVYVKIPVGKGCGFVQYIDRISAETAISQMQ 350

Query: 416 NFPFQGRNLRTGWGKE 431
            FP     +R  WG+ 
Sbjct: 351 GFPISNSRVRLSWGRS 366

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 89/242 (36%), Gaps = 61/242 (25%)

Query: 81  SAAPVLA---TQGGREKSDKILYVGNL-PKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE 136
           S+AP  A   T GG   S   ++VG+L P   +  L   +     S    K++ D ++  
Sbjct: 142 SSAPSTAGVSTTGGNNFS---IFVGDLAPNVTEAQLFDLFISRYPSTEHAKVVIDLSTGV 198

Query: 137 CN-YAFVEYFEPHDANVAYQTLNGKEVEGKVLKINW--------AFQSQQVNSDE----- 182
              Y F+ + +P D   A   + G  + G+ LK+          A  S+QV  D      
Sbjct: 199 SKGYGFIRFRDPADQQTALAEMQGVFLNGRALKVGMSSGQSNSGAGGSRQVGHDRYGGSK 258

Query: 183 ----------------------------------TFNLFVGDLNVDVDDATLAGTFKEFP 208
                                                +F+G L+  V +  L   F+ F 
Sbjct: 259 PAGGKSNTPNSALFSQFMYPIQQQPALNHFTDPNNTTVFIGGLSPLVKEEELRQYFQPFG 318

Query: 209 SFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQS 268
             +   +         +G GFV + ++  A+ A+   QGF ++   +R++W    + QQ 
Sbjct: 319 EIVYVKIP------VGKGCGFVQYIDRISAETAISQMQGFPISNSRVRLSWGRSAKQQQL 372

Query: 269 QQ 270
           QQ
Sbjct: 373 QQ 374

>Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar to
           Ashbya gossypii AFR107W
          Length = 448

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 95/183 (51%), Gaps = 14/183 (7%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
            ++VG L  SIDD+ LK  F+ IGG IS+  I      +   Y +V++ +   A  A + 
Sbjct: 212 TIFVGRLSWSIDDEWLKTEFEHIGGVISARVIYERGTERSRGYGYVDFEDKSYAEKAIKE 271

Query: 157 LNGKEVEGKVLKINWAFQSQQVNSDE-------------TFNLFVGDLNVDVDDATLAGT 203
           + GKE++G+ + ++ +      N  E             +  LF+G+L+ + D   +   
Sbjct: 272 MQGKEIDGRPINVDMSTSKPASNPKEDRAKKFGDVPSQPSDTLFLGNLSFNADRDNIFEL 331

Query: 204 FKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           FK++ S I   +    ++ + +G+G+V +   ++AQ A++  QG  ++ R +R++++S R
Sbjct: 332 FKDYGSIISVRIPTHPETNQPKGFGYVQYASIEEAQKALDKLQGEYIDNRPVRLDFSSPR 391

Query: 264 EPQ 266
            PQ
Sbjct: 392 PPQ 394

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 49/82 (59%)

Query: 182 ETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVA 241
           E   +FVG L+  +DD  L   F+     I A V+++  + RSRGYG+V F ++  A+ A
Sbjct: 209 EPATIFVGRLSWSIDDEWLKTEFEHIGGVISARVIYERGTERSRGYGYVDFEDKSYAEKA 268

Query: 242 METKQGFELNGRALRINWASKR 263
           ++  QG E++GR + ++ ++ +
Sbjct: 269 IKEMQGKEIDGRPINVDMSTSK 290

>Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {ON}
           YHR086W (NAM8) - putative RNA binding protein, involved
           in meiosis-specific splicing of the REC107 transcripts
           in cooperation with the Mer1 protein [contig 153] FULL
          Length = 522

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 95/176 (53%), Gaps = 12/176 (6%)

Query: 99  LYVGNLPKSIDDDLLKQYF-QIGGSISSVKIIPDKNSQECN--YAFVEYFEPHDANVAYQ 155
           LY+G+L  + D+  ++  +  +G     +K+I    S   N  Y FVE+  P   N +  
Sbjct: 47  LYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHNSGYCFVEF--PSHTNASNA 104

Query: 156 TL-NGKEVEG---KVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF-KEFPSF 210
            L NG  +     ++LK+NWA  S        +++FVGD+  +V +A L   F   + S 
Sbjct: 105 LLKNGLVIPNTGNRILKLNWA--SFATTPGNEYSVFVGDVAPNVTEAQLFELFISRYAST 162

Query: 211 IQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQ 266
           + A +++D  +G S+GYGFV FG++ + Q ++   QG  LNGRA+R++  SK  P+
Sbjct: 163 LNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRAIRVSTTSKNRPK 218

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 270 PNNTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGKGCGFVQYVDRLSAETAIAKMQ 329

Query: 416 NFPFQGRNLRTGWGKE 431
            FP     +R  WG+ 
Sbjct: 330 GFPIGNSRIRLSWGRS 345

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  +++G L   + +D L+ +FQ  GSI  VKI   K    C   FV+Y +   A  
Sbjct: 269 DPNNTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGKG---C--GFVQYVDRLSAET 323

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQV 178
           A   + G  +    ++++W   ++Q 
Sbjct: 324 AIAKMQGFPIGNSRIRLSWGRSAKQA 349

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 6/74 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L+  V +  L   F+ F S +   +         +G GFV + ++  A+ A+   
Sbjct: 275 VFIGGLSSLVTEDELRAFFQPFGSIVYVKI------PVGKGCGFVQYVDRLSAETAIAKM 328

Query: 246 QGFELNGRALRINW 259
           QGF +    +R++W
Sbjct: 329 QGFPIGNSRIRLSW 342

>CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 513

 Score = 82.4 bits (202), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 96/186 (51%), Gaps = 7/186 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L++YF   G++  +KI+ D N+ +   + F+ +  P   +   +T 
Sbjct: 132 MFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFDAPSSVDEVVKTQ 191

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A   ++   D+T  +FVG L  DV        F ++ + I A +M 
Sbjct: 192 H--ILDGKVIDPKRAIPREE--QDKTGKIFVGGLGTDVRPKEFEEYFSQWGTIIDAQLML 247

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFNG 277
           D  +GRSRG+GFV++   D A+   E++   E  G+ + I  A  R  QQ Q GQ+  + 
Sbjct: 248 DKDTGRSRGFGFVTYDSPDAAEKVCESRY-REFKGKQIEIKRAEPRH-QQKQAGQQAVSP 305

Query: 278 PASGRG 283
           P +G G
Sbjct: 306 PVAGMG 311

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 5/94 (5%)

Query: 176 QQVNSD---ETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSF 232
           +QV +D   E   +F+G LN +  +  L   F ++ + ++  +M D  +GRSRG+GF+SF
Sbjct: 119 RQVKADLSRENCKMFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSF 178

Query: 233 GEQDQAQVAMETKQGFELNGRALRINWASKREPQ 266
                    ++T+    L+G+ +    A  RE Q
Sbjct: 179 DAPSSVDEVVKTQH--ILDGKVIDPKRAIPREEQ 210

>CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086w NAM8 meiotic recombination protein
          Length = 555

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 63/183 (34%), Positives = 93/183 (50%), Gaps = 22/183 (12%)

Query: 99  LYVGNLPKSIDDDLLKQYFQ-IGGSISSVKII----PDKNSQECNYAFVEYFEPHDANVA 153
           LY+G+L  S D+ ++K  +  +G     V+++     D + +   Y FVE+  P  A+ A
Sbjct: 86  LYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFPSPAHASNA 145

Query: 154 YQTLNGKEVEG---KVLKINWAFQSQQVNSDETF------------NLFVGDLNVDVDDA 198
               NG E+ G   K LK+NW+ QS    S  +             ++FVGDL   V +A
Sbjct: 146 LMK-NGMEIPGFVHKKLKLNWSAQSVNNGSGASVANGAVANQQTNNSIFVGDLAPSVTEA 204

Query: 199 TLAGTF-KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRI 257
            L   F  ++PS + A VM+D  +G S+GYGFV F      Q A+   QG  LNGRA++I
Sbjct: 205 QLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCFLNGRAIKI 264

Query: 258 NWA 260
             A
Sbjct: 265 GIA 267

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT ++G +     E +L    + FG II  K    KGC F++Y     A   I  + 
Sbjct: 324 PNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGKGCGFVQYVERSSAETAITKMQ 383

Query: 416 NFPFQGRNLRTGWGKE 431
            FP     +R  WG+ 
Sbjct: 384 GFPIANSRVRLSWGRS 399

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  ++VG L   + +D L+ YF+  G+I  VKI   K    C   FV+Y E   A  
Sbjct: 323 DPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGKG---C--GFVQYVERSSAET 377

Query: 153 AYQTLNGKEVEGKVLKINW 171
           A   + G  +    ++++W
Sbjct: 378 AITKMQGFPIANSRVRLSW 396

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 6/74 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +FVG L+  V +  L   F+ F + I   +         +G GFV + E+  A+ A+   
Sbjct: 329 VFVGGLSPLVTEDELRSYFEPFGTIIYVKI------PAGKGCGFVQYVERSSAETAITKM 382

Query: 246 QGFELNGRALRINW 259
           QGF +    +R++W
Sbjct: 383 QGFPIANSRVRLSW 396

>Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to
           Ashbya gossypii ADR307W
          Length = 602

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 102/198 (51%), Gaps = 19/198 (9%)

Query: 91  GREKSDKILYVGNLPKSIDDDLLKQ-YFQIGGSISSVKIIPDKNSQECN---YAFVEYFE 146
           G E +   LY+G+L  S  ++ +KQ +  +G     VK+I  KNS   N   Y FVE+  
Sbjct: 47  GPETTSTQLYMGDLDASWTENDIKQIWATLGEPNVQVKLI--KNSGPMNNSGYCFVEFPS 104

Query: 147 PHDA-NVAYQTLNGKEVE-GKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF 204
              A N   +T     V+  + LK+NWA  S        F++FVGDL  +V ++ L   F
Sbjct: 105 NLSATNALLKTGLPIPVDPSRSLKLNWA--SFATAPGTEFSIFVGDLAPNVSESQLFELF 162

Query: 205 -KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
              + S + A +++D  +G S+GYGFV FG + + Q ++   QG  LNGRA+R++  SK 
Sbjct: 163 ISRYSSTLNAKIVFDQVTGVSKGYGFVKFGNEAEQQRSLVEMQGVFLNGRAIRVSTTSKN 222

Query: 264 EPQQSQQGQRRFNGPASG 281
           +         RF G  SG
Sbjct: 223 K--------SRFRGGLSG 232

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 283 PNNTTVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAKMQ 342

Query: 416 NFPFQGRNLRTGWGKE 431
            FP     +R  WG+ 
Sbjct: 343 GFPIGNSRIRLSWGRS 358

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 8/90 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L+  V +  L   F+ F   +   +         +G GFV + ++  A+ A+   
Sbjct: 288 VFIGGLSSLVTEEELRAYFQPFGQIVYVKIP------VGKGCGFVQYVDRSSAENAIAKM 341

Query: 246 QGFELNGRALRINWASKREPQQSQQGQRRF 275
           QGF +    +R++W   R  +Q+   Q+ F
Sbjct: 342 QGFPIGNSRIRLSWG--RSAKQAAGMQQVF 369

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  +++G L   + ++ L+ YFQ  G I  VKI   K    C   FV+Y +   A  
Sbjct: 282 DPNNTTVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVGKG---C--GFVQYVDRSSAEN 336

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQ 177
           A   + G  +    ++++W   ++Q
Sbjct: 337 AIAKMQGFPIGNSRIRLSWGRSAKQ 361

>TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {ON}
           Anc_5.382 YHR086W
          Length = 472

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 101/198 (51%), Gaps = 18/198 (9%)

Query: 91  GREKSDKILYVGNLPKSIDDDLLKQYF-QIGGSISSVKII-PDKNS---QECNYAFVEYF 145
           G +  +  LY+G+L  S D+++++  +  +G S   +K++  ++N+       Y FV++ 
Sbjct: 42  GSQSRNNQLYMGDLDPSWDENVIRSIWNSLGESNVEIKLMWNNRNAGVRTHLGYCFVQFS 101

Query: 146 EPHDANVAYQTLNGKEVEG---KVLKINWAFQS-QQVNSDETFNLFVGDLNVDVDDATLA 201
               A+ A    NG  + G   K L++NW+  S    +     ++FVGDL  +V ++ L 
Sbjct: 102 SRSQASNALLK-NGMAIPGYPSKTLRLNWSSASGNSADGSNEISVFVGDLAPNVTESDLF 160

Query: 202 GTF-KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
             F  + PS   A VM+D  +G S+GY FV FG Q+  Q A++   G  L GRA+R+  A
Sbjct: 161 ELFISKCPSTSNAKVMYDQVTGVSKGYAFVRFGNQEDQQRALQEMTGTFLKGRAIRVGSA 220

Query: 261 SKREPQQSQQGQRRFNGP 278
                    Q QR  NGP
Sbjct: 221 -------GHQNQRNRNGP 231

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 359 TTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNFP 418
           TT ++ ++ H   E++L    Q FG +I  K    K C F++Y     A + I+ L  FP
Sbjct: 279 TTLFVSSLSHMVTENELKAFFQPFGNVIYAKLPENKQCGFVQYVDRASAEMAILKLQGFP 338

Query: 419 FQGRNLRTGWGK-EKPTFI 436
            +G  ++  WG+  KP  +
Sbjct: 339 IRGSRIKISWGRPAKPAVV 357

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 83/216 (38%), Gaps = 55/216 (25%)

Query: 99  LYVGNL-PKSIDDDLLKQYFQIGGSISSVKIIPDK-NSQECNYAFVEYFEPHDANVAYQT 156
           ++VG+L P   + DL + +     S S+ K++ D+       YAFV +    D   A Q 
Sbjct: 145 VFVGDLAPNVTESDLFELFISKCPSTSNAKVMYDQVTGVSKGYAFVRFGNQEDQQRALQE 204

Query: 157 LNGKEVEGKVLKINWAFQSQQVN-------------------------SDETFN------ 185
           + G  ++G+ +++  A    Q N                         S   F+      
Sbjct: 205 MTGTFLKGRAIRVGSAGHQNQRNRNGPGLENKLKGLNATVSSPKPANISSTNFSQFILPT 264

Query: 186 ----------------LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGF 229
                           LFV  L+  V +  L   F+ F + I A +  + Q G      F
Sbjct: 265 QQLPPLNSFTDRNNTTLFVSSLSHMVTENELKAFFQPFGNVIYAKLPENKQCG------F 318

Query: 230 VSFGEQDQAQVAMETKQGFELNGRALRINWASKREP 265
           V + ++  A++A+   QGF + G  ++I+W    +P
Sbjct: 319 VQYVDRASAEMAILKLQGFPIRGSRIKISWGRPAKP 354

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 43/79 (54%), Gaps = 5/79 (6%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           ++++  L+V +L   + ++ LK +FQ  G++   K+  +K   +C   FV+Y +   A +
Sbjct: 275 DRNNTTLFVSSLSHMVTENELKAFFQPFGNVIYAKLPENK---QC--GFVQYVDRASAEM 329

Query: 153 AYQTLNGKEVEGKVLKINW 171
           A   L G  + G  +KI+W
Sbjct: 330 AILKLQGFPIRGSRIKISW 348

>AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER165W
           (PAB1)
          Length = 585

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 92/178 (51%), Gaps = 2/178 (1%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDK-NSQECNYAFVEYFEPHDAN 151
           E S   LYVG L  ++ + LL   F   GS+SS+++  D   +    YA+V + +     
Sbjct: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFI 211
            A + LN   ++GK  +I W+ +   +    + N+++ +L+  +D+ +L  TF  F + +
Sbjct: 94  KAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNIL 153

Query: 212 QAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ 269
              V  D ++G SRG+GFV F  +  A+ A+E   G  +N + + +     ++ +QS+
Sbjct: 154 SCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSK 210

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 88/191 (46%), Gaps = 17/191 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +YV N+ +    +  ++ F   G I+S  +  D   +   + FV + +   A  A   LN
Sbjct: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280

Query: 159 GKEVEGKVLKINWAFQS----------------QQVNSDETFNLFVGDLNVDVDDATLAG 202
             E +G+ L +  A +                 +++   +  NLFV +L+  +DD  L  
Sbjct: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE 340

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F  F +   A VM D ++G SRG+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 341 EFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 263 REPQQSQQGQR 273
           +E +++Q  Q+
Sbjct: 400 KEVRRNQLAQQ 410

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 83/177 (46%), Gaps = 5/177 (2%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +Y+ NL  +ID+  L + F   G+I S K+  D+N     + FV +    DA 
Sbjct: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDAR 180

Query: 152 VAYQTLNGKEVEGK--VLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKE-FP 208
            A + ++G  +  +   + ++ + + +Q   +E    F      ++D  T    F+E F 
Sbjct: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240

Query: 209 SF--IQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            +  I + V+     G+ RG+GFV+F +   A  A++     E  G+ L +  A K+
Sbjct: 241 KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKK 297

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           +L+VG+L   V +A L   F    S     V  D  +  S GY +V+F + +    A+E 
Sbjct: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98

Query: 245 KQGFELNGRALRINWASKREPQQSQQG 271
                + G+  RI W S+R+P   ++G
Sbjct: 99  LNYTLIKGKPCRIMW-SQRDPSLRKKG 124

>ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR086W (NAM8)
          Length = 566

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 96/181 (53%), Gaps = 11/181 (6%)

Query: 91  GREKSDKILYVGNL-PKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ---ECNYAFVEYFE 146
           G + S   LY+G+L P   + D+ + +  +G +   VK+I  KNS       Y FVE+  
Sbjct: 46  GADTSSTQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLI--KNSSGGGNSGYCFVEFPS 103

Query: 147 PHDA-NVAYQTLNGKEVEG-KVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF 204
              A N   +T     V+  + LK+NWA  S        F++FVGDL  +V ++ L   F
Sbjct: 104 NLAATNALLKTGLPIPVDASRTLKLNWA--SFATTPGSEFSIFVGDLAPNVTESQLFELF 161

Query: 205 -KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
              + S + A +++D  +G S+GYGFV FG + + Q ++   QG  LNGRA+R++  SK 
Sbjct: 162 ISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKN 221

Query: 264 E 264
           +
Sbjct: 222 K 222

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 34/78 (43%)

Query: 354 APPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVA 413
           A P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  
Sbjct: 277 ADPNNTTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAK 336

Query: 414 LTNFPFQGRNLRTGWGKE 431
           +  FP     +R  WG+ 
Sbjct: 337 MQGFPIGNSRVRLSWGRS 354

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 5/86 (5%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  +++G L   + +D L+ YFQ  G I  VKI   K    C   FV+Y +   A  
Sbjct: 278 DPNNTTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGKG---C--GFVQYVDRSSAEN 332

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQV 178
           A   + G  +    ++++W   ++Q 
Sbjct: 333 AIAKMQGFPIGNSRVRLSWGRSAKQT 358

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 6/74 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L+  V +  L   F+ F   +   +         +G GFV + ++  A+ A+   
Sbjct: 284 VFIGGLSSLVTEDELRAYFQPFGQIVYVKIP------VGKGCGFVQYVDRSSAENAIAKM 337

Query: 246 QGFELNGRALRINW 259
           QGF +    +R++W
Sbjct: 338 QGFPIGNSRVRLSW 351

>AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR159C (NSR1)
          Length = 396

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 95/184 (51%), Gaps = 14/184 (7%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQT 156
            ++VG L  S+DD+ LK  F   G +   ++I ++ + +   Y +V++ +   A  A + 
Sbjct: 168 TIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVDFEDVSYAEKAVKE 227

Query: 157 LNGKEVEGKVLKINW-------------AFQSQQVNSDETFNLFVGDLNVDVDDATLAGT 203
           ++GKE++G+ +  +              A +     S  +  LF+G+L+ + D   L   
Sbjct: 228 MHGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRDALFEL 287

Query: 204 FKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           F +  + I   +    +S + +G+G+V +G  ++AQ A++  QG  ++ R +RI+++S R
Sbjct: 288 FSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVRIDFSSPR 347

Query: 264 EPQQ 267
            PQQ
Sbjct: 348 PPQQ 351

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 49/92 (53%)

Query: 172 AFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVS 231
           A   +Q    +   +FVG L+  VDD  L   F      + A V+++  + +SRGYG+V 
Sbjct: 155 AVAKKQKTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVD 214

Query: 232 FGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           F +   A+ A++   G E++GRA+  + ++ +
Sbjct: 215 FEDVSYAEKAVKEMHGKEIDGRAINCDMSTSK 246

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 98/185 (52%), Gaps = 2/185 (1%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDAN 151
           E S   LYVG L  S+ + LL   F   GS+SS+++  D  ++    YA+V + + +   
Sbjct: 36  EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGT 95

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFI 211
            A + LN   ++G+  +I W+ +   +    + N+F+ +L+  +D+  L  TF  F + +
Sbjct: 96  TAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNIL 155

Query: 212 QAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQG 271
              +  D ++G+SR +GFV F E++ A+ A++   G  LNG  + +     ++ +QS+  
Sbjct: 156 SCKIATD-ETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNGLEVYVAPHVSKKDRQSKLD 214

Query: 272 QRRFN 276
           + + N
Sbjct: 215 EVKSN 219

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 98/214 (45%), Gaps = 23/214 (10%)

Query: 82  AAPVLATQGGREKSDKI------LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ 135
            AP ++ +  + K D++      +YV N+      D  ++ F   G+I+S  +  D   +
Sbjct: 200 VAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGK 259

Query: 136 ECNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINWA-------------FQSQQVNSDE 182
              + FV + + + A  A + LN  +  G+ L +  A             ++S ++    
Sbjct: 260 LRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLA 319

Query: 183 TF---NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
            +   NLFV +L+  +DD  L   F  F +     VM D  +G S+G+GFV F   ++A 
Sbjct: 320 KYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEAT 378

Query: 240 VAMETKQGFELNGRALRINWASKREPQQSQQGQR 273
            A+  K    + G+ L +  A ++E ++SQ  Q+
Sbjct: 379 KAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQ 412

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 86/179 (48%), Gaps = 9/179 (5%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +++ NL  +ID+  L   F + G+I S KI  D+  +   + FV + E   A 
Sbjct: 123 RKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEAAK 182

Query: 152 VAYQTLNGKEVEG-------KVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF 204
            A   +NG  + G        V K +   +  +V S+ T N++V +++ +         F
Sbjct: 183 EAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFT-NVYVKNIDPETKQDEFEKLF 241

Query: 205 KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            ++ +   A +  D + G+ RG+GFV+F + + A  A+E     + NG+ L +  A K+
Sbjct: 242 SQYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK 299

>NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score = 78.2 bits (191), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 94/177 (53%), Gaps = 12/177 (6%)

Query: 99  LYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           ++VG L  SIDD+ LK+ F+ IGG + +  I      +   Y +V++ +   A  A Q +
Sbjct: 173 IFVGRLSWSIDDEWLKKEFEHIGGVVGARVIYERGTDRSRGYGYVDFEDKSYAEKAIQEM 232

Query: 158 NGKEVEGKVLKINW-----------AFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKE 206
            GKE++G+ + ++            A +   V S+ +  LF+G+L+ + D   +  TF +
Sbjct: 233 QGKEIDGRPINVDMSTSKPAGGNDRAKKFGDVPSEPSDTLFLGNLSFNADKDNIYETFSK 292

Query: 207 FPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           +   I   +    ++ + +G+G+V F   + A+ A+E  QG  ++ RA+R+++++ R
Sbjct: 293 YGEIISVRIPTHPETEQPKGFGYVQFSNIEDAKKALEGLQGEYIDNRAVRLDYSTPR 349

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 52/88 (59%)

Query: 176 QQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQ 235
           Q+ +  E   +FVG L+  +DD  L   F+     + A V+++  + RSRGYG+V F ++
Sbjct: 163 QKTSGGEPATIFVGRLSWSIDDEWLKKEFEHIGGVVGARVIYERGTDRSRGYGYVDFEDK 222

Query: 236 DQAQVAMETKQGFELNGRALRINWASKR 263
             A+ A++  QG E++GR + ++ ++ +
Sbjct: 223 SYAEKAIQEMQGKEIDGRPINVDMSTSK 250

>KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.382
           YHR086W
          Length = 406

 Score = 77.8 bits (190), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 89/165 (53%), Gaps = 15/165 (9%)

Query: 98  ILYVGNLPKSIDDDLLKQYF-QIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           +LY+G+L  S D+ ++ Q +  +G    SVK++         Y F+ + +   A+ A   
Sbjct: 33  VLYMGDLDLSWDERVVSQIWASLGEPNVSVKMM-------NRYCFITFLDSLTASNALLK 85

Query: 157 LNGKEVEG---KVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF-KEFPSFIQ 212
            NG  + G   K LK+NWA  S   N+   +++FVGDL+ +V +A L   F  ++ S   
Sbjct: 86  -NGMLIPGYGGKRLKLNWAQASS--NASNGYSIFVGDLSPNVTEAQLFDLFINKYASTDH 142

Query: 213 AHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRI 257
           A +++D  +G SRGYGFV F      Q A+   QG  LNGRA++I
Sbjct: 143 AKIVYDQATGVSRGYGFVRFNSLMDQQHALLEMQGIFLNGRAIKI 187

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 33/76 (43%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT ++G +     E +L    + FG I+  K    KGC F++Y     A   I  + 
Sbjct: 241 PNNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGKGCGFVQYIDRVSAENAISKMQ 300

Query: 416 NFPFQGRNLRTGWGKE 431
            FP     +R  WG+ 
Sbjct: 301 GFPIANSRIRLSWGRS 316

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  ++VG L   + +D L++YF+  G+I  VKI   K    C   FV+Y +   A  
Sbjct: 240 DPNNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGKG---C--GFVQYIDRVSAEN 294

Query: 153 AYQTLNGKEVEGKVLKINW 171
           A   + G  +    ++++W
Sbjct: 295 AISKMQGFPIANSRIRLSW 313

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 6/74 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +FVG L+  V +  L   FK F + +   +         +G GFV + ++  A+ A+   
Sbjct: 246 VFVGGLSSLVTEDELREYFKPFGTIVYVKI------PVGKGCGFVQYIDRVSAENAISKM 299

Query: 246 QGFELNGRALRINW 259
           QGF +    +R++W
Sbjct: 300 QGFPIANSRIRLSW 313

>KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 96/179 (53%), Gaps = 2/179 (1%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDANVAYQTL 157
           LYVG L  S+ + LL   F   GS+SS+++  D  ++    YA+V + + +    A + L
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           N   ++G+  +I W+ +   +    + N+F+ +L+  +D+  L  TF  F + +   +  
Sbjct: 102 NYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIAT 161

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFN 276
           D ++G+SR +GFV F E++ A+ A++   G  LNG  + +     ++ +QS+  + + N
Sbjct: 162 D-ETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSN 219

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 102/215 (47%), Gaps = 25/215 (11%)

Query: 82  AAPVLATQGGREKSDKI------LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ 135
            AP ++ +  + K D++      +YV N+      +  ++ F   G+I+S  +  D   +
Sbjct: 200 VAPHVSKKDRQSKLDEVKSNFTNVYVKNIDSETTQEEFEKMFSNYGAITSAVLERDNEGK 259

Query: 136 ECNYAFVEYFEPHDANV-AYQTLNGKEVEGKVLKINWA-------------FQSQQVNSD 181
              + FV  FE H+A + A + LN  + +G+ L +  A             ++S ++   
Sbjct: 260 LRGFGFVN-FEDHNAALKACEELNDTDFKGQKLYVGRAQKKYERLQELKKQYESSRMEKL 318

Query: 182 ETF---NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQA 238
             +   NLFV +L+  VDD  L   F  F +     VM D ++G S+G+GFV F   ++A
Sbjct: 319 AKYQGVNLFVKNLDDSVDDQKLEEEFAPFGTITSVKVMRD-EAGNSKGFGFVCFSTPEEA 377

Query: 239 QVAMETKQGFELNGRALRINWASKREPQQSQQGQR 273
             A+  K    + G+ L +  A ++E ++SQ  Q+
Sbjct: 378 TKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQ 412

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 83/177 (46%), Gaps = 5/177 (2%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           R+K    +++ NL  +ID+  L   F + G+I S KI  D+  +   + FV + E   A 
Sbjct: 123 RKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEAAK 182

Query: 152 VAYQTLNGKEVEGKVLKI--NWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF-KEFP 208
            A   +NG  + G  + +  + + + +Q   DE  + F      ++D  T    F K F 
Sbjct: 183 EAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDSETTQEEFEKMFS 242

Query: 209 SF--IQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           ++  I + V+     G+ RG+GFV+F + + A  A E     +  G+ L +  A K+
Sbjct: 243 NYGAITSAVLERDNEGKLRGFGFVNFEDHNAALKACEELNDTDFKGQKLYVGRAQKK 299

>KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086W NAM8 RNA binding protein component of the U1
           snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 516

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 95/172 (55%), Gaps = 12/172 (6%)

Query: 99  LYVGNLPKSIDDDLLKQYF-QIGGSISSVKIIPDKNSQECN--YAFVEYFEPHDANVAYQ 155
           LY+G+L  S D++ ++  +  +G     VK+I +  S   +  Y FVE+  P   N +  
Sbjct: 45  LYMGDLDPSWDENAIRAVWANLGEPNVQVKLIRNSGSTGGSSGYCFVEF--PSHLNASNA 102

Query: 156 TL-NGKEV---EGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF-KEFPSF 210
            L NG  +     + LK+NWA  +    ++ +  +FVGD+  +V +A L   F   + S 
Sbjct: 103 LLKNGLLIPNARNRYLKLNWASFATAPGNEHS--VFVGDIAPNVSEAQLFELFISRYAST 160

Query: 211 IQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
           + A +++D  +G S+GYGFV FG++ + Q A+   QG  LNGRA+R++  SK
Sbjct: 161 LNAKIVFDQMTGVSKGYGFVKFGQESEQQRALLEMQGVFLNGRAVRVSTTSK 212

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 270 PNNTTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGKGCGFVQYVDRISAETAIAKMQ 329

Query: 416 NFPFQGRNLRTGWGKE 431
            +P     +R  WG+ 
Sbjct: 330 GYPIGNSRIRLSWGRS 345

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  +++G L   + +D L+ YFQ  GSI  VKI   K    C   FV+Y +   A  
Sbjct: 269 DPNNTTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGKG---C--GFVQYVDRISAET 323

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQV 178
           A   + G  +    ++++W   ++Q 
Sbjct: 324 AIAKMQGYPIGNSRIRLSWGRSAKQA 349

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 45/97 (46%), Gaps = 8/97 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L+  V +  L   F+ F S +   +         +G GFV + ++  A+ A+   
Sbjct: 275 VFIGGLSSLVSEDELRAYFQPFGSIVYVKIP------VGKGCGFVQYVDRISAETAIAKM 328

Query: 246 QGFELNGRALRINWASKREPQQSQQGQRRFNGPASGR 282
           QG+ +    +R++W   R  +Q+   Q+ F   A  R
Sbjct: 329 QGYPIGNSRIRLSWG--RSAKQAAVMQQAFASSAQHR 363

>TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa]
           {ON} Anc_4.61 YGR159C
          Length = 403

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 94/181 (51%), Gaps = 14/181 (7%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQTL 157
           ++VG L  SIDD+ LK  F+  G + S ++I +K +     Y +V++     A  A + +
Sbjct: 163 IFVGRLSWSIDDEWLKTEFEPIGGVLSARVIYEKGTDRSRGYGYVDFKNKTFAEKAIKEM 222

Query: 158 NGKEVEGKVLKINWAFQSQQVN------------SDETFNLFVGDLNVDVDDATLAGTFK 205
            GKE++G+ +  + +      N            S+ +  LF+G+L+ D D   +   F 
Sbjct: 223 QGKEIDGRPINCDMSTSKPASNGGDRAKKFGDTPSEPSETLFLGNLSFDADRDNIYEVFS 282

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREP 265
           ++   I   +    ++ + +G+G+V +G+ + A+ A++  QG  +N R +R+++++ R P
Sbjct: 283 KYGEIISVRIPTHPETEQPKGFGYVQYGDVESAKKALDALQGEYINNRPVRLDFSTPR-P 341

Query: 266 Q 266
           Q
Sbjct: 342 Q 342

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 49/84 (58%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S+E   +FVG L+  +DD  L   F+     + A V+++  + RSRGYG+V F  +  A+
Sbjct: 157 SEEPATIFVGRLSWSIDDEWLKTEFEPIGGVLSARVIYEKGTDRSRGYGYVDFKNKTFAE 216

Query: 240 VAMETKQGFELNGRALRINWASKR 263
            A++  QG E++GR +  + ++ +
Sbjct: 217 KAIKEMQGKEIDGRPINCDMSTSK 240

>CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {ON}
           similar to uniprot|P27476 Saccharomyces cerevisiae
           YGR159c NSR1 nuclear localization sequence binding
           protein
          Length = 425

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 95/179 (53%), Gaps = 14/179 (7%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQTL 157
           ++VG L  SIDD+ LKQ F+  G + + +++ ++ +     Y +V++ +   A  A + +
Sbjct: 178 VFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKAVKEM 237

Query: 158 NGKEVEGKVLKINWAFQSQQVN-------------SDETFNLFVGDLNVDVDDATLAGTF 204
           +GKE++G+ + ++ +     VN             S+ +  LF+G+L+ + D   +   F
Sbjct: 238 HGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNADRDNIYEIF 297

Query: 205 KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            +F   I   +    ++ + +G+G+V +   D A+ A+E  QG  ++ R +R+++++ +
Sbjct: 298 GKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRPVRLDYSTPK 356

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 182 ETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVA 241
           E   +FVG L+  +DD  L   F+     + A VM++  + RSRGYG+V F ++  A+ A
Sbjct: 174 EPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKA 233

Query: 242 METKQGFELNGRALRINWA-SKREPQQSQQGQRRF 275
           ++   G E++GR + ++ + SK      +  Q+RF
Sbjct: 234 VKEMHGKEIDGRPINVDMSTSKPTVNPREDRQKRF 268

>KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.61
           YGR159C
          Length = 399

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 94/183 (51%), Gaps = 15/183 (8%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
            L+VG L  S+DD+ LK  F  IGG +S+  I+     +   Y +V++ +   A  A + 
Sbjct: 150 TLFVGRLSWSVDDEWLKNEFAPIGGVVSARVIMERGTDRSRGYGYVDFEDISYAEKALKE 209

Query: 157 LNGKEVEGKVLKINW-------------AFQSQQVNSDETFNLFVGDLNVDVDDATLAGT 203
           + GKE++G+ + ++              A +   V S+ +  LF+G+L+ D D   L   
Sbjct: 210 MQGKEIDGRPINVDMSTSKPAGGASNDRAKKFGDVPSEPSDTLFLGNLSFDADRDNLYEI 269

Query: 204 FKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           F +F   I   +    ++ + +G+G+V +   + A+ A++  QG  +N R +R+++++ R
Sbjct: 270 FGKFGEIISVRIPTHPETEQPKGFGYVQYTNTEDAKKALDALQGESINDRPVRLDFSTPR 329

Query: 264 EPQ 266
            PQ
Sbjct: 330 -PQ 331

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 50/89 (56%)

Query: 175 SQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGE 234
           +++  + E   LFVG L+  VDD  L   F      + A V+ +  + RSRGYG+V F +
Sbjct: 140 TKKSKTQEPATLFVGRLSWSVDDEWLKNEFAPIGGVVSARVIMERGTDRSRGYGYVDFED 199

Query: 235 QDQAQVAMETKQGFELNGRALRINWASKR 263
              A+ A++  QG E++GR + ++ ++ +
Sbjct: 200 ISYAEKALKEMQGKEIDGRPINVDMSTSK 228

>SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]
           {ON} some similarities with uniprot|Q754G3 Ashbya
           gossypii AFR107W AFR107Wp and some similarites with
           YGR159C uniprot|P27476 Saccharomyces cerevisiae YGR159C
           NSR1 Nucleolar protein that binds nuclear localization
           sequences required for pre-rRNA processing and ribosome
           biogenesis
          Length = 421

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 91/180 (50%), Gaps = 14/180 (7%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQTL 157
           ++VG L  SIDD+ LK  F   G + S ++I ++ S     Y +V++ + H A  A + +
Sbjct: 175 IFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKEM 234

Query: 158 NGKEVEGKVLKINW-------------AFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF 204
           +GKE++G+ +  +              A +   V S  +  LF+G+L+ + D   L   F
Sbjct: 235 HGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFEIF 294

Query: 205 KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKRE 264
            +    I   +    ++ + +G+G+V +G  D A+ A E  QG  ++ R +R++++  R+
Sbjct: 295 SQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPVRLDYSIPRQ 354

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 46/82 (56%)

Query: 182 ETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVA 241
           E   +FVG L+  +DD  L   F      + A V+++  S RSRGYG+V F ++  A+ A
Sbjct: 171 EPATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKA 230

Query: 242 METKQGFELNGRALRINWASKR 263
           ++   G E++GR +  + ++ +
Sbjct: 231 VKEMHGKEIDGRPINCDMSTSK 252

>TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {ON}
           Anc_4.61 YGR159C
          Length = 436

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 91/179 (50%), Gaps = 14/179 (7%)

Query: 99  LYVGNLPKSIDDDLLKQYF-QIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           ++VG L  SIDD+ LK  F  IGG +S+  I      +   Y +V++ +   A  A + +
Sbjct: 189 IFVGRLSWSIDDEWLKNEFDHIGGVVSARVIYERGTDRSRGYGYVDFEDKSYAEKAVKEM 248

Query: 158 NGKEVEGKVLKINWAFQSQQVN-------------SDETFNLFVGDLNVDVDDATLAGTF 204
           +GKE++G+ +  + +      N             S+ +  LF+G+L+ + D   +   F
Sbjct: 249 HGKEIDGRPINCDLSTSKPAGNPRDDRAKKFGDLPSEPSETLFLGNLSFNADRDNIYEMF 308

Query: 205 KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            +F   +   +    ++ + +G+G+V +G  D A+ A++  QG  ++ R +R+++++ R
Sbjct: 309 SKFGEIVSVRIPTHPETEQPKGFGYVQYGNVDDAKKALDALQGEYIDNRPVRLDYSTPR 367

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 47/84 (55%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S E   +FVG L+  +DD  L   F      + A V+++  + RSRGYG+V F ++  A+
Sbjct: 183 SGEPATIFVGRLSWSIDDEWLKNEFDHIGGVVSARVIYERGTDRSRGYGYVDFEDKSYAE 242

Query: 240 VAMETKQGFELNGRALRINWASKR 263
            A++   G E++GR +  + ++ +
Sbjct: 243 KAVKEMHGKEIDGRPINCDLSTSK 266

>TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.49
           YOL123W
          Length = 547

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 86/174 (49%), Gaps = 6/174 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L+ YF   G +  +KI+ D N+ +   + F+ + EP   +   +T 
Sbjct: 159 MFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTFDEPSSVDEVVKTQ 218

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A   ++   D+T  +FVG +  DV        F ++ + I A +M 
Sbjct: 219 H--ILDGKVIDPKRAIPREE--QDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDAQLML 274

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQG 271
           D  +GRSRG+GFV++   D      + K   +  G+ + I  A  R  Q+ QQG
Sbjct: 275 DKDTGRSRGFGFVTYDSPDAVDRVCQNKF-IDFKGKKIEIKRAEPRHMQKQQQG 327

>NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON} 
          Length = 415

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 95/178 (53%), Gaps = 13/178 (7%)

Query: 99  LYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           ++VG L  SIDD+ LK+ F+ IGG +S+  I+     +   Y +V++ +   A  A + +
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEM 223

Query: 158 NGKEVEGKVLKINW------------AFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFK 205
            GKE++G+ + ++             A +   V S+ +  LF+G+L+ + D   ++  F 
Sbjct: 224 QGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELFS 283

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           ++   I   +    ++ + +G+G+V +   + A+ A+E  QG  ++ R +R+++++ R
Sbjct: 284 KYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPVRLDYSTPR 341

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 53/99 (53%)

Query: 177 QVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQD 236
           Q    E   +FVG L+  +DD  L   F+     + A V+ +  + RSRGYG+V F ++ 
Sbjct: 155 QKTEGEPATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKS 214

Query: 237 QAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRF 275
            A+ A++  QG E++GR + ++ ++ +    +    ++F
Sbjct: 215 YAEKAIKEMQGKEIDGREINVDMSTSKPAAGNNDRAKKF 253

>NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382
          Length = 443

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/190 (31%), Positives = 94/190 (49%), Gaps = 13/190 (6%)

Query: 99  LYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKN-SQECNYAFVEYFEPHDANVAYQT 156
           LY+G+L  + D+++++Q ++ +G S   VK++ + N      Y FVE+      N A   
Sbjct: 49  LYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGYCFVEFPSMEHGNNALLK 108

Query: 157 LNGKEVEG---KVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF-KEFPSFIQ 212
            NG  + G   + LK+NWA      N +  F++FVGDL+ +V +A L   F   +PS   
Sbjct: 109 -NGIVIPGFPQRRLKLNWASAGANGN-NSGFSVFVGDLSPNVTEAQLFELFIGRYPSTCH 166

Query: 213 AHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQ-- 270
           A V+ D  +G S+ YGFV F      Q  +   QG  LNGR++++          S    
Sbjct: 167 AKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKVGLTGGAHNDNSNTNS 226

Query: 271 ---GQRRFNG 277
              G+ RF G
Sbjct: 227 MAGGRSRFGG 236

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 34/77 (44%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E DL    Q FG II  K    KGC F++Y     A L I  + 
Sbjct: 280 PNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGKGCGFVQYVDRLSAELAISKMQ 339

Query: 416 NFPFQGRNLRTGWGKEK 432
            FP     +R  WG+  
Sbjct: 340 GFPLANSRIRLSWGRSS 356

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  +++G L   + +D L+QYFQ  G I  VKI   K    C   FV+Y +   A +
Sbjct: 279 DPNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGKG---C--GFVQYVDRLSAEL 333

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQ 177
           A   + G  +    ++++W   S+Q
Sbjct: 334 AISKMQGFPLANSRIRLSWGRSSKQ 358

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L+  V +  L   F+ F   I   +         +G GFV + ++  A++A+   
Sbjct: 285 VFIGGLSSLVSEDDLRQYFQPFGDIIYVKIP------TGKGCGFVQYVDRLSAELAISKM 338

Query: 246 QGFELNGRALRINWA 260
           QGF L    +R++W 
Sbjct: 339 QGFPLANSRIRLSWG 353

>KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some
           similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein
          Length = 589

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 90/177 (50%), Gaps = 14/177 (7%)

Query: 99  LYVGNL-PKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN------YAFVEYFEPHDAN 151
           LY+G+L P   ++D+   +  +G     VK+I   N  + +      Y FVE+     A+
Sbjct: 58  LYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQMAAS 117

Query: 152 VAYQTLNGKEV---EGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF-KEF 207
            A    +G  V       LK+NWA  +    S+  F LFVGDL  +V +A L   F   +
Sbjct: 118 NALMK-SGLRVPMDSNYALKLNWASFATAPGSE--FTLFVGDLAPNVTEAQLFELFISRY 174

Query: 208 PSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKRE 264
            S + A +++D  +G S+GYGFV F  + + Q A+   QG  LNGRA+R+   SK +
Sbjct: 175 SSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVGTTSKNK 231

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 313 PNNTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGKGCGFVQYVDRISAETAISKMQ 372

Query: 416 NFPFQGRNLRTGWGKE 431
            FP     +R  WG+ 
Sbjct: 373 GFPIGNSRIRLSWGRS 388

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  +++G L   I +D L+ YFQ  G I  VKI   K    C   FV+Y +   A  
Sbjct: 312 DPNNTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGKG---C--GFVQYVDRISAET 366

Query: 153 AYQTLNGKEVEGKVLKINW 171
           A   + G  +    ++++W
Sbjct: 367 AISKMQGFPIGNSRIRLSW 385

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 35/74 (47%), Gaps = 6/74 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L+  + +  L   F+ F   +   +         +G GFV + ++  A+ A+   
Sbjct: 318 VFIGGLSTLITEDELRSYFQPFGQIVYVKI------PVGKGCGFVQYVDRISAETAISKM 371

Query: 246 QGFELNGRALRINW 259
           QGF +    +R++W
Sbjct: 372 QGFPIGNSRIRLSW 385

>KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.61
           YGR159C
          Length = 412

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 93/181 (51%), Gaps = 13/181 (7%)

Query: 99  LYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           ++VG L  SIDD+ LK  F+ IGG I +  I      +   Y +V++     A  A + +
Sbjct: 167 IFVGRLSWSIDDEWLKNEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKEYAEKAVKEM 226

Query: 158 NGKEVEGKVLKINW------------AFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFK 205
           +GKE++G+ +  +             A +   V S+ +  LF+G+L+ + D   ++  F 
Sbjct: 227 HGKEIDGREINCDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDNISEMFS 286

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREP 265
           +F   +   +    ++ + +G+G+V +   + A+ A++  QG  ++ R +R+++++ R P
Sbjct: 287 KFGEIVSVRIPTHPETEQPKGFGYVQYTNVEDAKKALDALQGEYIDNRPVRLDFSTPRPP 346

Query: 266 Q 266
           Q
Sbjct: 347 Q 347

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 51/94 (54%)

Query: 182 ETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVA 241
           E   +FVG L+  +DD  L   F+     I A V+++  + RSRGYG+V F  ++ A+ A
Sbjct: 163 EPATIFVGRLSWSIDDEWLKNEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKEYAEKA 222

Query: 242 METKQGFELNGRALRINWASKREPQQSQQGQRRF 275
           ++   G E++GR +  + ++ +    +    ++F
Sbjct: 223 VKEMHGKEIDGREINCDMSTSKPAAGNNDRAKKF 256

>ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 468

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 91/180 (50%), Gaps = 14/180 (7%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQT 156
            ++VG L  +IDD  LK  F+  G + S ++I ++ S     Y +V++ +   A  A + 
Sbjct: 237 TIFVGRLSWNIDDQWLKNEFEHIGGVQSARVIYERGSTRSRGYGYVDFTDKSYAEKAVKE 296

Query: 157 LNGKEVEGKVLKINWAFQSQQVN-------------SDETFNLFVGDLNVDVDDATLAGT 203
           ++GKE++G+ +  + +     VN             S+ +  LF+G+L+ + D   +   
Sbjct: 297 MHGKELDGRPINCDMSTSKPTVNPREDRAKRFGDMPSEPSDTLFLGNLSFNADRDQIYEL 356

Query: 204 FKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           F      I   +    ++ + +G+G+V +   D AQ A+ET QG  ++ R +R+++++ +
Sbjct: 357 FSPHGEVISVRIPTHPETEQPKGFGYVQYASVDSAQKALETLQGEYIDNRPVRLDFSTPK 416

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 48/84 (57%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S E   +FVG L+ ++DD  L   F+       A V+++  S RSRGYG+V F ++  A+
Sbjct: 232 SGEPATIFVGRLSWNIDDQWLKNEFEHIGGVQSARVIYERGSTRSRGYGYVDFTDKSYAE 291

Query: 240 VAMETKQGFELNGRALRINWASKR 263
            A++   G EL+GR +  + ++ +
Sbjct: 292 KAVKEMHGKELDGRPINCDMSTSK 315

>TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {ON}
           Anc_5.382 YHR086W
          Length = 674

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 90/185 (48%), Gaps = 27/185 (14%)

Query: 99  LYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKNSQECN-----YAFVEYFEPHDANV 152
           LY+G+L    D+  +KQ +  +G +   VKII + N          Y F+E+   ++A+ 
Sbjct: 64  LYMGDLDPMWDESTIKQIWNSLGENNIVVKIITNSNMTSMGRNNPGYCFIEFSNYNNASN 123

Query: 153 AYQTLNGKEVEG---KVLKINWAFQSQQVNSDET----------------FNLFVGDLNV 193
           A    NG  + G   KVLK+NWA    + N +                  F++FVGDL  
Sbjct: 124 ALLK-NGLVIPGYNSKVLKLNWASMHTRSNGNTNCTANNNTSSNNSTNNDFSVFVGDLAP 182

Query: 194 DVDDATLAGTF-KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNG 252
           +V +A L   F   + S I A +++D  +  S+GYGFV F      Q ++   QG  LNG
Sbjct: 183 NVTEAQLFDLFINRYSSTIHAKIVYDQMTNVSKGYGFVRFNNSADQQRSLNEMQGVFLNG 242

Query: 253 RALRI 257
           R++R+
Sbjct: 243 RSIRV 247

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 337 PNNTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGKGCGFVQYVDRSAAETAISKMQ 396

Query: 416 NFPFQGRNLRTGWGK 430
            FP     +R  WG+
Sbjct: 397 GFPIGNSRIRLSWGR 411

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 8/85 (9%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L+  V +  L   F+ F + +   +         +G GFV + ++  A+ A+   
Sbjct: 342 VFIGGLSSLVSEGELRSYFQPFGTIVYVKI------PVGKGCGFVQYVDRSAAETAISKM 395

Query: 246 QGFELNGRALRINWASKREPQQSQQ 270
           QGF +    +R++W   R  +QS Q
Sbjct: 396 QGFPIGNSRIRLSWG--RFAKQSAQ 418

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 8/89 (8%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  +++G L   + +  L+ YFQ  G+I  VKI   K    C   FV+Y +   A  
Sbjct: 336 DPNNTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGKG---C--GFVQYVDRSAAET 390

Query: 153 AYQTLNGKEVEGKVLKINW---AFQSQQV 178
           A   + G  +    ++++W   A QS QV
Sbjct: 391 AISKMQGFPIGNSRIRLSWGRFAKQSAQV 419

>KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some
           similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre- rRNA
           processing and ribosome biogenesis
          Length = 505

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 90/180 (50%), Gaps = 14/180 (7%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
            ++VG L  S+DD+ LK  F+ IGG IS+  I+     +   Y +V++     A  A + 
Sbjct: 257 TIFVGRLSWSVDDEWLKTEFEPIGGVISARVIMERGTDRSRGYGYVDFENKFYAEKAVKE 316

Query: 157 LNGKEVEGKVLKINWAFQSQQVN-------------SDETFNLFVGDLNVDVDDATLAGT 203
           ++GKE++G+ +  + +      N             S  +  LF+G+L+ + D   +  T
Sbjct: 317 MHGKEIDGRPINCDMSTSKPAGNPRNDRAKQFGDTPSQPSDTLFLGNLSFNADRDNIFET 376

Query: 204 FKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           F E    +   +    ++ + +G+G+V +   D+AQ A E  QG  ++ R +R+++++ +
Sbjct: 377 FAEHGEVVSVRLPTHPETNQPKGFGYVQYSSVDEAQKAFEALQGHYIDNRPVRLDFSTPK 436

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 45/82 (54%)

Query: 182 ETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVA 241
           E   +FVG L+  VDD  L   F+     I A V+ +  + RSRGYG+V F  +  A+ A
Sbjct: 254 EPATIFVGRLSWSVDDEWLKTEFEPIGGVISARVIMERGTDRSRGYGYVDFENKFYAEKA 313

Query: 242 METKQGFELNGRALRINWASKR 263
           ++   G E++GR +  + ++ +
Sbjct: 314 VKEMHGKEIDGRPINCDMSTSK 335

>KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {ON}
           Anc_3.49 YOL123W
          Length = 479

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 86/174 (49%), Gaps = 6/174 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           +++G L     ++ L+ YF   G ++ +KI+ D N+ +   + F+ +  P   +   +T 
Sbjct: 96  MFIGGLNWETTEETLRDYFNKYGHVTDLKIMKDSNTGRSRGFGFLTFEHPSSVDEVVKTQ 155

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    +   ++   D+T  +FVG +  DV        F ++ + I A +M 
Sbjct: 156 H--ILDGKVIDPKRSIPREE--QDKTGKIFVGGIGADVRPKEFEEFFSQYGNIIDAQLML 211

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQG 271
           D  +GRSRG+GFV++   D      ++K   E  G+ + I  A  R  Q+ Q G
Sbjct: 212 DKDTGRSRGFGFVTYDSPDAVDRVCQSKY-IEFKGKQIEIKRAQPRHLQKGQYG 264

>Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON}
           YGR159C (REAL)
          Length = 393

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 92/180 (51%), Gaps = 14/180 (7%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQT 156
            ++VG L  SIDD+ LK+ F+  G + S ++I ++ +     Y +V++     A  A Q 
Sbjct: 142 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVINERGTDRSRGYGYVDFENKSYAEKAIQE 201

Query: 157 LNGKEVEGKVLKINWAFQSQQVN-------------SDETFNLFVGDLNVDVDDATLAGT 203
           + GKE++G+ +  + +      N             S+ +  LF+G+L+ + D  T+   
Sbjct: 202 MQGKEIDGRPINCDLSTSKPAGNNTNDRAKKFGDTPSEPSDTLFLGNLSFNADRDTIFEL 261

Query: 204 FKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           F +    +   +    ++ + +G+G+V F   + ++ A+E+ QG  ++ R +R++++S R
Sbjct: 262 FAKHGEVVSVRIPTHPETEQPKGFGYVQFSSLEDSKKALESLQGEYIDNRPVRLDYSSPR 321

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (55%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S E   +FVG L+  +DD  L   F+     I A V+ +  + RSRGYG+V F  +  A+
Sbjct: 137 SGEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVINERGTDRSRGYGYVDFENKSYAE 196

Query: 240 VAMETKQGFELNGRALRINWASKR 263
            A++  QG E++GR +  + ++ +
Sbjct: 197 KAIQEMQGKEIDGRPINCDLSTSK 220

>Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON}
           YGR159C (REAL)
          Length = 391

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 91/181 (50%), Gaps = 15/181 (8%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
            ++VG L  SIDD+ LK+ F+ IGG IS+  I+     +   Y +V++     A  A Q 
Sbjct: 138 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVILERGTDRSRGYGYVDFENQSYAEKAIQE 197

Query: 157 LNGKEVEGKVLKINWAFQSQQVN--------------SDETFNLFVGDLNVDVDDATLAG 202
           + GKE++G+ +  + +      N              S+ +  LF+G+L+ + D  T+  
Sbjct: 198 MQGKEIDGRPINCDISTSKPAGNNNNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDTIFE 257

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            F +    +   +    ++ + +G+G+V +   D A+ A++  QG  ++ R +R++++S 
Sbjct: 258 MFAKHGEVVSVRIPTHPETEQPKGFGYVQYTNLDDAKKALDALQGEYIDNRPVRLDYSSP 317

Query: 263 R 263
           R
Sbjct: 318 R 318

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 47/84 (55%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S E   +FVG L+  +DD  L   F+     I A V+ +  + RSRGYG+V F  Q  A+
Sbjct: 133 SQEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVILERGTDRSRGYGYVDFENQSYAE 192

Query: 240 VAMETKQGFELNGRALRINWASKR 263
            A++  QG E++GR +  + ++ +
Sbjct: 193 KAIQEMQGKEIDGRPINCDISTSK 216

>TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {ON}
           Anc_4.61 YGR159C
          Length = 416

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 96/180 (53%), Gaps = 15/180 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYF-QIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           ++VG L  SIDD+ LK  F  IGG I +  ++     +   Y +V++ +   A  A + +
Sbjct: 159 IFVGRLSWSIDDEWLKNEFDHIGGVIGARVMLERGTDRSRGYGYVDFSDKSYAEKAIKEM 218

Query: 158 NGKEVEGKVLKI-----------NWAFQSQQ---VNSDETFNLFVGDLNVDVDDATLAGT 203
           +GKE++G+ +             N A ++++   + S+ +  LF+G+L+ + D  ++   
Sbjct: 219 HGKEIDGREINCDMSTSKPAGSNNGADRAKKFGDIPSEPSETLFLGNLSFNADRDSIWEM 278

Query: 204 FKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           F +F   +   +    ++ + +G+G+V +G  D A+ A+E  QG  ++ R +R+++++ +
Sbjct: 279 FSKFGEIVSVRLPTHPETEQPKGFGYVQYGNIDDAKKALEALQGEYIDNRPVRLDYSTPK 338

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 49/93 (52%), Gaps = 1/93 (1%)

Query: 182 ETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVA 241
           E   +FVG L+  +DD  L   F      I A VM +  + RSRGYG+V F ++  A+ A
Sbjct: 155 EPATIFVGRLSWSIDDEWLKNEFDHIGGVIGARVMLERGTDRSRGYGYVDFSDKSYAEKA 214

Query: 242 METKQGFELNGRALRINWASKREPQQSQQGQRR 274
           ++   G E++GR +  + ++ + P  S  G  R
Sbjct: 215 IKEMHGKEIDGREINCDMSTSK-PAGSNNGADR 246

>KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49
           YOL123W
          Length = 545

 Score = 72.0 bits (175), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 6/174 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQEC-NYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L++YF   G +  +KI+ D NS     + F+ + EP   +   +T 
Sbjct: 159 MFIGGLNWETTEDGLREYFNKYGHVIDLKIMKDPNSGRSRGFGFLTFEEPSSVDEVVKTQ 218

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    +   ++   D+T  +FVG +  DV        F ++ + I A +M 
Sbjct: 219 H--ILDGKVIDPKRSIPREE--QDKTGKIFVGGIGADVRPKEFEEFFSQYGTIIDAQLML 274

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQG 271
           D  +GRSRG+GFV++   +      + K   +  G+ + I  A  R  Q+ Q G
Sbjct: 275 DKDTGRSRGFGFVTYDSPEAVDRVCQNKY-IDFKGKQIEIKRAEPRHMQKGQYG 327

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 2/87 (2%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S +   +F+G LN +  +  L   F ++   I   +M D  SGRSRG+GF++F E     
Sbjct: 153 SKDNCKMFIGGLNWETTEDGLREYFNKYGHVIDLKIMKDPNSGRSRGFGFLTFEEPSSVD 212

Query: 240 VAMETKQGFELNGRALRINWASKREPQ 266
             ++T+    L+G+ +    +  RE Q
Sbjct: 213 EVVKTQH--ILDGKVIDPKRSIPREEQ 237

>Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON}
           YGR159C (REAL)
          Length = 395

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 89/180 (49%), Gaps = 14/180 (7%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
            ++VG L  SIDD+ LK+ F+ IGG IS+  I      +   Y +V++     A  A Q 
Sbjct: 148 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVIYERGTDRSRGYGYVDFENKSYAEKAIQE 207

Query: 157 LNGKEVEGKVLKINWAFQSQQVN-------------SDETFNLFVGDLNVDVDDATLAGT 203
           + GKE++G+ +  + +      N             S+ +  LF+G+L+ + D   +   
Sbjct: 208 MQGKEIDGRPINCDMSTSKPASNNNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDVIFEL 267

Query: 204 FKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           F +    +   +    ++ + +G+G+V F   + A+ A++  QG  ++ R +R++++S R
Sbjct: 268 FAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPR 327

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 49/84 (58%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S+E   +FVG L+  +DD  L   F+     I A V+++  + RSRGYG+V F  +  A+
Sbjct: 143 SEEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVIYERGTDRSRGYGYVDFENKSYAE 202

Query: 240 VAMETKQGFELNGRALRINWASKR 263
            A++  QG E++GR +  + ++ +
Sbjct: 203 KAIQEMQGKEIDGRPINCDMSTSK 226

>Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W
           (REAL)
          Length = 513

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 97/192 (50%), Gaps = 26/192 (13%)

Query: 99  LYVGNLPKSIDDDLLKQ-YFQIGGSISSVKIIPDKNSQECN-----------YAFVEY-F 145
           LY+G+L  + D + ++Q +  +G +  +V+++ +  S   +           Y F+++  
Sbjct: 46  LYMGDLDPTWDKNTIRQIWTSLGEANVNVRMMWNNPSNSGSRPSVGPKNNQGYCFIDFPS 105

Query: 146 EPHDANVAYQTLNGKEVEG---KVLKINWAFQSQQVN-------SDETFNLFVGDLNVDV 195
             H AN   +  NG  +     + LK+NWA  S   N       S  ++++FVGDL  +V
Sbjct: 106 STHAANALLK--NGMLIPNFPNRKLKLNWATSSYSNNINGANMKSGNSYSIFVGDLAPNV 163

Query: 196 DDATLAGTF-KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRA 254
            ++ L   F   + S   A ++ D  +G S+GYGFV F   D+ Q+A+   QG  LNGRA
Sbjct: 164 TESQLFELFINRYASASHAKIVHDQVTGMSKGYGFVKFTNADEEQLALSEMQGVFLNGRA 223

Query: 255 LRINWASKREPQ 266
           +++   S ++ Q
Sbjct: 224 IKVGPTSGQQQQ 235

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 36/87 (41%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 302 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAEAAIAGMQ 361

Query: 416 NFPFQGRNLRTGWGKEKPTFIRPQQQM 442
            FP     +R  WG+        QQ M
Sbjct: 362 GFPIANSRVRLSWGRSAKQTALLQQAM 388

 Score = 37.0 bits (84), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  +++G L   + +D L+ YFQ  G+I  VKI   K    C   FV+Y +   A  
Sbjct: 301 DPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKG---C--GFVQYVDRLSAEA 355

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQV 178
           A   + G  +    ++++W   ++Q 
Sbjct: 356 AIAGMQGFPIANSRVRLSWGRSAKQT 381

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L+  V +  L   F+ F + +   +         +G GFV + ++  A+ A+   
Sbjct: 307 VFIGGLSSLVTEDELRAYFQPFGTIVYVKIP------VGKGCGFVQYVDRLSAEAAIAGM 360

Query: 246 QGFELNGRALRINWA 260
           QGF +    +R++W 
Sbjct: 361 QGFPIANSRVRLSWG 375

>Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to
           Ashbya gossypii ADL160W
          Length = 541

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 92/188 (48%), Gaps = 9/188 (4%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L++YF   G+++ VKI+ D  + +   + F+ + +    +   +T 
Sbjct: 173 MFIGGLNWETTEDNLREYFSKYGTVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 232

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A   ++   D+T  +FVG +  DV        F E+ S I A +M 
Sbjct: 233 H--ILDGKVIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFSEWGSIIDAQLML 288

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFNG 277
           D  +GRSRG+GF+++   D      + K   E  G+ + I  A   EP+Q Q+ +     
Sbjct: 289 DKDTGRSRGFGFITYDSPDAVDRVCQNK-FIEFKGKRIEIKRA---EPRQVQKQRTTNPS 344

Query: 278 PASGRGGF 285
           P +  G F
Sbjct: 345 PTTQSGTF 352

>KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 445

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 89/176 (50%), Gaps = 14/176 (7%)

Query: 99  LYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           ++VG L  SIDD+ LK  F+ IGG IS+  +      +   Y +V++ +   A  A + +
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKEM 257

Query: 158 NGKEVEGKVLKINW-------------AFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF 204
           +GKE++G+ +  +              A +   V S+ +  LF+G+L+ + D   L   F
Sbjct: 258 HGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLYEIF 317

Query: 205 KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
            ++   +   +    ++ + +G+G+V +G  + A  A E  QG  +N R +R++++
Sbjct: 318 GKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRPVRLDYS 373

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 47/82 (57%)

Query: 182 ETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVA 241
           E   +FVG L+  +DD  L   F+     I A VM++  + RSRGYG+V F ++  A+ A
Sbjct: 194 EPATIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKA 253

Query: 242 METKQGFELNGRALRINWASKR 263
           ++   G E++GR +  + ++ +
Sbjct: 254 IKEMHGKEIDGRPINCDMSTSK 275

>YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}
           NSR1Nucleolar protein that binds nuclear localization
           sequences, required for pre-rRNA processing and ribosome
           biogenesis
          Length = 414

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 88/178 (49%), Gaps = 12/178 (6%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
            ++VG L  SIDD+ LK+ F+ IGG I +  I      +   Y +V++     A  A Q 
Sbjct: 169 TIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQE 228

Query: 157 LNGKEVEGKVLKINWAFQSQQVNSDE-----------TFNLFVGDLNVDVDDATLAGTFK 205
           + GKE++G+ +  + +      N+D            +  LF+G+L+ + D   +   F 
Sbjct: 229 MQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFA 288

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           +    +   +    ++ + +G+G+V F   + A+ A++  QG  ++ R +R++++S R
Sbjct: 289 KHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPR 346

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 49/84 (58%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           ++E   +FVG L+  +DD  L   F+     I A V+++  + RSRGYG+V F  +  A+
Sbjct: 164 TEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAE 223

Query: 240 VAMETKQGFELNGRALRINWASKR 263
            A++  QG E++GR +  + ++ +
Sbjct: 224 KAIQEMQGKEIDGRPINCDMSTSK 247

>TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {ON}
           Anc_3.49 YOL123W
          Length = 518

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 84/171 (49%), Gaps = 6/171 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L+ YF   GS+  +KI+ D N+ +   + F+ +      +   +T 
Sbjct: 166 MFIGGLNWETTEDTLRDYFNKYGSVVELKIMKDNNTGRSRGFGFLTFENASSVDEVVKTQ 225

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A   ++   D+T  +FVG +  DV        F ++ + I A +M 
Sbjct: 226 H--ILDGKVIDPKRAIPREE--QDKTGKIFVGGIGADVRPKEFEEFFAQYGTIIDAQLML 281

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQS 268
           D  +GRSRG+GFV++   D      ++K   E  G+ + I  A  R  Q++
Sbjct: 282 DKDTGRSRGFGFVTYDSPDAVDRVCQSKY-IEFKGKQIEIKRAEPRNNQKA 331

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 2/87 (2%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S ++  +F+G LN +  + TL   F ++ S ++  +M D  +GRSRG+GF++F  ++ + 
Sbjct: 160 SKDSCKMFIGGLNWETTEDTLRDYFNKYGSVVELKIMKDNNTGRSRGFGFLTF--ENASS 217

Query: 240 VAMETKQGFELNGRALRINWASKREPQ 266
           V    K    L+G+ +    A  RE Q
Sbjct: 218 VDEVVKTQHILDGKVIDPKRAIPREEQ 244

>YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA
           binding protein, component of the U1 snRNP protein;
           mutants are defective in meiotic recombination and in
           formation of viable spores, involved in the formation of
           DSBs through meiosis-specific splicing of REC107
           pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs
           of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA
           binding domains RRM2 and RRM3 are required for Nam8p
           meiotic function
          Length = 523

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 67/227 (29%), Positives = 107/227 (47%), Gaps = 37/227 (16%)

Query: 85  VLATQGGREKS----DKILYVGNLPKSIDDDLLKQ-YFQIGGSISSVKIIPD-------- 131
           VL+ QG    S       LY+G+L  + D + ++Q +  +G +  +V+++ +        
Sbjct: 38  VLSLQGASNVSLGTTGNQLYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSR 97

Query: 132 -----KNSQECNYAFVEY-FEPHDANVAYQTLNGKEVEG---KVLKINWA--------FQ 174
                KN+Q   Y FV++    H AN   +  NG  +     K LK+NWA          
Sbjct: 98  SSMGPKNNQ--GYCFVDFPSSTHAANALLK--NGMLIPNFPNKKLKLNWATSSYSNSNNS 153

Query: 175 SQQVNSDETFNLFVGDLNVDVDDATLAGTF-KEFPSFIQAHVMWDMQSGRSRGYGFVSFG 233
              V S    ++FVGDL  +V ++ L   F   + S   A ++ D  +G S+GYGFV F 
Sbjct: 154 LNNVKSGNNCSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFT 213

Query: 234 EQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFNGPAS 280
             D+ Q+A+   QG  LNGRA+++   S +  QQ   G   +N  +S
Sbjct: 214 NSDEQQLALSEMQGVFLNGRAIKVGPTSGQ--QQHVSGNNDYNRSSS 258

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 35/87 (40%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E +L    Q FG I+  K    K C F++Y     A   I  + 
Sbjct: 310 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAEAAIAGMQ 369

Query: 416 NFPFQGRNLRTGWGKEKPTFIRPQQQM 442
            FP     +R  WG+        QQ M
Sbjct: 370 GFPIANSRVRLSWGRSAKQTALLQQAM 396

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  +++G L   + +D L+ YFQ  G+I  VKI   K    C   FV+Y +   A  
Sbjct: 309 DPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGK----C-CGFVQYVDRLSAEA 363

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQV 178
           A   + G  +    ++++W   ++Q 
Sbjct: 364 AIAGMQGFPIANSRVRLSWGRSAKQT 389

>TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3.49
           YOL123W
          Length = 472

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 82/166 (49%), Gaps = 6/166 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPD-KNSQECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D+L+QYF   G++  VKI+ D  N +   + F+ +      +   +T 
Sbjct: 152 MFIGGLNWDTTEDVLRQYFNKYGNVIDVKIMTDGHNGKSRGFGFLTFENSSSVDEVVKTQ 211

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A   ++   D+T  +FVG +  DV        F ++ S I A +M 
Sbjct: 212 H--ILDGKVIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLML 267

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           D  +GRSRG+GFV++   D      + K   E  G+ + I  A +R
Sbjct: 268 DKDTGRSRGFGFVTYDSPDAVDKVCQNK-FIEFKGKTIEIKRAEQR 312

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 2/87 (2%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S ++  +F+G LN D  +  L   F ++ + I   +M D  +G+SRG+GF++F  ++ + 
Sbjct: 146 SKDSCKMFIGGLNWDTTEDVLRQYFNKYGNVIDVKIMTDGHNGKSRGFGFLTF--ENSSS 203

Query: 240 VAMETKQGFELNGRALRINWASKREPQ 266
           V    K    L+G+ +    A  RE Q
Sbjct: 204 VDEVVKTQHILDGKVIDPKRAIPREEQ 230

>NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49
          Length = 581

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 83/175 (47%), Gaps = 6/175 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPD-KNSQECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D LK YF   G++  +KI+ D    +   + F+ +  P   +   +T 
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    +   ++   D+T  +FVG +  DV        F ++ + I A +M 
Sbjct: 258 H--ILDGKVIDPKRSIPREE--QDKTGKIFVGGIGTDVRPKEFEDFFAQYGTIIDAQLML 313

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQ 272
           D  +GRSRG+GFV++   D      + K   E  G+ + I  A  R  Q++   Q
Sbjct: 314 DKDTGRSRGFGFVTYDSGDAVDRVCQNKY-IEFKGKQIEIKRAEPRHNQRAAASQ 367

>ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {ON}
           weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 543

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 85/182 (46%), Gaps = 6/182 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQEC-NYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L+ YF   G +  +KI+ D N+     + F+ +      +   +T 
Sbjct: 161 MFIGGLNWETTEDTLRDYFSKYGRVIDLKIMKDTNTGRSRGFGFLTFDSSSSVDEVVKTQ 220

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A   ++   D+T  +FVG +  DV        F ++ + I A +M 
Sbjct: 221 H--ILDGKVIDPKRAIPREE--QDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDAQLML 276

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFNG 277
           D  +GRSRG+GFV++   D      + K   +  G+ + I  A  R  Q+ QQ     + 
Sbjct: 277 DKDTGRSRGFGFVTYDSPDAVDRVCQNKF-IDFKGKKIEIKRAEPRHMQKQQQMGDGMSA 335

Query: 278 PA 279
           PA
Sbjct: 336 PA 337

>Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W
           (REAL)
          Length = 524

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 89/184 (48%), Gaps = 27/184 (14%)

Query: 99  LYVGNLPKSIDDDLLKQ-YFQIGGSISSVKII-----------PDKNSQECNYAFVEY-F 145
           LY+G+L  + D + ++Q +  +G +  +V+++           P  +     Y FV++  
Sbjct: 56  LYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNSLNNGSRSPMGSKNNQGYCFVDFPS 115

Query: 146 EPHDANVAYQTLNGKEVEG---KVLKINWAFQS--------QQVNSDETFNLFVGDLNVD 194
             H AN   +  NG  +     + LK+NWA  S          V S    ++FVGDL  +
Sbjct: 116 STHAANALLK--NGMLIPNFPNRKLKLNWATSSYSSGNSTFNNVKSSNNCSVFVGDLAPN 173

Query: 195 VDDATLAGTF-KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGR 253
           V ++ L   F   + S   A V+ D  +G S+GYGFV F   D+ Q A+   QG  LNGR
Sbjct: 174 VTESQLFELFINRYASVAHAKVVHDQVTGISKGYGFVKFANSDEQQSALLEMQGVFLNGR 233

Query: 254 ALRI 257
           A+++
Sbjct: 234 AIKV 237

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 36/87 (41%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 310 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAETAIARMQ 369

Query: 416 NFPFQGRNLRTGWGKEKPTFIRPQQQM 442
            FP     +R  WG+        QQ M
Sbjct: 370 GFPIANSRVRLSWGRSAKQTALLQQAM 396

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  +++G L   + +D L+ YFQ  G+I  VKI   K    C   FV+Y +   A  
Sbjct: 309 DPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKG---C--GFVQYVDRLSAET 363

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQV 178
           A   + G  +    ++++W   ++Q 
Sbjct: 364 AIARMQGFPIANSRVRLSWGRSAKQT 389

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L+  V +  L   F+ F + +   +         +G GFV + ++  A+ A+   
Sbjct: 315 VFIGGLSSLVTEDELRAYFQPFGTIVYVKI------PVGKGCGFVQYVDRLSAETAIARM 368

Query: 246 QGFELNGRALRINWA 260
           QGF +    +R++W 
Sbjct: 369 QGFPIANSRVRLSWG 383

>YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA
           binding protein that negatively regulates growth rate;
           interacts with the 3' UTR of the mitochondrial porin
           (POR1) mRNA and enhances its degradation; overexpression
           impairs mitochondrial function; interacts with Dhh1p to
           mediate POR1 mRNA decay; expressed in stationary phase
          Length = 672

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 69/145 (47%), Gaps = 22/145 (15%)

Query: 139 YAFVEYFEPHDANVAYQTLNGKEVEG---------------KVLKINWA----FQSQQVN 179
           Y FVE+    DA  A  +LN   +                 +  ++NWA     QS  + 
Sbjct: 130 YCFVEFETQKDAKFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSS-IP 187

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFK-EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQA 238
           S   F+LFVGDL+    +A L   F+  F S     VM D  +G SR +GFV FG++D+ 
Sbjct: 188 STPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDER 247

Query: 239 QVAMETKQGFELNGRALRINWASKR 263
           + A+    G    GRALR+ +A+ R
Sbjct: 248 RRALIEMSGKWFQGRALRVAYATPR 272

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT ++G +     E  L  L + FG I++ +    K C F+K++    A   I  L 
Sbjct: 357 PTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 416

Query: 416 NFPFQGRNLRTGWGK 430
            F   G  +R  WG+
Sbjct: 417 GFIVGGSPIRLSWGR 431

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 44/94 (46%), Gaps = 7/94 (7%)

Query: 167 LKINWAFQSQQVNSDET-FNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSR 225
           +++N +  S   N+D T   +FVG L     +  L   FK F   +   +         +
Sbjct: 342 MRVNDSLPSNTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI------PNGK 395

Query: 226 GYGFVSFGEQDQAQVAMETKQGFELNGRALRINW 259
             GFV F ++  A+ +++  QGF + G  +R++W
Sbjct: 396 NCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSW 429

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  ++VG L     +  L+  F+  G I +V+I    N + C   FV++ +  DA  
Sbjct: 356 DPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI---PNGKNC--GFVKFEKRIDAEA 410

Query: 153 AYQTLNGKEVEGKVLKINW 171
           + Q L G  V G  ++++W
Sbjct: 411 SIQGLQGFIVGGSPIRLSW 429

>Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086W
           (REAL)
          Length = 541

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 103/235 (43%), Gaps = 46/235 (19%)

Query: 85  VLATQGGRE----KSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKI------------ 128
           VL  QG  +     +   LY+G+L  + D + + Q   I GS+    I            
Sbjct: 41  VLNVQGASDINTGTAGNQLYMGDLDPTWDKNTISQ---IWGSLGEANINVRMMWNNPSNS 97

Query: 129 -----IPDKNSQECNYAFVEY-FEPHDANVAYQTLNGKEVEG---KVLKINWA------- 172
                +  KN+Q   Y FV++    H AN   +  NG  +     K LK+NWA       
Sbjct: 98  SSRPSMGPKNNQ--GYCFVDFPSSTHAANALLK--NGMIIPSFPNKKLKLNWATSSYSNG 153

Query: 173 -----FQSQQVNSDETFNLFVGDLNVDVDDATLAGTF-KEFPSFIQAHVMWDMQSGRSRG 226
                       S   +++FVGDL  +V ++ L   F   + S   A ++ D  +G S+G
Sbjct: 154 NNGGNNSISNSKSGNNYSIFVGDLAPNVTESQLFDLFITRYASAFHAKIVHDQVTGMSKG 213

Query: 227 YGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ-QGQRRFNGPAS 280
           YGFV F   D+ Q+A+   QG  LNGRA+++   S ++ Q  +  G   +N  +S
Sbjct: 214 YGFVKFSNADEQQLALSEMQGVFLNGRAIKVGPTSGQQQQNVRANGSNEYNRTSS 268

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 320 PNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAETAIAGMQ 379

Query: 416 NFPFQGRNLRTGWGKE 431
            FP     +R  WG+ 
Sbjct: 380 GFPIANSRVRLSWGRS 395

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  +++G L   + +D L+ YFQ  G+I  VKI   K    C   FV+Y +   A  
Sbjct: 319 DPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKG---C--GFVQYVDRLSAET 373

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQV 178
           A   + G  +    ++++W   ++Q 
Sbjct: 374 AIAGMQGFPIANSRVRLSWGRSAKQT 399

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L+  V +  L   F+ F + +   +         +G GFV + ++  A+ A+   
Sbjct: 325 VFIGGLSSLVTEDELRAYFQPFGTIVYVKI------PVGKGCGFVQYVDRLSAETAIAGM 378

Query: 246 QGFELNGRALRINWA 260
           QGF +    +R++W 
Sbjct: 379 QGFPIANSRVRLSWG 393

>Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 49/72 (68%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LF+GDL+  V + TL G F +FPSF+ A V  D  + +S G+G+++F ++++A+ AME  
Sbjct: 93  LFIGDLHETVTEETLKGIFGKFPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAERAMEEL 152

Query: 246 QGFELNGRALRI 257
              ++NGR +RI
Sbjct: 153 NYTDVNGREIRI 164

>Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W
           (REAL)
          Length = 663

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 75/164 (45%), Gaps = 24/164 (14%)

Query: 122 SISSVKIIPDKNSQ--ECNYAFVEYFEPHDANVAYQTLNGKEVEG--------------- 164
           +I+ V  I    +Q     Y FVE+    DA  A  +LN   +                 
Sbjct: 110 NINGVSFIDPSTTQLHHAGYCFVEFETQKDAQFAL-SLNATPLPNFYSPTTNSQTNSTFK 168

Query: 165 KVLKINWA----FQSQQVNSDETFNLFVGDLNVDVDDATLAGTFK-EFPSFIQAHVMWDM 219
           +  ++NWA     QS  + S   F+LFVGDL+    +A L   F+  F S     VM D 
Sbjct: 169 RTFRLNWASGATLQSS-IPSTPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDP 227

Query: 220 QSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            +G SR +GFV FG +D+ + A+    G    GRALR+ +A+ R
Sbjct: 228 LTGSSRCFGFVRFGNEDERRRALIEMSGKWFQGRALRVAYATPR 271

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT ++G +     E  L  L + FG I++ +    K C F+K++    A   I  L 
Sbjct: 353 PTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 412

Query: 416 NFPFQGRNLRTGWGK 430
            F   G  +R  WG+
Sbjct: 413 GFIVGGSPIRLSWGR 427

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 7/88 (7%)

Query: 173 FQSQQVNSDET-FNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVS 231
             S   N+D T   +FVG L     +  L   FK F   +   +         +  GFV 
Sbjct: 344 LPSHTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI------PNGKNCGFVK 397

Query: 232 FGEQDQAQVAMETKQGFELNGRALRINW 259
           F ++  A+ +++  QGF + G  +R++W
Sbjct: 398 FEKRIDAEASIQGLQGFIVGGSPIRLSW 425

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  ++VG L     +  L+  F+  G I +V+I    N + C   FV++ +  DA  
Sbjct: 352 DPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI---PNGKNC--GFVKFEKRIDAEA 406

Query: 153 AYQTLNGKEVEGKVLKINW 171
           + Q L G  V G  ++++W
Sbjct: 407 SIQGLQGFIVGGSPIRLSW 425

>Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W
           (REAL)
          Length = 664

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 75/164 (45%), Gaps = 24/164 (14%)

Query: 122 SISSVKIIPDKNSQ--ECNYAFVEYFEPHDANVAYQTLNGKEVEG--------------- 164
           +I+ V  I    +Q     Y FVE+    DA  A  +LN   +                 
Sbjct: 110 NINGVSFIDPSTTQLHHAGYCFVEFETQKDAQFAL-SLNATPLPNFYSPTTNAQTNPTFK 168

Query: 165 KVLKINWA----FQSQQVNSDETFNLFVGDLNVDVDDATLAGTFK-EFPSFIQAHVMWDM 219
           +  ++NWA     QS  + S   F+LFVGDL+    +A L   F+  F S     VM D 
Sbjct: 169 RTFRLNWASGATLQSS-IPSTPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDP 227

Query: 220 QSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            +G SR +GFV FG +D+ + A+    G    GRALR+ +A+ R
Sbjct: 228 LTGSSRCFGFVRFGNEDERRRALIEMSGKWFQGRALRVAYATPR 271

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT ++G +     E  L  L + FG I++ +    K C F+K++    A   I  L 
Sbjct: 356 PTNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 415

Query: 416 NFPFQGRNLRTGWGK 430
            F   G  +R  WG+
Sbjct: 416 GFIVGGSPIRLSWGR 430

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 7/101 (6%)

Query: 160 KEVEGKVLKINWAFQSQQVNSDET-FNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWD 218
           KE     ++ N    S   NSD T   +FVG L     +  L   FK F   +   +   
Sbjct: 334 KEGGNSNVRANEFLPSNTYNSDPTNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRI--- 390

Query: 219 MQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINW 259
                 +  GFV F ++  A+ +++  QGF + G  +R++W
Sbjct: 391 ---PNGKNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSW 428

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  ++VG L     +  L+  F+  G I +V+I    N + C   FV++ +  DA  
Sbjct: 355 DPTNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRI---PNGKNC--GFVKFEKRIDAEA 409

Query: 153 AYQTLNGKEVEGKVLKINW 171
           + Q L G  V G  ++++W
Sbjct: 410 SIQGLQGFIVGGSPIRLSW 428

>Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]
           {ON} YOL123W (HRP1) - putative
           polyadenylated-RNA-binding protein [contig 124] FULL
          Length = 597

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 80/166 (48%), Gaps = 6/166 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D LK YF   G ++ +KI+ D  + +   + F+ + E    +   +T 
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A   ++   D+T  +FVG +  DV        F ++ + I A +M 
Sbjct: 271 H--ILDGKVIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLML 326

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           D  +GRSRG+GF+++   D      E K   E  G+ + I  A  R
Sbjct: 327 DKDTGRSRGFGFITYDTPDAVDRVCENKF-IEFKGKRIEIKRAEPR 371

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G LN +  +  L   F ++       +M D  +GRSRG+GF++F E       ++T+
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 246 QGFELNGRALRINWASKREPQ 266
               L+G+ +    A  RE Q
Sbjct: 271 H--ILDGKVIDPKRAIPREEQ 289

>NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {ON}
           Anc_5.382
          Length = 498

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 90/182 (49%), Gaps = 17/182 (9%)

Query: 92  REKSDKILYVGNLPKSIDDDLLKQYFQ-IGGSISSVKIIPDKN-SQECNYAFVEY-FEPH 148
           R K  +I Y+G L  +  +  +K  ++ +G  + +VK+I +KN      Y F+E+  E H
Sbjct: 66  RNKKTQI-YMGELDPTWTEATIKSIWKSLGEELINVKLIWNKNLGLNQGYCFIEFPSEQH 124

Query: 149 DANVAYQT-LNGKEVEGKVLKINWAF----------QSQQVNSDET-FNLFVGDLNVDVD 196
            +N   +  +N  E   K +K+NW             S QV S  T +++FVGDL  +V 
Sbjct: 125 ASNALLKNGINIPEFPRKKVKLNWTSSSSASLQGSSNSGQVPSTSTNYSVFVGDLAANVT 184

Query: 197 DATLAGTF-KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRAL 255
           +  L   F   F S   A ++ D  +  S+ YGFV F +    Q A+   QG  LNGRA+
Sbjct: 185 EGQLFDLFISRFQSTCHAKIVHDPVTRASKCYGFVKFNDLRDQQRALVEMQGIFLNGRAI 244

Query: 256 RI 257
           +I
Sbjct: 245 KI 246

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 33/76 (43%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT ++G +     E  L    Q FG II  K    KGC F++Y     A   I+ + 
Sbjct: 323 PNNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGKGCGFVQYFDRISAETAILRMQ 382

Query: 416 NFPFQGRNLRTGWGKE 431
            FP     +R  WG+ 
Sbjct: 383 GFPIGNSRIRLSWGRS 398

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 10/87 (11%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +FVG L+  V +  L   F+ F + I   +         +G GFV + ++  A+ A+   
Sbjct: 328 VFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPI------GKGCGFVQYFDRISAETAILRM 381

Query: 246 QGFELNGRALRINWASKREPQQSQQGQ 272
           QGF +    +R++W         QQGQ
Sbjct: 382 QGFPIGNSRIRLSWGRSSR----QQGQ 404

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  ++VG L   + ++ L+  FQ  G+I  VKI   K    C   FV+YF+   A  
Sbjct: 322 DPNNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGKG---C--GFVQYFDRISAET 376

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQ 177
           A   + G  +    ++++W   S+Q
Sbjct: 377 AILRMQGFPIGNSRIRLSWGRSSRQ 401

>KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 588

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 80/166 (48%), Gaps = 6/166 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D LK YF   G ++ +KI+ D  + +   + F+ + E    +   +T 
Sbjct: 210 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 269

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A   ++   D+T  +FVG +  DV        F ++ + I A +M 
Sbjct: 270 H--ILDGKVIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLML 325

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           D  +GRSRG+GF+++   D      E K   E  G+ + I  A  R
Sbjct: 326 DKDTGRSRGFGFITYDTPDAVDRVCENKF-IEFKGKRIEIKRAEPR 370

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G LN +  +  L   F ++       +M D  +GRSRG+GF++F E       ++T+
Sbjct: 210 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 269

Query: 246 QGFELNGRALRINWASKREPQ 266
               L+G+ +    A  RE Q
Sbjct: 270 H--ILDGKVIDPKRAIPREEQ 288

>TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa]
           {ON} Anc_3.49 YOL123W
          Length = 623

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 88/175 (50%), Gaps = 8/175 (4%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQEC-NYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L+ YF   G++  +KI+ D N+ +   + F+ + +    +   +T 
Sbjct: 172 MFIGGLNWETTEDGLRDYFNKYGNVVDLKIMKDNNTGKSRGFGFLTFEKSSSVDEVVKTQ 231

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A   ++   D+T  +F+G +  DV        F ++ + I A +M 
Sbjct: 232 H--ILDGKVIDPKRAIPREE--QDKTGKIFIGGIGADVRPKEFEEFFAKYGNIIDAQLML 287

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR--EPQQSQQ 270
           D  +GRSRG+GFV++   D      + K   E  G+ + I  A  R  +P+Q+Q+
Sbjct: 288 DKDTGRSRGFGFVTYDSPDAVDRVCQHKF-IEFKGKQIEIKRAQPRHNQPRQTQE 341

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 2/87 (2%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S ++  +F+G LN +  +  L   F ++ + +   +M D  +G+SRG+GF++F +     
Sbjct: 166 SKDSCKMFIGGLNWETTEDGLRDYFNKYGNVVDLKIMKDNNTGKSRGFGFLTFEKSSSVD 225

Query: 240 VAMETKQGFELNGRALRINWASKREPQ 266
             ++T+    L+G+ +    A  RE Q
Sbjct: 226 EVVKTQH--ILDGKVIDPKRAIPREEQ 250

>Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W
           (REAL)
          Length = 736

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 68/145 (46%), Gaps = 22/145 (15%)

Query: 139 YAFVEYFEPHDANVAYQTLNGKEVEG---------------KVLKINWA----FQSQQVN 179
           Y FVE+    DA  A  +LN   +                 +  ++NWA     QS  + 
Sbjct: 129 YCFVEFETQTDAQFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSS-IP 186

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFK-EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQA 238
           S   F+LFVGDL+    +A L   F+  F S     VM D  +G SR +GFV FG +D+ 
Sbjct: 187 STPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDER 246

Query: 239 QVAMETKQGFELNGRALRINWASKR 263
           + A+    G    GRALR+ +A+ R
Sbjct: 247 RRALIEMSGKWFQGRALRVAYATPR 271

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT ++G +     E  L  L + FG I++ +    K C F+K++    A   I  L 
Sbjct: 356 PTNTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQ 415

Query: 416 NFPFQGRNLRTGWGK 430
            F   G  +R  WG+
Sbjct: 416 GFIVGGSPIRLSWGR 430

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 55/133 (41%), Gaps = 9/133 (6%)

Query: 147 PHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDET-FNLFVGDLNVDVDDATLAGTFK 205
           P +A     +++  E     ++ N +  S   N+D T   +FVG L     +  L   FK
Sbjct: 321 PLNALQNVHSVHLNESSNSNMRQNESLPSNTFNTDPTNTTVFVGGLGPKTTEFQLRSLFK 380

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREP 265
            F   +   +         +  GFV F ++  A+ +++  QGF + G  +R++W   R  
Sbjct: 381 PFGPILNVRI------PNGKNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG--RPS 432

Query: 266 QQSQQGQRRFNGP 278
             S +      GP
Sbjct: 433 SSSAKAAPNIMGP 445

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  ++VG L     +  L+  F+  G I +V+I    N + C   FV++ +  DA  
Sbjct: 355 DPTNTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRI---PNGKNC--GFVKFEKRIDAEA 409

Query: 153 AYQTLNGKEVEGKVLKINW 171
           + Q L G  V G  ++++W
Sbjct: 410 SIQGLQGFIVGGSPIRLSW 428

>SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 551

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 81/166 (48%), Gaps = 6/166 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L+ YF   G+++ +KI+ D  + +   + F+ + E    +   +T 
Sbjct: 184 MFIGGLNWETTEDNLRDYFSKYGAVTDLKIMRDNATGRSRGFGFLTFAESSSVDEVVKTQ 243

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A   ++   D+T  +FVG +  DV        F ++ + I A +M 
Sbjct: 244 H--ILDGKVIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFSQYGTIIDAQLML 299

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           D  +GRSRG+GF+++   D      + K   E  G+ + I  A  R
Sbjct: 300 DKDTGRSRGFGFITYDTPDAVDRVCQNK-FIEFKGKRIEIKRAEPR 344

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G LN +  +  L   F ++ +     +M D  +GRSRG+GF++F E       ++T+
Sbjct: 184 MFIGGLNWETTEDNLRDYFSKYGAVTDLKIMRDNATGRSRGFGFLTFAESSSVDEVVKTQ 243

Query: 246 QGFELNGRALRINWASKREPQ 266
               L+G+ +    A  RE Q
Sbjct: 244 H--ILDGKVIDPKRAIPREEQ 262

>Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {ON}
           complement(24646..26226) [1581 nt, 527 aa]
          Length = 526

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 80/167 (47%), Gaps = 8/167 (4%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           +++G L     ++ L+ YF   G +  +KI+ D N+ +   + F+ +    DA    + +
Sbjct: 158 MFIGGLNWETTEETLRDYFNKYGKVVELKIMKDNNTGRSRGFGFLTF---EDATSVDEVV 214

Query: 158 NGKEV-EGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVM 216
             + + +GKV+    A   ++   D+T  +FVG +  DV        F ++ + I A +M
Sbjct: 215 KTQHILDGKVIDPKRAIPREE--QDKTGKIFVGGIGADVRPKEFEDFFAQYGTIIDAQLM 272

Query: 217 WDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            D  +GRSRG+GFV++   D      + K   E  G+ + I  A  R
Sbjct: 273 LDKDTGRSRGFGFVTYDSPDAVDRVCQNKF-IEFKGKQIEIKRAEPR 318

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 2/87 (2%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S ++  +F+G LN +  + TL   F ++   ++  +M D  +GRSRG+GF++F  +D   
Sbjct: 152 SKDSCKMFIGGLNWETTEETLRDYFNKYGKVVELKIMKDNNTGRSRGFGFLTF--EDATS 209

Query: 240 VAMETKQGFELNGRALRINWASKREPQ 266
           V    K    L+G+ +    A  RE Q
Sbjct: 210 VDEVVKTQHILDGKVIDPKRAIPREEQ 236

>NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON}
           Anc_1.357
          Length = 610

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 46/72 (63%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LF+GDLN DV   TL   F  +PSF+ A V +D Q+  S G+G+++FG+++ A+ A++  
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 246 QGFELNGRALRI 257
              +L  + +RI
Sbjct: 163 NCMKLGDKVIRI 174

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           ++V NLP SI  + ++ +F   G+I ++  I DK S    +AFV+Y     A  A + LN
Sbjct: 313 VFVSNLPTSITVEEIRNHFNKIGNIMNL-FISDKISSNALWAFVKYSTAACAIRAIKELN 371

Query: 159 GKEVEGKVLKINWAFQ 174
              +  K + ++ AF+
Sbjct: 372 NTFIRKKQIVVSQAFR 387

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 67/146 (45%), Gaps = 3/146 (2%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPD-KNSQECNYAFVEYFEPHDANVAYQTL 157
           L++G+L + +  + L+  F +  S  S K+  D + +    + ++ + +  DA  A    
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           N  ++  KV++I  + + +        N+F    N+  +D  L  + K F  F Q   + 
Sbjct: 163 NCMKLGDKVIRIMPSLRGKNTKKSIGTNVFFT--NLPDEDNRLFHSRKFFEIFRQFGKIL 220

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAME 243
             +   ++  GF+SF  ++ A+  ++
Sbjct: 221 SCRLDPNKNIGFISFEHEEVAKTVVK 246

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 40/85 (47%), Gaps = 7/85 (8%)

Query: 91  GREKSDKILYVGNLPKSIDDDLLKQYFQ----IGGSISSVKIIPDKNSQECNYAFVEYFE 146
            R+ + +ILY+  L +  D D + Q+          IS  K+  +K++     A ++   
Sbjct: 396 SRKPTKRILYLKELSRICDKDFVSQFCHQRRIKFDEISLTKVNLEKSTHT---ARIKCRT 452

Query: 147 PHDANVAYQTLNGKEVEGKVLKINW 171
             DA   Y ++N + + G ++K +W
Sbjct: 453 DEDARKLYNSINNRLIAGSIIKASW 477

>KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weakly
           similar to uniprot|Q99383 Saccharomyces cerevisiae
           YOL123W HRP1 Subunit of cleavage factor I a five-subunit
           complex required for the cleavage and polyadenylation of
           pre-mRNA 3' ends RRM-containing heteronuclear RNA
           binding protein and hnRNPA/B family member that binds to
           poly (A) signal sequences
          Length = 570

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 86/175 (49%), Gaps = 6/175 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           +++G L     ++ L+ YF   G+++ VKI+ D  + +   + F+ +      +   +T 
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A   ++   D+T  +FVG +  DV        F ++ S I A +M 
Sbjct: 248 H--ILDGKVIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLML 303

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQ 272
           D  +GRSRG+GF+++   D      + K   E  G+ + I  A  R+ Q+ +Q Q
Sbjct: 304 DKDTGRSRGFGFITYDTPDAVDRVCQNK-FIEFKGKQIEIKRAEPRQLQKQKQPQ 357

>Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {ON}
           complement(46606..47919) [1314 nt, 438 aa]
          Length = 437

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 90/179 (50%), Gaps = 14/179 (7%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQEC-NYAFVEYFEPHDANVAYQTL 157
           ++VG L  S+DD+ LK  F+  G +   ++I ++ +     Y +V++     A  A + +
Sbjct: 180 IFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSKSAAERAVKEM 239

Query: 158 NGKEVEGKVLKINW-------------AFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF 204
           +GK+++G+ +  +              A +   V S  +  LF+G+L+ + D   +   F
Sbjct: 240 HGKQIDGREINCDMSTSKPAGGNGGDRAKKFGDVPSQPSDTLFLGNLSFNADRDQIYELF 299

Query: 205 KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            +    I   +    ++ + +G+G+V +G  + AQ A++  QG  ++ R +R+++++ +
Sbjct: 300 SKHGEIISVRLPTHPETEQPKGFGYVQYGNVNDAQSALDALQGEYIDNRPVRLDFSTPK 358

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 14/112 (12%)

Query: 175 SQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGE 234
           ++  N  ET  +FVG L+  VDD  L   F+     I A V+++  + RSRGYG+V F  
Sbjct: 169 TEDSNDGETATIFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSS 228

Query: 235 QDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFNGPASGRGGFR 286
           +  A+ A++   G +++GR +  + ++ +              PA G GG R
Sbjct: 229 KSAAERAVKEMHGKQIDGREINCDMSTSK--------------PAGGNGGDR 266

>Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {ON}
           complement(104488..106251) [1764 nt, 588 aa]
          Length = 587

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 70/142 (49%), Gaps = 15/142 (10%)

Query: 132 KNSQECNYAFVEYFEP-----HDANVAYQTLNGKEVEGKVLKINWA----FQSQQVNSDE 182
           +N ++  YA      P      D+N  Y    GK    +  ++NWA     QS    + E
Sbjct: 172 QNQEDAQYALSLNSNPIPNILSDSNNLYTNPTGK----RNFRLNWASGATLQSSIPVTPE 227

Query: 183 TFNLFVGDLNVDVDDATLAGTFKE-FPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVA 241
            F+LFVGDL+    +A L   F++ + S     VM D  +G SR +GF+ FG+QD+ + A
Sbjct: 228 -FSLFVGDLSPTATEADLLSLFQQQYRSVKTVRVMTDPITGASRCFGFIRFGDQDERKRA 286

Query: 242 METKQGFELNGRALRINWASKR 263
           +    G    GR LR+ +A+ R
Sbjct: 287 LSEMNGVWCQGRPLRVAYATPR 308

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%)

Query: 358 VTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNF 417
           V+T +IG +     E  +  L + FG I++ K  P K C F+K++    A   I  L  F
Sbjct: 379 VSTVFIGGLSPKINESQVRSLFKPFGNIVNVKLPPGKNCGFVKFENRIDAEAAIQGLQGF 438

Query: 418 PFQGRNLRTGWGK 430
              G  +R  WGK
Sbjct: 439 IVAGNPIRLSWGK 451

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 50/102 (49%), Gaps = 5/102 (4%)

Query: 84  PVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVE 143
           P L+    + +    +++G L   I++  ++  F+  G+I +VK+ P KN   C   FV+
Sbjct: 367 PQLSKSNSQNELVSTVFIGGLSPKINESQVRSLFKPFGNIVNVKLPPGKN---C--GFVK 421

Query: 144 YFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFN 185
           +    DA  A Q L G  V G  ++++W   S   + + + N
Sbjct: 422 FENRIDAEAAIQGLQGFIVAGNPIRLSWGKASSMTSGNASNN 463

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 40/74 (54%), Gaps = 6/74 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L+  ++++ +   FK F + +      +++    +  GFV F  +  A+ A++  
Sbjct: 382 VFIGGLSPKINESQVRSLFKPFGNIV------NVKLPPGKNCGFVKFENRIDAEAAIQGL 435

Query: 246 QGFELNGRALRINW 259
           QGF + G  +R++W
Sbjct: 436 QGFIVAGNPIRLSW 449

>Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON}
           complement(931..1584) [654 nt, 218 aa]
          Length = 217

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 98/212 (46%), Gaps = 21/212 (9%)

Query: 90  GGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPH 148
            G +  D  +YVGN+  SI  +LL + F     I+ +    DK  Q    YAF++++   
Sbjct: 6   SGFKNPDLSVYVGNIDPSITKELLYELFVQISPIAKINYPKDKVLQTHQGYAFIDFYTEE 65

Query: 149 DANVAYQTLNGK-EVEGKVLKINWAFQSQQVNSDETFNL------------FVGDLNVDV 195
           DAN A Q  N   ++  +VLK+     +  ++S  + NL            FV +L+  V
Sbjct: 66  DANYAIQAFNNNVQLNNRVLKVRKT--NNNISSKSSTNLSQATSVTPYAKIFVKNLDSSV 123

Query: 196 DDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRAL 255
           D A L+  FK+F S  +   ++ + +G  R   +V F + ++A  A+++  G  +  + +
Sbjct: 124 DVAYLSKLFKKFGSLARESEIFHLSNGELRC-AYVYFKDYEKADEAIKSLDGQLVTNKRI 182

Query: 256 RINWASK----REPQQSQQGQRRFNGPASGRG 283
            I +A K    ++ +  +   R  N  A   G
Sbjct: 183 NIEYAFKENGDKKAKYGEDVDRLLNKEAIKNG 214

>TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON}
           Anc_6.104 YBR212W
          Length = 594

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 78/165 (47%), Gaps = 26/165 (15%)

Query: 122 SISSVKIIPDKNSQECN---YAFVEYFEPHDANVAYQTLNGKEV---------------E 163
           SI+ V  I D N+ + +   Y FVE+    DA  A  +LN   +                
Sbjct: 112 SINGVSFI-DPNTTQLHHAGYCFVEFANQVDAKFAL-SLNSSPIPNFYSSSISLHTNPNN 169

Query: 164 GKVLKINWAFQSQQVNSD----ETFNLFVGDLNVDVDDATLAGTF-KEFPSFIQAHVMWD 218
            +  ++NWA     +NS       F+LFVGDL+  V +A L   F K+F S     VM D
Sbjct: 170 NRNFRLNWA-SGATLNSSIPLTPEFSLFVGDLSPLVTEADLLSLFQKKFKSVKTVRVMTD 228

Query: 219 MQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
             +G SR +GF+ F ++ + + A+    G   NGR LR+ +A+ R
Sbjct: 229 PITGTSRCFGFIRFTDELERKNALIEMNGIWCNGRPLRVAYATPR 273

>Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {ON}
           YBR212W (NGR1) - negative growth regulatory protein
           [contig 235] FULL
          Length = 535

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 74/162 (45%), Gaps = 22/162 (13%)

Query: 123 ISSVKIIPDKNSQ--ECNYAFVEYFEPHDANVAYQTLNGKEV------EGKV-------- 166
           I+ V  I    +Q     Y FVE+    DA  A  TLN   +       G V        
Sbjct: 94  INGVSFIDPNTTQLHHAGYCFVEFESLADAQWAL-TLNSSPLPDITCGNGHVSTNPSGLR 152

Query: 167 -LKINWAFQS---QQVNSDETFNLFVGDLNVDVDDATLAGTF-KEFPSFIQAHVMWDMQS 221
             ++NWA  +     + S   F+LFVGDL+    +A L   F K+F S     VM D  +
Sbjct: 153 NFRLNWASGATLLSAIPSTPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPIT 212

Query: 222 GRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           G SR +GFV FG++ + + A+    G    GR LR+ +A+ R
Sbjct: 213 GASRCFGFVRFGDEQERRRALVEMNGVWCQGRNLRVAYATPR 254

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 34/75 (45%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E  L  L   FG II+ K  P KGC F+KY     A   I  + 
Sbjct: 393 PNNTTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQ 452

Query: 416 NFPFQGRNLRTGWGK 430
            F   G  +R  WG+
Sbjct: 453 GFIVGGNPIRLSWGR 467

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 6/74 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L   + +  L   F  F + I   +         +G GFV +  +  A+ A++  
Sbjct: 398 VFIGGLTSQISERQLHSLFSPFGAIINVKI------PPGKGCGFVKYAYRIDAEAAIQGM 451

Query: 246 QGFELNGRALRINW 259
           QGF + G  +R++W
Sbjct: 452 QGFIVGGNPIRLSW 465

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 39/90 (43%), Gaps = 5/90 (5%)

Query: 82  AAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAF 141
           A P          ++  +++G L   I +  L   F   G+I +VKI P K        F
Sbjct: 381 AQPTAPRSAFTNPNNTTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGKGC-----GF 435

Query: 142 VEYFEPHDANVAYQTLNGKEVEGKVLKINW 171
           V+Y    DA  A Q + G  V G  ++++W
Sbjct: 436 VKYAYRIDAEAAIQGMQGFIVGGNPIRLSW 465

>SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {ON}
           weakly similar to uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 490

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 67/145 (46%), Gaps = 22/145 (15%)

Query: 139 YAFVEYFEPHDANVAYQTLNGKEVEG---------------KVLKINWA----FQSQQVN 179
           Y FVE+ +  DA  A  TLN   +                 +  ++NWA     QS  + 
Sbjct: 114 YCFVEFQKLEDAQWAL-TLNSTPLPNILSNSTHSQTNPTLQRSFRLNWASGATLQSA-IP 171

Query: 180 SDETFNLFVGDLNVDVDDATLAGTF-KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQA 238
           S   F+LFVGDL+    +A L   F K F S     VM D  +G SR +GFV F ++ + 
Sbjct: 172 STPEFSLFVGDLSPSATEAHLLSLFQKNFKSVKTVRVMTDPITGASRCFGFVRFADEQER 231

Query: 239 QVAMETKQGFELNGRALRINWASKR 263
           + A+    G    GR LR+ +A+ R
Sbjct: 232 RRALVEMNGVWCQGRCLRVAYATPR 256

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 38/87 (43%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P+ TT +IG +     E  L  L   FG I + +    KGC F+K+++   A   I  + 
Sbjct: 364 PKNTTVFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKGCGFVKFESRIDAEAAIQGMQ 423

Query: 416 NFPFQGRNLRTGWGKEKPTFIRPQQQM 442
            F   G  +R  WG+        QQ M
Sbjct: 424 GFIVGGNPIRLSWGRSSGEKTPTQQHM 450

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 6/74 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L   + +  L   F  F S     +       + +G GFV F  +  A+ A++  
Sbjct: 369 VFIGGLASQISEPQLYSLFLPFGSITNVRI------PQGKGCGFVKFESRIDAEAAIQGM 422

Query: 246 QGFELNGRALRINW 259
           QGF + G  +R++W
Sbjct: 423 QGFIVGGNPIRLSW 436

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 96  DKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQ 155
           +  +++G L   I +  L   F   GSI++V+I   K        FV++    DA  A Q
Sbjct: 366 NTTVFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKGC-----GFVKFESRIDAEAAIQ 420

Query: 156 TLNGKEVEGKVLKINWAFQS 175
            + G  V G  ++++W   S
Sbjct: 421 GMQGFIVGGNPIRLSWGRSS 440

>TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {ON}
           Anc_6.104 YBR212W
          Length = 617

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 68/145 (46%), Gaps = 22/145 (15%)

Query: 139 YAFVEYFEPHDANVAYQTLNGKEVEGKV---------------LKINWA----FQSQQVN 179
           Y FVE+    DA  A  +LN   +   +                ++NWA     QS  + 
Sbjct: 141 YCFVEFESQQDAQFAL-SLNSGPLPNIISRSTNLPTNPSGQRNFRLNWASGATLQSS-IP 198

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKE-FPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQA 238
           S   F+LFVGDL+    +A L   F++ F S     VM D  +G SR +GFV FG +++ 
Sbjct: 199 SRPEFSLFVGDLSPTATEADLLSLFQQKFRSVKTVRVMTDPITGASRCFGFVRFGNEEER 258

Query: 239 QVAMETKQGFELNGRALRINWASKR 263
           + A+    G    GR LR+ +A+ R
Sbjct: 259 RRALVEMNGVWCQGRCLRVAYATPR 283

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 33/77 (42%)

Query: 354 APPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVA 413
            PP  TT +IG +     E  L  L   FG I+  K    K C F+KY+    A   I  
Sbjct: 381 TPPNNTTVFIGGLTPKINEAQLQALFSPFGNILTVKIPQGKNCGFVKYENRIDAEAAIQG 440

Query: 414 LTNFPFQGRNLRTGWGK 430
           +  F   G  +R  WG+
Sbjct: 441 MQGFIVGGNPVRLSWGR 457

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L   +++A L   F  F + +   +       + +  GFV +  +  A+ A++  
Sbjct: 388 VFIGGLTPKINEAQLQALFSPFGNILTVKI------PQGKNCGFVKYENRIDAEAAIQGM 441

Query: 246 QGFELNGRALRINW 259
           QGF + G  +R++W
Sbjct: 442 QGFIVGGNPVRLSW 455

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 96  DKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQ 155
           +  +++G L   I++  L+  F   G+I +VKI      Q  N  FV+Y    DA  A Q
Sbjct: 385 NTTVFIGGLTPKINEAQLQALFSPFGNILTVKI-----PQGKNCGFVKYENRIDAEAAIQ 439

Query: 156 TLNGKEVEGKVLKINW 171
            + G  V G  ++++W
Sbjct: 440 GMQGFIVGGNPVRLSW 455

>Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W
           (REAL)
          Length = 539

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 89/191 (46%), Gaps = 10/191 (5%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPD-KNSQECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L++YF   G+++ +KI+ D    +   + F+ + +P   +   +T 
Sbjct: 164 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 223

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A    +   D+T  +FVG +  DV        F ++ + I A +M 
Sbjct: 224 H--ILDGKVIDPKRAIPRDE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLML 279

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFNG 277
           D  +G+SRG+GFV++   D      + K   +   R + I  A  R  QQ        N 
Sbjct: 280 DKDTGQSRGFGFVTYDSADAVDRVCQNK-FIDFKDRKIEIKRAEPRHMQQKSSNNGGTNT 338

Query: 278 PASG----RGG 284
            ++G    RGG
Sbjct: 339 GSTGNMNRRGG 349

>Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W
           (PES4) - poly(A) binding protein; related to PES4
           protein homolog YHR015w [contig 89] FULL
          Length = 560

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 47/80 (58%)

Query: 178 VNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQ 237
           V S +  +LF+GDL+ +V +  L  TF+ FPS I   +  D ++G S GYG+++F     
Sbjct: 9   VTSQKVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKD 68

Query: 238 AQVAMETKQGFELNGRALRI 257
           A+ A+ET     L GR +RI
Sbjct: 69  AETAIETFSYVNLFGREVRI 88

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/180 (19%), Positives = 81/180 (45%), Gaps = 10/180 (5%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           L++G+L  ++ + +L   F++  S+ SVKI  D  +     Y ++ ++   DA  A +T 
Sbjct: 17  LFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIETF 76

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVD---VDDATLAGTFKEFPSFIQAH 214
           +   + G+ ++I  + ++     +   N+F  +L ++   +       TF+E+   +   
Sbjct: 77  SYVNLFGREVRIMPSMRNSYFRKNIGTNVFFSNLPLEQPALTTRVFYETFREYGKVLSCK 136

Query: 215 VMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRR 274
           +       R +  GFV F     A+ A+ +    E  G  +       ++ ++S + ++R
Sbjct: 137 L------DRRKNIGFVYFESDAAARKAIASYNNKEYYGNIVTCGLHFDKDIRRSPEFEKR 190

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           ++V NLP +I ++ L  YF   G + SV       +   ++ FV Y +  D   A  +LN
Sbjct: 227 IHVKNLPFNICNEDLLNYFSRIGPVKSV-FTSKLEAYRSSWGFVTYKKGCDTRKALDSLN 285

Query: 159 GKEVEGKVLKINWAFQSQ 176
           G     + L++N A ++ 
Sbjct: 286 GAIFMDRRLEVNKALKNN 303

>Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W
           (REAL)
          Length = 551

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 83/170 (48%), Gaps = 6/170 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L++YF   G+++ +KI+ D  + +   + F+ + +P   +   +T 
Sbjct: 163 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 222

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A    +   D+T  +FVG +  DV        F ++ + I A +M 
Sbjct: 223 H--ILDGKVIDPKRAIPRDE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLML 278

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQ 267
           D  +G+SRG+GFV++   D      + K   +   R + I  A  R  QQ
Sbjct: 279 DKDTGQSRGFGFVTYDSADAVDRVCQNK-FIDFKDRKIEIKRAEPRHMQQ 327

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S E+  +F+G LN D  +  L   F ++ +     +M D  +GRSRG+GF+SF +     
Sbjct: 157 SKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVD 216

Query: 240 VAMETKQGFELNGRALRINWASKREPQ 266
             ++T+    L+G+ +    A  R+ Q
Sbjct: 217 EVVKTQH--ILDGKVIDPKRAIPRDEQ 241

>YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit of
           cleavage factor I, a five-subunit complex required for
           the cleavage and polyadenylation of pre-mRNA 3' ends;
           RRM-containing heteronuclear RNA binding protein and
           hnRNPA/B family member that binds to poly (A) signal
           sequences
          Length = 534

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 83/170 (48%), Gaps = 6/170 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L++YF   G+++ +KI+ D  + +   + F+ + +P   +   +T 
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A    +   D+T  +FVG +  DV        F ++ + I A +M 
Sbjct: 221 H--ILDGKVIDPKRAIPRDE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLML 276

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQ 267
           D  +G+SRG+GFV++   D      + K   +   R + I  A  R  QQ
Sbjct: 277 DKDTGQSRGFGFVTYDSADAVDRVCQNK-FIDFKDRKIEIKRAEPRHMQQ 325

>Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W
           (REAL)
          Length = 536

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 83/170 (48%), Gaps = 6/170 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L++YF   G+++ +KI+ D  + +   + F+ + +P   +   +T 
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A    +   D+T  +FVG +  DV        F ++ + I A +M 
Sbjct: 221 H--ILDGKVIDPKRAIPRDE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLML 276

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQ 267
           D  +G+SRG+GFV++   D      + K   +   R + I  A  R  QQ
Sbjct: 277 DKDTGQSRGFGFVTYDSADAVDRVCQNK-FIDFKDRKIEIKRAEPRHMQQ 325

>NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.49
           YOL123W
          Length = 607

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 79/166 (47%), Gaps = 6/166 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPD-KNSQECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L+ YF   G++  +KI+ D    +   + F+ +  P   +   +T 
Sbjct: 199 MFIGGLNWETTEDGLRNYFNKYGNVIELKIMKDGATGRSRGFGFLTFEHPSSVDEVVKTQ 258

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    +   ++   D+   +FVG +  DV        F +F + I A +M 
Sbjct: 259 H--ILDGKVIDPKRSIPKEE--QDKIGKIFVGGIGTDVRPKEFEEFFAQFGTIIDAQLML 314

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           D  +GRSRG+GF+++   D      + K   +  G+ + +  A +R
Sbjct: 315 DKDTGRSRGFGFITYDSADAVDKVCQNKY-IDFKGKQIEVKRAQQR 359

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 33/53 (62%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSF 232
           S ++  +F+G LN +  +  L   F ++ + I+  +M D  +GRSRG+GF++F
Sbjct: 193 SKDSCKMFIGGLNWETTEDGLRNYFNKYGNVIELKIMKDGATGRSRGFGFLTF 245

>Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W
           (REAL)
          Length = 613

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 47/72 (65%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LF+GDL+  V + TL   F ++PSF+ A V  D  S +S G+G+++F ++++A  AME  
Sbjct: 93  LFIGDLHETVTEETLKDVFGKYPSFVSAKVCLDSVSKKSLGHGYLNFEDKEEAGKAMEEL 152

Query: 246 QGFELNGRALRI 257
              E+NG+ +RI
Sbjct: 153 NYTEVNGKEIRI 164

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/158 (19%), Positives = 72/158 (45%), Gaps = 4/158 (2%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE-CNYAFVEYFEPHDANVAYQTL 157
           L++G+L +++ ++ LK  F    S  S K+  D  S++   + ++ + +  +A  A + L
Sbjct: 93  LFIGDLHETVTEETLKDVFGKYPSFVSAKVCLDSVSKKSLGHGYLNFEDKEEAGKAMEEL 152

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           N  EV GK ++I  + ++     +   N+F  +L ++    T    +  F  + +   + 
Sbjct: 153 NYTEVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPQLTTRAFYDTFSRYGK---IL 209

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRAL 255
             +    +  GFV F ++  A+  ++        G+ +
Sbjct: 210 SCKLDSRKDIGFVYFEDEKTARNVIKMYNNTNFFGKKI 247

>TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.382
           YHR086W
          Length = 494

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 91/196 (46%), Gaps = 30/196 (15%)

Query: 88  TQGGREKSDKILYVGNLPKSIDDDLLKQYF-QIGGSISSVKII-----------PDKNSQ 135
           TQG   K + +LY+G L  S ++ ++K  + ++G   ++V+++           P +   
Sbjct: 37  TQG---KGNNVLYMGGLDYSWNEAVIKDIWNKVGEPATNVRMMWNMQFQHNNAGPTEGKS 93

Query: 136 ECNYAFVEYFEPHDANVAYQTLNGKEV---EGKVLKINW----------AFQSQQVNSDE 182
              Y FVE F  H+        NG  +   +G+  K+NW               Q     
Sbjct: 94  NLGYCFVE-FSTHETASNAIMKNGTMIPGYKGRYFKLNWSSGSSLSSSATHTENQGPQSN 152

Query: 183 TFNLFVGDLNVDVDDATLAGTFK-EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVA 241
            +++FVGDL  +V ++ L   FK  + S + + ++ D  +  S+GYGF+ F +Q+    A
Sbjct: 153 DYSVFVGDLGQNVTESQLYNLFKSHYASTLSSKIIHDPLTYISKGYGFIKFHDQNDYNDA 212

Query: 242 METKQGFELNGRALRI 257
           +   Q   LNGR +++
Sbjct: 213 LSKMQNKILNGRGIKV 228

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           L V N  K I  +  K YF   G++  ++I  D N+   N  FV Y +   A  + + L 
Sbjct: 303 LVVSNASKDISMNEFKSYFLPFGNL--IEISKDPNT---NILFVTYVDRICAENSMRILQ 357

Query: 159 GKEVEGKVLKINWA 172
           GK + G  ++I W 
Sbjct: 358 GKVIRGNKIQIAWG 371

>NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa]
           {ON} Anc_3.49
          Length = 552

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 71/137 (51%), Gaps = 9/137 (6%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPH--DANVAYQ 155
           L++G L     ++ LK YF   G++  +KI+ D NS +   + F+ +  P   D  V  Q
Sbjct: 231 LFIGGLNWETTEEKLKDYFSKYGNVVDLKIMKDANSGRSRGFGFLSFEHPSSVDEVVKSQ 290

Query: 156 TLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHV 215
            +    ++GKV+    A   ++   D+T  +FVG +  DV        F ++ + I A +
Sbjct: 291 HI----LDGKVIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQL 344

Query: 216 MWDMQSGRSRGYGFVSF 232
           M D  +GRSRG+GF+++
Sbjct: 345 MLDKDTGRSRGFGFITY 361

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S E+  LF+G LN +  +  L   F ++ + +   +M D  SGRSRG+GF+SF  +  + 
Sbjct: 225 SKESCKLFIGGLNWETTEEKLKDYFSKYGNVVDLKIMKDANSGRSRGFGFLSF--EHPSS 282

Query: 240 VAMETKQGFELNGRALRINWASKREPQ 266
           V    K    L+G+ +    A  RE Q
Sbjct: 283 VDEVVKSQHILDGKVIDPKRAIPREEQ 309

>ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {ON}
           some similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 558

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 93/195 (47%), Gaps = 20/195 (10%)

Query: 99  LYVGNLPKSIDDDLLKQYF-QIGGSISSVKIIPDKN---------SQECNYAFVEYFEPH 148
           LY+G+L  S D++ ++Q +  +G S   ++++   N              Y F+E+  P 
Sbjct: 47  LYMGDLDPSWDENTIRQIWGSLGESNVVIRLMLHNNVSGSGTMGPRNNLGYCFLEF--PS 104

Query: 149 DANVAYQTL-NGKEVEG---KVLKINWAFQSQQVNSD-ETFNLFVGDLNVDVDDATLAGT 203
             + +   L NG ++     K LK+NWA  S         +++FVGDL  +V ++ L   
Sbjct: 105 TVHASNALLKNGMQIPNFVHKRLKLNWASSSHSSAGAFNEYSVFVGDLAPNVTESQLFEL 164

Query: 204 F-KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
           F   F S     +++D  +G S+GY FV F      Q A+   QG  L+GRA+R++ A  
Sbjct: 165 FISRFNSTSHVKIVYDQLTGVSKGYAFVKFTNPAHQQRALLEMQGIFLSGRAIRVSNAGH 224

Query: 263 REPQQSQQGQRRFNG 277
              Q S  G+ +  G
Sbjct: 225 L--QNSADGKSKATG 237

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 36/87 (41%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT ++G +     E +L    Q FG I+  K    KGC F++Y     A   I  + 
Sbjct: 280 PNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRISAETAIAKMQ 339

Query: 416 NFPFQGRNLRTGWGKEKPTFIRPQQQM 442
            FP     +R  WG+        QQ +
Sbjct: 340 GFPIGNSRVRLSWGRSAKQAATVQQAL 366

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  ++VG L   + +D L+ YFQ  G+I  VKI   K    C   FV+Y +   A  
Sbjct: 279 DPNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGKG---C--GFVQYVDRISAET 333

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQ 177
           A   + G  +    ++++W   ++Q
Sbjct: 334 AIAKMQGFPIGNSRVRLSWGRSAKQ 358

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 7/86 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +FVG L+  V +  L   F+ F + +   +         +G GFV + ++  A+ A+   
Sbjct: 285 VFVGGLSSLVAEDELRAYFQPFGTIVYVKIP------VGKGCGFVQYVDRISAETAIAKM 338

Query: 246 QGFELNGRALRINWA-SKREPQQSQQ 270
           QGF +    +R++W  S ++    QQ
Sbjct: 339 QGFPIGNSRVRLSWGRSAKQAATVQQ 364

>CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} similar
           to uniprot|P32831 Saccharomyces cerevisiae YBR212w
           Negative growth regulatory protein
          Length = 802

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 75/163 (46%), Gaps = 22/163 (13%)

Query: 122 SISSVKIIPDKNSQ--ECNYAFVEYFEPHDANVAY-----------QTLNGKEVEG---K 165
           +I+ V  I    +Q     Y FVE+    DA                T  G+++     +
Sbjct: 153 NINGVSFIDPATTQLHHAGYCFVEFESQKDAQEGLALNSTPLPNFVSTTTGQDINPTGQR 212

Query: 166 VLKINWA----FQSQQVNSDETFNLFVGDLNVDVDDATLAGTFK-EFPSFIQAHVMWDMQ 220
             ++NWA     QS    + E ++LFVGDL+    +A L   F+ +F S     VM D  
Sbjct: 213 TFRLNWASGATLQSSIPTTPE-YSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPI 271

Query: 221 SGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           +G SR +GFV FG +++ + A+    G    GR LR+ +A+ R
Sbjct: 272 TGASRCFGFVRFGNEEERRRALIEMNGVHFQGRTLRVAYATPR 314

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT ++G +    QE  L  + Q FG I+  K  P K C F+K++    A   I  L 
Sbjct: 464 PTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGKNCGFVKFEHKIDAEAAIQGLQ 523

Query: 416 NFPFQGRNLRTGWGK 430
            F      +R  WG+
Sbjct: 524 GFVLVENPIRLSWGR 538

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 5/79 (6%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  ++VG L  ++ +  L++ FQ  G+I S+KI P KN   C   FV++    DA  
Sbjct: 463 DPTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGKN---C--GFVKFEHKIDAEA 517

Query: 153 AYQTLNGKEVEGKVLKINW 171
           A Q L G  +    ++++W
Sbjct: 518 AIQGLQGFVLVENPIRLSW 536

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 15/98 (15%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +FVG L   V +  L   F+ F + +   +         +  GFV F  +  A+ A++  
Sbjct: 469 VFVGGLGPTVQEQQLRKIFQPFGNILSIKI------PPGKNCGFVKFEHKIDAEAAIQGL 522

Query: 246 QGFELNGRALRINWA---------SKREPQQSQQGQRR 274
           QGF L    +R++W          +K  PQ    G +R
Sbjct: 523 QGFVLVENPIRLSWGRNHVAKNMINKLPPQYVSSGNQR 560

>KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {ON}
           some similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 547

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 4/101 (3%)

Query: 167 LKINWAFQS---QQVNSDETFNLFVGDLNVDVDDATLAGTF-KEFPSFIQAHVMWDMQSG 222
            ++NWA  +     + S   F+LFVGDL+    +A L   F K+F S     VM D  +G
Sbjct: 155 FRLNWASGATLLSAIPSTPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITG 214

Query: 223 RSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            SR +GFV FG++ + + A+    G    GR LR+ +A+ R
Sbjct: 215 ASRCFGFVRFGDEQERRRALVEMNGVWCQGRNLRVAYATPR 255

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 34/75 (45%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E  L  L   FG II+ K  P KGC F+KY     A   I  + 
Sbjct: 403 PNNTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQ 462

Query: 416 NFPFQGRNLRTGWGK 430
            F   G  +R  WG+
Sbjct: 463 GFIVGGNPIRLSWGR 477

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 6/75 (8%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
            +F+G L     +  L   F  F + I   +         +G GFV +  +  A+ A++ 
Sbjct: 407 TVFIGGLTSHTSERQLHSLFAPFGTIINVKI------PPGKGCGFVKYAYRIDAEAAIQG 460

Query: 245 KQGFELNGRALRINW 259
            QGF + G  +R++W
Sbjct: 461 MQGFIVGGNPIRLSW 475

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 96  DKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQ 155
           +  +++G L     +  L   F   G+I +VKI P K    C   FV+Y    DA  A Q
Sbjct: 405 NTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKG---C--GFVKYAYRIDAEAAIQ 459

Query: 156 TLNGKEVEGKVLKINW 171
            + G  V G  ++++W
Sbjct: 460 GMQGFIVGGNPIRLSW 475

>CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar to
           uniprot|Q99181 Saccharomyces cerevisiae YOR319w
           essential yeast splicing factor
          Length = 211

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 79/170 (46%), Gaps = 15/170 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQTL 157
           +YVGN+   +  +LL + F   G +  VK   DK SQE   +AF+E+F   DA+     +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 158 NGK-EVEGKVLKI---NWAFQSQQVNSDETFN--------LFVGDLNVDVDDATLAGTFK 205
           N   ++  KVLKI   N A Q    N     +        +FV D+   V+   L   F 
Sbjct: 68  NNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQLFS 127

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQG-FELNGRA 254
           +F    +   ++ + +G  R   F+ F   D A +A++T  G F +N +A
Sbjct: 128 KFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIMNKKA 176

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 2/77 (2%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHD-ANVAYQTL 157
           ++V ++  +++   L Q F   G ++    +   ++ E   AF+ YF+ +D A++A QTL
Sbjct: 108 VFVKDIADTVEVRHLTQLFSKFGPLAKTPEVFTVSNGEVRCAFI-YFKFYDNADLAIQTL 166

Query: 158 NGKEVEGKVLKINWAFQ 174
           NG+ +  K   + +AF+
Sbjct: 167 NGQFIMNKKASLEYAFK 183

>CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some
           similarities with uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 452

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 81/171 (47%), Gaps = 6/171 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPD-KNSQECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L+ YF   G +  +KI+ D    +   + F+ +      +   +T 
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVVKTQ 183

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    A   ++   D+T  +FVG +  DV        F ++ + I A +M 
Sbjct: 184 H--ILDGKVIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLML 239

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQS 268
           D  +GRSRG+GF+++   D      + K   +  GR + I  A+ R  Q++
Sbjct: 240 DKDTGRSRGFGFITYDTPDAVDKVCQNK-FIDFKGRKIEIKRAAPRHLQKT 289

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 2/87 (2%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S ++  +F+G LN +  +  L   F ++    +  +M D  +GRSRG+GF++F       
Sbjct: 118 SKDSCKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVD 177

Query: 240 VAMETKQGFELNGRALRINWASKREPQ 266
             ++T+    L+G+ +    A  RE Q
Sbjct: 178 EVVKTQH--ILDGKVIDPKRAIPREEQ 202

>ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {ON}
           similar to uniprot|Q75EC3 Ashbya gossypii AAR151W
           AAR151Wp and weakly similar to YBR212W uniprot|P32831
           Saccharomyces cerevisiae YBR212W NGR1 negative growth
           regulatory protein
          Length = 716

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 67/145 (46%), Gaps = 22/145 (15%)

Query: 139 YAFVEYFEPHDANVAYQTLNGKEVEGKV---------------LKINWA----FQSQQVN 179
           Y FVE+    DA     +LN   +   +                ++NWA     QS  + 
Sbjct: 160 YCFVEFETQQDAQFGL-SLNSTPLPNFISQSSGLATNPTGQRNFRLNWASGATLQSS-IP 217

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKE-FPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQA 238
           S   F+LFVGDL+    +A L   F++ F S     VM D  +G SR +GFV FG +++ 
Sbjct: 218 SRPEFSLFVGDLSPTATEADLLSLFQQKFKSVKTVRVMTDPITGASRCFGFVRFGNEEER 277

Query: 239 QVAMETKQGFELNGRALRINWASKR 263
           + A+    G    GR LR+ +A+ R
Sbjct: 278 RRALVEMNGVWCQGRCLRVAYATPR 302

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E+ L  L   FG I+  K    K C F+K++    A   I  + 
Sbjct: 418 PNNTTVFIGGLTPKINENQLQTLFSPFGNILTVKIPQGKNCGFVKFEKRIDAEAAIQGMQ 477

Query: 416 NFPFQGRNLRTGWGK 430
            F   G  +R  WG+
Sbjct: 478 GFVVGGCPIRLSWGR 492

 Score = 37.4 bits (85), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 5/79 (6%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  +++G L   I+++ L+  F   G+I +VKI      Q  N  FV++ +  DA  
Sbjct: 417 DPNNTTVFIGGLTPKINENQLQTLFSPFGNILTVKI-----PQGKNCGFVKFEKRIDAEA 471

Query: 153 AYQTLNGKEVEGKVLKINW 171
           A Q + G  V G  ++++W
Sbjct: 472 AIQGMQGFVVGGCPIRLSW 490

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +F+G L   +++  L   F  F + +   +       + +  GFV F ++  A+ A++  
Sbjct: 423 VFIGGLTPKINENQLQTLFSPFGNILTVKI------PQGKNCGFVKFEKRIDAEAAIQGM 476

Query: 246 QGFELNGRALRINW 259
           QGF + G  +R++W
Sbjct: 477 QGFVVGGCPIRLSW 490

>NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa]
           {ON} Anc_3.49
          Length = 506

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 80/172 (46%), Gaps = 10/172 (5%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDK---NSQECNYAFVEYFEPHDANVAYQ 155
           L++G L     +D LK YF   G++  +KI+ D     S+   +   E     D  V  Q
Sbjct: 195 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 254

Query: 156 TLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHV 215
            +    ++GKV+    A   ++   D+T  +FVG +  DV        F ++ + I A +
Sbjct: 255 HI----LDGKVIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQL 308

Query: 216 MWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQ 267
           M D  +GRSRG+GF+++   +      + K   +  G+ + I  A+ R  Q+
Sbjct: 309 MLDKDTGRSRGFGFITYDSSEAVDRVCQNKY-IDFKGKQIEIKRAAPRHMQK 359

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 2/87 (2%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           S E   LF+G LN +  +  L   F ++ + +   +M D  +GRSRG+GF++F       
Sbjct: 189 SKECCKLFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVD 248

Query: 240 VAMETKQGFELNGRALRINWASKREPQ 266
             ++T+    L+G+ +    A  RE Q
Sbjct: 249 EVVKTQHI--LDGKVIDPKRAIPREEQ 273

>CAGL0M12573g Chr13 (1247678..1248577) [900 bp, 299 aa] {ON} similar
           to uniprot|Q00916 Saccharomyces cerevisiae YIL061c SNP1
           U1 small nuclear ribonucleoprotein
          Length = 299

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 59/117 (50%), Gaps = 4/117 (3%)

Query: 140 AFVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDAT 199
           A + + E  DA       N +EVE ++L+ +    +   ++D    +FVG L  D D+  
Sbjct: 71  ATLRHLERMDAVAKRVRDNQREVEQQLLQWDPLSDNHMRDTDPYKTVFVGRLPYDTDEVQ 130

Query: 200 LAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAME---TKQGFELNGR 253
           L   F ++   ++  V+ D Q+ +SRGY FV F E D A+V        +G ++NGR
Sbjct: 131 LQKVFAKYGEIVRVRVVRDKQN-KSRGYAFVLFKETDSARVCTRDIGVHRGIQINGR 186

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K ++VG LP   D+  L++ F   G I  V+++ DK ++   YAFV + E   A V  + 
Sbjct: 115 KTVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSARVCTRD 174

Query: 157 L---NGKEVEGK 165
           +    G ++ G+
Sbjct: 175 IGVHRGIQINGR 186

>KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {ON}
           Anc_6.104 YBR212W
          Length = 620

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 105/262 (40%), Gaps = 69/262 (26%)

Query: 84  PVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKI--------IP----- 130
           P  AT    ++  + L++G+L  + D+  +K+ ++  G   S+K+        IP     
Sbjct: 24  PPFATVSTSDEPPRTLWMGDLDPTFDELTIKEIWKRLGKNVSIKLVRAKKNLLIPCSSFT 83

Query: 131 ------DKNSQE---------------------CNYAFVEYFEPHDANVAYQTLNGKEVE 163
                  KN  E                       Y F+E+    DA     +LN K + 
Sbjct: 84  NNSGGNSKNETEESSITINGISFIDPMTTQLHHAGYCFIEFDSLKDAQFGL-SLNSKPIP 142

Query: 164 G---------------KVLKINWA----FQSQQVNSDETFNLFVGDLNVDVDDATLAGTF 204
                           +  ++NWA     QS    + E ++LFVGDL+    +A L   F
Sbjct: 143 NFKSISTELETNPSGQRTFRLNWASGATLQSSIPTTPE-YSLFVGDLSPMTTEADLLKLF 201

Query: 205 -KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            K F S     VM D  +G SR +GF+   ++ + + A++   G  L+GR LR+  A+ R
Sbjct: 202 QKTFKSVKTVRVMTDPITGESRCFGFIRLSDEFEREEALDKMNGTLLHGRQLRVALANPR 261

Query: 264 E-------PQQSQQGQRRFNGP 278
                   P Q  + +++ N P
Sbjct: 262 NANLQEQAPSQVVEDKKKHNEP 283

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 5/79 (6%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  ++VGNL   I +D L++ F+  G+I  VKI P K   +C   FV++    DA  
Sbjct: 318 DPTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGK---KC--GFVKFCNKIDAEA 372

Query: 153 AYQTLNGKEVEGKVLKINW 171
           +   L G  V G  ++I+W
Sbjct: 373 SMYGLQGYFVAGSPIRISW 391

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 84/215 (39%), Gaps = 60/215 (27%)

Query: 99  LYVGNL-PKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQT 156
           L+VG+L P + + DLLK + +   S+ +V+++ D  + E   + F+   +  +   A   
Sbjct: 183 LFVGDLSPMTTEADLLKLFQKTFKSVKTVRVMTDPITGESRCFGFIRLSDEFEREEALDK 242

Query: 157 LNGKEVEGKVLKI------NWAFQSQ---------------------------------- 176
           +NG  + G+ L++      N   Q Q                                  
Sbjct: 243 MNGTLLHGRQLRVALANPRNANLQEQAPSQVVEDKKKHNEPLLLETAKKLFSKELLKNSS 302

Query: 177 ------QVNSDETFN------LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRS 224
                 + N D + N      +FVG+LN  + +  L   F+ F +  +  +         
Sbjct: 303 SNVNDVKSNEDHSDNDPTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKI------PPG 356

Query: 225 RGYGFVSFGEQDQAQVAMETKQGFELNGRALRINW 259
           +  GFV F  +  A+ +M   QG+ + G  +RI+W
Sbjct: 357 KKCGFVKFCNKIDAEASMYGLQGYFVAGSPIRISW 391

 Score = 37.4 bits (85), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT ++GN+     E +L  + + FG I   K  P K C F+K+     A   +  L 
Sbjct: 319 PTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGKKCGFVKFCNKIDAEASMYGLQ 378

Query: 416 NFPFQGRNLRTGW 428
            +   G  +R  W
Sbjct: 379 GYFVAGSPIRISW 391

>ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL123W (HRP1)
          Length = 526

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 89/184 (48%), Gaps = 10/184 (5%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           +++G L     +D L++YF   G+++ VKI+ D  + +   + F+ + +    +   +T 
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 224

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +   ++GKV+    +  + +    +   +FV  +  DV        F ++ S I A +M 
Sbjct: 225 H--ILDGKVIDPKESDPTGRAR--KAGKIFVAGIGPDVRPKEFEEFFSQWGSIIDAQLML 280

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFNG 277
           D  +GRSRG+GF+++   D      + K   E  G+ + I  A   EP+Q Q+ QR  N 
Sbjct: 281 DKDTGRSRGFGFITYDSPDAVDRVCQNKF-IEFKGKRIEIKRA---EPRQVQK-QRTTNA 335

Query: 278 PASG 281
             +G
Sbjct: 336 SPTG 339

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 3/76 (3%)

Query: 174 QSQQVNSD---ETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFV 230
           +++QV +D   +   +F+G LN +  +  L   F ++ +  +  +M D  +GRSRG+GF+
Sbjct: 150 EAKQVKADLSRDINKMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFL 209

Query: 231 SFGEQDQAQVAMETKQ 246
           SF +       ++T+ 
Sbjct: 210 SFADASSVDEVVKTQH 225

>AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR212W (NGR1)
          Length = 481

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 72/163 (44%), Gaps = 24/163 (14%)

Query: 123 ISSVKIIPDKNSQ--ECNYAFVEYFEPHDANVAYQTLNGKEVEGKV-------------- 166
           I+ V  I    +Q     Y FV++    +A    Q LN   +   V              
Sbjct: 82  INGVSFIDPNTTQLHHAGYCFVQFANLQEAQAGLQ-LNATPLPNVVSPTTRNPTNPTGKR 140

Query: 167 -LKINWA----FQSQQVNSDETFNLFVGDLNVDVDDATLAGTFK-EFPSFIQAHVMWDMQ 220
             ++NWA     QS  + +   F+LFVGDL+    +A L   F+ +F S     VM D  
Sbjct: 141 NFRLNWASGATLQSD-IPATPEFSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPI 199

Query: 221 SGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           +G SR +GFV F ++ + + A+    G    GR LR+ +A+ R
Sbjct: 200 TGASRCFGFVRFADEKERRRALAEMNGVWCQGRQLRVAYATPR 242

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%)

Query: 359 TTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNFP 418
           TT +IG + +   E  L  L   FG I+  K  P +GC F++++    A   I  +  F 
Sbjct: 326 TTVFIGGLSNMISEGQLHALFMPFGNILSVKVPPGRGCGFVRFENRMDAEAAIQGMQGFI 385

Query: 419 FQGRNLRTGWGK 430
             G  +R  WG+
Sbjct: 386 VGGNAIRLSWGR 397

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
            +F+G L+  + +  L   F  F + +   V         RG GFV F  +  A+ A++ 
Sbjct: 327 TVFIGGLSNMISEGQLHALFMPFGNILSVKV------PPGRGCGFVRFENRMDAEAAIQG 380

Query: 245 KQGFELNGRALRINW 259
            QGF + G A+R++W
Sbjct: 381 MQGFIVGGNAIRLSW 395

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + ++  +++G L   I +  L   F   G+I SVK+ P +        FV +    DA  
Sbjct: 322 DTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKVPPGRGC-----GFVRFENRMDAEA 376

Query: 153 AYQTLNGKEVEGKVLKINW 171
           A Q + G  V G  ++++W
Sbjct: 377 AIQGMQGFIVGGNAIRLSW 395

>Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii AAR151W
          Length = 586

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 75/164 (45%), Gaps = 26/164 (15%)

Query: 123 ISSVKIIPDKNSQECN---YAFVEYFEPHDANVAYQTLNGKEVEGKV------------- 166
           I+ V  I D N+ + +   Y FV++    +A    Q LN   +   +             
Sbjct: 83  INGVSFI-DPNTTQLHHAGYCFVQFPSLQEAQAGLQ-LNSTPLPNLISSTTHNPTNPTAK 140

Query: 167 --LKINWA----FQSQQVNSDETFNLFVGDLNVDVDDATLAGTFK-EFPSFIQAHVMWDM 219
              ++NWA     QS    + E F+LFVGDL+    +A L   F+ +F S     VM D 
Sbjct: 141 RNFRLNWASGATLQSDIPTTPE-FSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDP 199

Query: 220 QSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            +G SR +GFV F ++ + + A+    G    GR LR+ +A+ R
Sbjct: 200 ITGASRCFGFVRFADEQERRRALVEMNGIWCQGRQLRVAYATPR 243

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 34/75 (45%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG + +   E  L  L   FG I+  K  P KGC F+K++    A   I  + 
Sbjct: 395 PSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGKGCGFVKFEHRLDAEAAIQGMQ 454

Query: 416 NFPFQGRNLRTGWGK 430
            F      +R  WG+
Sbjct: 455 GFIVGNSAIRLSWGR 469

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
            +F+G LN  + ++ L   F  F + +   V         +G GFV F  +  A+ A++ 
Sbjct: 399 TVFIGGLNNQITESQLQSLFMPFGNILSVKV------PPGKGCGFVKFEHRLDAEAAIQG 452

Query: 245 KQGFELNGRALRINW 259
            QGF +   A+R++W
Sbjct: 453 MQGFIVGNSAIRLSW 467

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query: 90  GGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHD 149
           G  + S+  +++G L   I +  L+  F   G+I SVK+ P K    C   FV++    D
Sbjct: 391 GYTDPSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGKG---C--GFVKFEHRLD 445

Query: 150 ANVAYQTLNGKEVEGKVLKINW 171
           A  A Q + G  V    ++++W
Sbjct: 446 AEAAIQGMQGFIVGNSAIRLSW 467

>ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR319W (HSH49)
          Length = 204

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 80/169 (47%), Gaps = 7/169 (4%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQTL 157
           +YVGNL   +  +LL + F     +S ++   DK  QE   +AFVE F   D + A ++L
Sbjct: 9   VYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCDFAIKSL 68

Query: 158 NGK-EVEGKVLKINWAFQSQQVNSDETF---NLFVGDLNVDVDDATLAGTFKEFPSFIQA 213
           N    + GKVLK+    ++ + NS   F    LFV +L+  +D   L   F +F    + 
Sbjct: 69  NNTVSLFGKVLKVRRTLENAK-NSAPVFARAKLFVKNLDSTIDAVQLQKLFGKFGPLAKP 127

Query: 214 HVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
             ++ ++ G  R   +V F     +  A+E      +  + + I++A K
Sbjct: 128 PQLFTLKDGALRC-AYVYFTTFRHSDEALEKLNNQIVANQIISIDYAFK 175

>TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON}
           Anc_1.357 YHR015W
          Length = 665

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 41/70 (58%)

Query: 174 QSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFG 233
           ++  +N   +F LF+G LN  V    L   FK+FPSFI A V  DM++ +S GYG+++F 
Sbjct: 84  RNNSLNDKNSFALFIGGLNQRVTKEMLKEEFKDFPSFISAKVCVDMKTKKSLGYGYLNFS 143

Query: 234 EQDQAQVAME 243
            Q+     +E
Sbjct: 144 NQNDILRLVE 153

>AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR023W
           (PES4) and YHR015W (MIP6)
          Length = 678

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 51/92 (55%)

Query: 166 VLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSR 225
           ++K+  +  S  + S +   LF+GDL+  V +  L  TF +F SF+ A +  D  + +S 
Sbjct: 98  IVKLGRSKDSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSL 157

Query: 226 GYGFVSFGEQDQAQVAMETKQGFELNGRALRI 257
           GYG+++F  ++ A+  +E      + GR +RI
Sbjct: 158 GYGYLNFSNEEDAERVIEEFNYIPIFGREVRI 189

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/180 (20%), Positives = 76/180 (42%), Gaps = 10/180 (5%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE-CNYAFVEYFEPHDANVAYQTL 157
           L++G+L + + +  L+  F    S  S KI  D N+++   Y ++ +    DA    +  
Sbjct: 118 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 177

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDL---NVDVDDATLAGTFKEFPSFIQAH 214
           N   + G+ ++I  + ++     +   N+F  +L   N+ +        FK+F   +   
Sbjct: 178 NYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPLENLALTTRVFYDAFKKFGKILSCK 237

Query: 215 VMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRR 274
           +       R +  GFV F +   A+ A+    G E  G  +       R  ++S + ++R
Sbjct: 238 L------DRRKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNILCGIHFDRNVRKSPEFEKR 291

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +++ NLP + D DLL  YF   G + S+    + +     +AF+ + +  DA  A   LN
Sbjct: 327 VFIKNLPLNPDSDLLLDYFSQIGPVKSI-FTSNVSKLSSAWAFITFQKGSDAQDAIDNLN 385

Query: 159 GKEVEGKVLKINWAFQSQQVNSD 181
             ++ G+ ++++ A ++ Q + D
Sbjct: 386 HSQLLGRPIELSRAQKNFQTDID 408

>KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some
           similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 540

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 74/158 (46%), Gaps = 24/158 (15%)

Query: 128 IIPDK-NSQECNYAFVEYFEPHDANVAYQTLNGKEV---------------EGK-VLKIN 170
           I P+K N     Y FVE+    DA  A  TLN   +               +GK   ++N
Sbjct: 84  IDPNKTNLHHAGYCFVEFESFEDAQQAL-TLNATPIPNISCNTTASKRTNDDGKRKFRLN 142

Query: 171 WA----FQSQQVNSDETFNLFVGDLNVDVDDATLAGTFK-EFPSFIQAHVMWDMQSGRSR 225
           WA      S  + + E F+LFVGDL+    +A L   F+ ++ S     VM D  +G SR
Sbjct: 143 WANGATLHSTILPTPE-FSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASR 201

Query: 226 GYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
            +GFV F  + + + A+    G +  GR LR+ +A+ R
Sbjct: 202 CFGFVRFANETERRNALIEMNGVQFQGRQLRVAYATPR 239

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 34/72 (47%)

Query: 359 TTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNFP 418
           TT ++G +     E  L  L + FG I D K  P K C F+KY+   +A   I  L  F 
Sbjct: 445 TTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEAAINGLQGFI 504

Query: 419 FQGRNLRTGWGK 430
             G  +R  WG+
Sbjct: 505 IMGSPIRLSWGR 516

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 41/74 (55%), Gaps = 6/74 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +FVG LN ++++  L   FK F +      + D++    +  GFV + E+ +A+ A+   
Sbjct: 447 VFVGGLNPNINELQLFELFKPFGT------ITDVKIPPGKQCGFVKYNERLEAEAAINGL 500

Query: 246 QGFELNGRALRINW 259
           QGF + G  +R++W
Sbjct: 501 QGFIIMGSPIRLSW 514

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 95  SDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAY 154
           S   ++VG L  +I++  L + F+  G+I+ VKI P K   +C   FV+Y E  +A  A 
Sbjct: 443 SSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGK---QC--GFVKYNERLEAEAAI 497

Query: 155 QTLNGKEVEGKVLKINW 171
             L G  + G  ++++W
Sbjct: 498 NGLQGFIIMGSPIRLSW 514

>Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar to
           Ashbya gossypii AEL016C
          Length = 681

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 51/92 (55%)

Query: 166 VLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSR 225
           ++K+  +  S  + S +   LF+GDL+  V +  L  TF +F SF+ A +  D  + +S 
Sbjct: 102 IVKLGRSKDSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSL 161

Query: 226 GYGFVSFGEQDQAQVAMETKQGFELNGRALRI 257
           GYG+++F  ++ A+  +E      + GR +RI
Sbjct: 162 GYGYLNFSNEEDAERVIEEFNYIPIFGREVRI 193

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 46/83 (55%), Gaps = 10/83 (12%)

Query: 99  LYVGNLPKSIDDDLLKQYF-QIGGSISSVKIIPDKNSQECN--YAFVEYFEPHDANVAYQ 155
           +++ NLP + D DLL  YF QIG     VK I   N  + N  +AF+ + +  DA  A  
Sbjct: 331 VFIKNLPLNSDSDLLLDYFSQIG----PVKSIFTSNVSKLNSAWAFITFKKGSDAQDAID 386

Query: 156 TLNGKEVEGKVLKINWA---FQS 175
           +LN  ++ G+ ++++ A   FQS
Sbjct: 387 SLNHSQLLGRTIELSRAQKNFQS 409

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 79/178 (44%), Gaps = 6/178 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE-CNYAFVEYFEPHDANVAYQTL 157
           L++G+L + + +  L+  F    S  S KI  D N+++   Y ++ +    DA    +  
Sbjct: 122 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 181

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEF-PSFIQAHVM 216
           N   + G+ ++I  + ++     +   N+F  +L ++     LA T + F  +F +   +
Sbjct: 182 NYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPLE----NLALTTRVFYDAFKKYGKI 237

Query: 217 WDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRR 274
              +  R +  GFV F +   A+ A+    G +  G  +       R  ++S + ++R
Sbjct: 238 LSCKLDRRKNIGFVYFEKDSSAKQAIAEYNGKQFYGNNILCGIHFDRNVRKSPEFEKR 295

>SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 672

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 49/92 (53%)

Query: 166 VLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSR 225
           ++K++    S  ++S     LF+GDL+  V +  L  TF ++PS +   +  D  S RS 
Sbjct: 84  IVKLDKLKDSLYLSSKRLVALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSL 143

Query: 226 GYGFVSFGEQDQAQVAMETKQGFELNGRALRI 257
           GYG+++F   + A+ A E      L G+ +RI
Sbjct: 144 GYGYINFSNDEDAEKATEEFNYVPLFGKEVRI 175

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 81/180 (45%), Gaps = 10/180 (5%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE-CNYAFVEYFEPHDANVAYQTL 157
           L++G+L + + + +L+  F    S+ SVKI  D  S+    Y ++ +    DA  A +  
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDL---NVDVDDATLAGTFKEFPSFIQAH 214
           N   + GK ++I  + ++     +   N+F  +L   N+ +       TFK++   +   
Sbjct: 164 NYVPLFGKEVRIMPSLRNSFYRKNIGTNVFFSNLPLENLSLTTRAFYDTFKKYGKILSCK 223

Query: 215 VMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRR 274
           +       R +  GF+ F +   A+ A++   G E  G  +       RE ++S + ++R
Sbjct: 224 L------DRRKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDREVRKSPEFEKR 277

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 42/76 (55%), Gaps = 5/76 (6%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSV--KIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           ++V NLP + ++D +  +F   G + SV    +P  NS   ++AFV Y +  D + A + 
Sbjct: 314 IFVKNLPVNANEDDILDFFSRIGPVKSVFTSKVPKYNS---SWAFVTYKKGSDTSEAIEK 370

Query: 157 LNGKEVEGKVLKINWA 172
           LNG+  + + +++  A
Sbjct: 371 LNGEIFKHRKIEVARA 386

>Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON}
           (325215..327119) [1905 nt, 635 aa]
          Length = 634

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 90/186 (48%), Gaps = 17/186 (9%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE-CNYAFVEYFEPHDANVAYQTL 157
           LY+G+L K + +D+LK +F +  S+ SVKI  D +S E   Y ++      +A+   +  
Sbjct: 101 LYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEEADDLMERF 160

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAH-VM 216
           N   + GKV++I  + ++ Q   +   N+F  DL +     T     ++F +F +A+  +
Sbjct: 161 NYTPIFGKVVRIMPSLRNSQTRKNMGTNVFFSDLPLSEKSITT----RDFYNFFKAYGNI 216

Query: 217 WDMQSGRSRGYGFVSFGEQDQAQVAM------ETKQGFELN-----GRALRINWASKREP 265
              +   S+  GF+ F  +  A+  +      E   G+++N      +++R N  ++++ 
Sbjct: 217 LSCKLNTSKNIGFIFFENESSAKEVISKFNANELLYGYKINCGVHIDKSIRKNLGTEKQK 276

Query: 266 QQSQQG 271
             S + 
Sbjct: 277 SASSES 282

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 45/98 (45%)

Query: 178 VNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQ 237
           + S ++  L++GDL   V +  L   F  + S +   +  D  SG S GYG+++   +++
Sbjct: 93  IESKQSIALYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEE 152

Query: 238 AQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRF 275
           A   ME      + G+ +RI  + +    +   G   F
Sbjct: 153 ADDLMERFNYTPIFGKVVRIMPSLRNSQTRKNMGTNVF 190

>TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON}
           Anc_7.159 YIR005W
          Length = 167

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 72/139 (51%), Gaps = 12/139 (8%)

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQ 212
           A Q +N  E+   +L  N ++ ++    D  + +F+G LNV++ +A +   F ++   + 
Sbjct: 6   AIQRINDTELSSGILSPNLSWHNEY--KDRAY-IFIGGLNVELTEADILTIFSQYGIPVD 62

Query: 213 AHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRIN--WASKR------- 263
             ++ D ++G S+G+G++ + +Q  A +A++   G ++ GR ++++  W + R       
Sbjct: 63  VFLVRDRETGDSKGFGYLKYEDQRSAVLAIDNLNGSKIAGRIIKVDHAWYTPRDDMIEYQ 122

Query: 264 EPQQSQQGQRRFNGPASGR 282
           E  Q +  + R + P   R
Sbjct: 123 EAVQRELSKDRIDIPKELR 141

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 45/79 (56%), Gaps = 3/79 (3%)

Query: 99  LYVGNLPKSIDD-DLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQT 156
           +++G L   + + D+L  + Q G  +  V ++ D+ + +   + +++Y +   A +A   
Sbjct: 36  IFIGGLNVELTEADILTIFSQYGIPVD-VFLVRDRETGDSKGFGYLKYEDQRSAVLAIDN 94

Query: 157 LNGKEVEGKVLKINWAFQS 175
           LNG ++ G+++K++ A+ +
Sbjct: 95  LNGSKIAGRIIKVDHAWYT 113

>Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON}
           (47628..49610) [1983 nt, 661 aa]
          Length = 660

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 44/72 (61%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LF+G+L++DV++  L   FK+FPS +   +  +  +  S GYG+++FG+++ A+ A E  
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 246 QGFELNGRALRI 257
               L G  ++I
Sbjct: 140 NYINLFGNEVKI 151

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 70/149 (46%), Gaps = 10/149 (6%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE-CNYAFVEYFEPHDANVAYQTL 157
           L++GNL   ++++ LKQ F+   S+ SVKI  +  ++E   Y ++ + +  DA  A +  
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDAT---LAGTFKEFPSFIQAH 214
           N   + G  +KI  + ++     +   NLF  +L +D  + T      TFK++   +   
Sbjct: 140 NYINLFGNEVKIMPSLRNSFYRKNIGTNLFFCNLPLDNKELTTRRFYDTFKKYGKILSCK 199

Query: 215 VMWDMQSGRSRGYGFVSFGEQDQAQVAME 243
           +       + +  GFV F     A+  ++
Sbjct: 200 L------DKRKNIGFVYFDNDKSAKEVIK 222

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSV--KIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           ++V NLP +  D+ +  YF + G I SV    +P  NS    ++ + Y +  D+  A QT
Sbjct: 334 VFVKNLPINTTDEEILDYFSVAGPIKSVFSSKVPKFNSL---WSIITYKKSSDSIKAIQT 390

Query: 157 LNGKEVEGKVLKINWA 172
            + K  + KV+ +  A
Sbjct: 391 YDNKTFKEKVISVTKA 406

>KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 82/180 (45%), Gaps = 8/180 (4%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQTL 157
           +YVGN+   +  +LL + F   G ++ ++   DK  Q    +AFVE+  P DA  A + L
Sbjct: 12  VYVGNVDPKVSKELLYELFLQIGPVAKIRYPKDKVLQTHQGFAFVEFNSPQDAEYASKCL 71

Query: 158 NGK----EVEGKVLKINWAFQS--QQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFI 211
           N      +   KV K N A  S   Q   D    LF+ +++  VD   L   F +F S +
Sbjct: 72  NNTVRLYDRTLKVRKANGASSSPTSQNALDVGAKLFIKNIDELVDSEMLTKIFGKFGSLV 131

Query: 212 QAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQG 271
           +   ++ ++ G  R   ++ +   + +  A+E      +  + + I++A K   +  + G
Sbjct: 132 RPPEIFTLKQGLLRC-AYICYSTFEHSDAALEKLNNQMVMNKCISIDYAYKEGSKTEKHG 190

>TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.104
           YBR212W
          Length = 608

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 68/145 (46%), Gaps = 22/145 (15%)

Query: 139 YAFVEYFEPHDANVAYQTLNGKEVEG---------------KVLKINWA----FQSQQVN 179
           Y FVE+    D  +A  +LN   +                 +  ++NWA     QS  + 
Sbjct: 121 YCFVEFESQQDV-IAALSLNKAVIPNIFSESINLYTNPNGRRTFRLNWASGATLQSL-IP 178

Query: 180 SDETFNLFVGDLNVDVDDATLAGTF-KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQA 238
           +   ++LF+GDL+    +A +   F K++ S     VM D  +G SRG+GF+ F ++D+ 
Sbjct: 179 ATPEYSLFIGDLSPLTTEADILSIFQKKYKSVKTVRVMTDPINGSSRGFGFIRFSDEDER 238

Query: 239 QVAMETKQGFELNGRALRINWASKR 263
           + A+E   G   + R  R+  A+ R
Sbjct: 239 KDALENMNGVMCHSRYFRLALATPR 263

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%)

Query: 359 TTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNFP 418
           TT +IG +     E++L  L + FG I+  K    K C F+K+    +A   I  +  F 
Sbjct: 342 TTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPIGKNCGFVKFKRKIEANAAIKGMQGFI 401

Query: 419 FQGRNLRTGWGK 430
             G  +R  WGK
Sbjct: 402 INGNPIRLSWGK 413

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 45/98 (45%), Gaps = 8/98 (8%)

Query: 179 NSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQA 238
           NS+ T  +F+G L+   ++  L   F+ F + +   +         +  GFV F  + +A
Sbjct: 339 NSNTT--VFIGGLSTSTNEYELQVLFEPFGNILSVKIPI------GKNCGFVKFKRKIEA 390

Query: 239 QVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFN 276
             A++  QGF +NG  +R++W        ++   +  N
Sbjct: 391 NAAIKGMQGFIINGNPIRLSWGKSNNNASTKLNHKHIN 428

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 43/79 (54%), Gaps = 5/79 (6%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           + S+  +++G L  S ++  L+  F+  G+I SVKI   KN   C   FV++    +AN 
Sbjct: 338 DNSNTTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPIGKN---C--GFVKFKRKIEANA 392

Query: 153 AYQTLNGKEVEGKVLKINW 171
           A + + G  + G  ++++W
Sbjct: 393 AIKGMQGFIINGNPIRLSW 411

>NCAS0E03880 Chr5 complement(761175..763328) [2154 bp, 717 aa] {ON}
           Anc_5.76 YGR250C
          Length = 717

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 84/202 (41%), Gaps = 40/202 (19%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDK----------NSQECNYAFVEYFEPH 148
           +++G +   ID+  ++  F+  GSI S+K+  D+          +S    Y F+ +    
Sbjct: 183 IFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLGS 242

Query: 149 DANVAYQTLNGKEVEGKVLKINWAFQSQQV-----------NSDETFN-LFVGDLNVDVD 196
            A+      NGK +EG  L +N+  + ++            N DE F  +F+G+L   + 
Sbjct: 243 QASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFKCIFIGNLPTTLT 302

Query: 197 DATLAGTFKE------------------FPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQA 238
           D T+     +                  FP     +   + +S   +GYGFV+ G  +QA
Sbjct: 303 DLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINNKSSPLKGYGFVNLGSHEQA 362

Query: 239 QVAMETKQGFELNGRALRINWA 260
              ++T  G E  G  L +N A
Sbjct: 363 LKVIQTLDGLEWKGNRLVVNKA 384

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 9/95 (9%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWD---------MQSGRSRGYGFVSFGEQ 235
           N+F+G +N  +D++ +   F++F S +   +  D           S    GYGF+SF   
Sbjct: 182 NIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLG 241

Query: 236 DQAQVAMETKQGFELNGRALRINWASKREPQQSQQ 270
            QA   +    G  + G  L +N+  +R+ ++  Q
Sbjct: 242 SQASECINEFNGKIIEGTKLFLNYHVERKERERIQ 276

>SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {ON}
           similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 88/197 (44%), Gaps = 15/197 (7%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKN-SQECNYAFVEYFEPHDANVAYQTL 157
           LY+GN+  ++  DLL + F     IS ++   DK       YAF+E+F   DA+   + +
Sbjct: 12  LYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVKVM 71

Query: 158 NGK-EVEGKVLKI-----NWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFI 211
           N   ++  + LK+     N A      + +    LFV +L+  VD A LA  F +F  F 
Sbjct: 72  NNTVQLYNRTLKVRRANSNTAASQPSKHVEIGAKLFVKNLDDLVDVAALAKIFGKFGPFS 131

Query: 212 -QAHVMWDMQSGRSRGY-GFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ 269
            Q  +    Q+     Y  + +F + DQA   +  +  F    R++ +++A K E    +
Sbjct: 132 KQPEIFHVKQADYKCAYIYYTTFDDSDQALAKLNNQIVF---NRSISVDYAFKDEKGNEK 188

Query: 270 QG---QRRFNGPASGRG 283
            G   +R  +  A   G
Sbjct: 189 HGDEVERLLDKEAKKHG 205

>NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON}
           Anc_1.357
          Length = 464

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 57/108 (52%), Gaps = 11/108 (10%)

Query: 150 ANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPS 209
            N+  QT N    EGK +KI        + S ETF+LF+GDL+  V    L   F ++PS
Sbjct: 28  VNLYGQTTN---YEGKKIKI--------LESGETFSLFIGDLHPKVTQEILENIFGKYPS 76

Query: 210 FIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRI 257
           F+ A V +D ++  S G+G+++F  +  ++ A++      L    +R+
Sbjct: 77  FLSAKVCYDFKTKVSLGHGYLNFSSERDSKQAIDDFNCTRLFDSVIRL 124

>YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A)
           binding protein, suppressor of DNA polymerase epsilon
           mutation, similar to Mip6p
          Length = 611

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 50/72 (69%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LF+GDL+  V + TL G FK++PSF+ A V  D  + +S G+G+++F ++++A+ AME  
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 246 QGFELNGRALRI 257
              ++NG+ +RI
Sbjct: 153 NYTKVNGKEIRI 164

>AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL043W (NOP4)
          Length = 729

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 57/103 (55%), Gaps = 10/103 (9%)

Query: 175 SQQVNSDETFN------LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYG 228
           S+QVN D + N      LFV ++  D  DA L   F +F     A ++ D  +G SRG+G
Sbjct: 2   SKQVN-DTSKNGLDLKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKD-NAGSSRGFG 59

Query: 229 FVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQG 271
           FVSF  +   Q A++  +  +  GR LR++ A +RE  +S++G
Sbjct: 60  FVSFAVESDTQAALDKGRKTQFKGRLLRVDVAKRRE--RSKKG 100

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/192 (19%), Positives = 72/192 (37%), Gaps = 29/192 (15%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V N+P    D  L  +F     I    I+ D       + FV +    D   A   
Sbjct: 16  KTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDK 75

Query: 157 LNGKEVEGKVLKINWAFQSQQVNS----------------------DETF-----NLFVG 189
               + +G++L+++ A + ++                         DE        L + 
Sbjct: 76  GRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLIIR 135

Query: 190 DLNVDVDDAT-LAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGF 248
           ++     D T L   F  F    +A +      G+  G+ FV+  +    + A+E  +G 
Sbjct: 136 NMPWSCRDPTKLKKIFGRFGVVAEASIPRKA-DGKLCGFAFVTMKKLSNCRKAIEECKGL 194

Query: 249 ELNGRALRINWA 260
           +++GR + +++A
Sbjct: 195 KIDGREVAVDFA 206

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 99  LYVGNLPKSIDDDL-LKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           L + N+P S  D   LK+ F   G ++   I    + + C +AFV   +  +   A +  
Sbjct: 132 LIIRNMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEEC 191

Query: 158 NGKEVEGKVLKINWAFQSQQ 177
            G +++G+ + +++A Q  +
Sbjct: 192 KGLKIDGREVAVDFAVQKSK 211

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%)

Query: 179 NSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQ 235
           N  E F++FV ++  D    TL   F +F     A  + D ++G  +G  FV+F ++
Sbjct: 283 NRRENFSVFVRNVPYDATQETLEAHFSKFGPVKYALPVQDKETGLPKGTAFVAFKDE 339

>KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 203

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 82/175 (46%), Gaps = 6/175 (3%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDK----NSQECNYAFVEYFEPHDANVAY 154
           +YVGNL   ++  LL + F   G IS +K   +K    +SQ   YAF+++       V  
Sbjct: 5   VYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVNDDVDYVCK 64

Query: 155 QTLNGKEVEGKVLKINWA-FQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQA 213
              N   + GK LK+  +  Q +  + D    LFV +L+  +D   L+  FK F   ++ 
Sbjct: 65  LFDNRVSLYGKPLKVRRSNKQPETTDFDVGAKLFVKNLDESIDVPQLSNIFKIFGKLLRK 124

Query: 214 HVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQS 268
             ++ +Q+G  R   +V F     +  A++      L  + + I++A K + Q++
Sbjct: 125 PEVFYLQNGTLRC-AYVWFTTFKHSDEALQQLNETNLANKLIYIDYAYKDDMQKT 178

>AEL217W Chr5 (225217..227721) [2505 bp, 834 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR250C
          Length = 834

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 85/216 (39%), Gaps = 56/216 (25%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE-CNYAFVEYFEPHDANVAYQTL 157
           LY+  +PK +  D L   F   G++ S+KII D N++E   Y F+ Y     A    + L
Sbjct: 219 LYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKEL 278

Query: 158 NGKEVEGKVLKINWAFQSQQV-----------NSDETFN-LFVGDLNVDVDDATLAGTFK 205
           NG  + G  L IN+  + ++            N DE F  +FVG+L  + +D TL    +
Sbjct: 279 NGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDERFRGVFVGNLPTEYEDGTLITPEQ 338

Query: 206 EFPSFIQAHVM---------------------------------------WDMQSGRS-- 224
            F  F   H++                                        D Q+  S  
Sbjct: 339 VFNKF--NHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCDSQNEDSPL 396

Query: 225 RGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
           +GYGF+ F   D A  A++    F   G +L +N A
Sbjct: 397 KGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVVNKA 432

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           NL++  +  D+    L   F +F + +   ++ D  +  S GYGF+S+    QA   ++ 
Sbjct: 218 NLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKE 277

Query: 245 KQGFELNGRALRINWASKRE 264
             G  +NG  L IN+  +R+
Sbjct: 278 LNGNLMNGSPLFINYHVERK 297

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 29/77 (37%), Gaps = 6/77 (7%)

Query: 362 YIGNIPHFAQEHDLIPLLQNFG------FIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           YI  IP      DLIP+   FG       IID       G  FI Y    QAA CI  L 
Sbjct: 220 YIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKELN 279

Query: 416 NFPFQGRNLRTGWGKEK 432
                G  L   +  E+
Sbjct: 280 GNLMNGSPLFINYHVER 296

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 39/95 (41%), Gaps = 16/95 (16%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHV---------------MWDMQSGRSRGYGF 229
           NL+V  + +   D  L   + ++   I A +               + D+  G SRGYGF
Sbjct: 600 NLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRGYGF 659

Query: 230 VSFGEQDQAQVAMETKQGFEL-NGRALRINWASKR 263
           V F     A  AM     F++     L +++A KR
Sbjct: 660 VCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR 694

>Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043W
           (REAL)
          Length = 686

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 2/87 (2%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFV  +  DV D  LA  F  F     A V+ D+   RSRG+GFVSF  +D  + A+   
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDVNK-RSRGFGFVSFAVEDDTKEALAKA 86

Query: 246 QGFELNGRALRINWASKRE-PQQSQQG 271
           +  + NG +LR++ A +R+  ++S +G
Sbjct: 87  RKTKFNGHSLRVDVAKRRDRSKKSSEG 113

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 35/200 (17%), Positives = 76/200 (38%), Gaps = 37/200 (18%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V ++P+ + D+ L  +F     I    ++ D N +   + FV +    D   A   
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDVNKRSRGFGFVSFAVEDDTKEALAK 85

Query: 157 LNGKEVEGKVLKINWA--------------------FQSQQVNSDETF------------ 184
               +  G  L+++ A                    F+  +V   E              
Sbjct: 86  ARKTKFNGHSLRVDVAKRRDRSKKSSEGAEKSAPKSFEKTEVQKTENEDDDVDDEDSMLK 145

Query: 185 ---NLFVGDLNVDVDDAT-LAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQV 240
               L + ++     D T L   F  + + ++A +    + G+  G+ FV+  +    ++
Sbjct: 146 GKPKLIIRNMPWSCRDPTKLKKIFGRYGTVVEATIPRK-RDGKLCGFAFVTMKKISNCRI 204

Query: 241 AMETKQGFELNGRALRINWA 260
           A+E  +   ++GR + +++A
Sbjct: 205 ALEGTKDLTIDGRKVAVDFA 224

>SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} similar
           to uniprot|P38922 Saccharomyces cerevisiae YNL004W
          Length = 464

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 78/173 (45%), Gaps = 15/173 (8%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           ++VGNL      + LK+YF   G +    II  +         VE+    D + A +  +
Sbjct: 164 IFVGNLTYDCQPEDLKEYFSQIGEVVRADIITSRGHHR-GMGTVEFTNADDVDEAIRRFD 222

Query: 159 GKEVEGK---VLKINWAFQSQQVN----------SDETFNLFVGDLNVDVDDATLAGTFK 205
           G  +  +   V + N   +S +            S   + +F+ +L   V+   L   FK
Sbjct: 223 GSTLLDREIFVRQDNPPPESMRAPPRERRPRIQASAPGYEVFIANLPYSVNWQALKDMFK 282

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRIN 258
           E    ++A V  D + G SRGYG V +  +++ QVA+E   G+EL GR L ++
Sbjct: 283 ECGDVLRADVKLD-RDGYSRGYGVVYYKTKEEVQVAIERYNGYELEGRVLDVH 334

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 86  LATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYF 145
           +AT GG + S   ++V NLP S     L   F+  G ++  ++    N +    A VEY 
Sbjct: 377 MATGGGDQSS--TIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYD 434

Query: 146 EPHDANVAYQTLNGKEVEGKVLKINWA 172
            P DA V    LN     G+ L I++ 
Sbjct: 435 NPADAEVCISRLNSYNYGGRDLDISYV 461

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 359 TTAYIGNIPHFAQEHDLIPLLQNFGFI----IDFKHYPE-KGCCFIKYDTHEQAALCIVA 413
           +T ++ N+P    + DL  L +  G +    + F +  +  G   ++YD    A +CI  
Sbjct: 386 STIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEVCISR 445

Query: 414 LTNFPFQGRNLRTGW 428
           L ++ + GR+L   +
Sbjct: 446 LNSYNYGGRDLDISY 460

>NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.491
           YPL043W
          Length = 702

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 11/112 (9%)

Query: 170 NWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGF 229
           N A++ Q  N  +   LFV  + +DV D  LA  F  F     A V+ D+   +SRG+GF
Sbjct: 13  NAAYK-QNDNGLDMKTLFVRSIPMDVTDEELADYFSNFAPTKHAVVVKDVNK-KSRGFGF 70

Query: 230 VSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFNGPASG 281
           VSF  +D  + A++  +  +L G  LR++ A +R+         R N P  G
Sbjct: 71  VSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRD---------RSNKPGEG 113

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/197 (18%), Positives = 78/197 (39%), Gaps = 36/197 (18%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V ++P  + D+ L  YF          ++ D N +   + FV +    D   A + 
Sbjct: 26  KTLFVRSIPMDVTDEELADYFSNFAPTKHAVVVKDVNKKSRGFGFVSFAVEDDTKEALKQ 85

Query: 157 LNGKEVEGKVLKINWAFQSQQVN---------SDETFNLFVGDLNVDVDDATLAGTFKEF 207
               +++G +L+++ A +  + N              +    D N +VD+ +L    K  
Sbjct: 86  ARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTDTIARDENEEVDEESL---LKGK 142

Query: 208 PSFIQAHVMWDM------------------------QSGRSRGYGFVSFGEQDQAQVAME 243
           P  I  ++ W                          + G+  G+ FV+  +     +A+E
Sbjct: 143 PKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKLCGFAFVTMKKLSNCTIALE 202

Query: 244 TKQGFELNGRALRINWA 260
             +  +++GR++ +++A
Sbjct: 203 NTKDLKIDGRSVAVDFA 219

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 99  LYVGNLPKSIDD-DLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           L + N+P S  D + LK+ F   G++    I   ++ + C +AFV   +  +  +A +  
Sbjct: 145 LIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKLCGFAFVTMKKLSNCTIALENT 204

Query: 158 NGKEVEGKVLKINWAFQSQQ 177
              +++G+ + +++A Q  +
Sbjct: 205 KDLKIDGRSVAVDFAVQKNR 224

>KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 766

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 88/191 (46%), Gaps = 6/191 (3%)

Query: 89  QGGREKSDK--ILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE-CNYAFVEYF 145
           Q    KS+K   L++G+LP ++ +D+L   F    S +SVKI  D N+++   Y ++ + 
Sbjct: 128 QTNTMKSEKQTALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFG 187

Query: 146 EPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFK 205
           +P DA  A    N   + G+ +++  + ++     +   N+F  +L +D    T    + 
Sbjct: 188 DPKDAENAVDEYNYMPIFGREIRMMPSLRNTYFRKNIGTNVFFSNLPLDNTKLTTRVFYD 247

Query: 206 EFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREP 265
           EF  F +   +   +  R +  GF+ F     A+ A++   G E     +       R  
Sbjct: 248 EFKKFGK---ILSCKLDRRKNIGFIYFENDAAAKEAIKQYNGKEFFDSTIMCGVHFDRNV 304

Query: 266 QQSQQGQRRFN 276
           ++S + +++ N
Sbjct: 305 RKSPEFEQKIN 315

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           ++V NLP +   D L  +F   G + SV    D +  + ++AF+ Y    D   A + LN
Sbjct: 388 IFVKNLPINPSHDNLLNFFSKIGPVKSV-YTSDVSKFDSSWAFITYKRIQDTKTAIEKLN 446

Query: 159 GKEVEGKVLKI 169
           G +   + +++
Sbjct: 447 GCKYMKRTIEV 457

>KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {ON}
           Anc_1.357 YHR015W
          Length = 589

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LF+G+L+ DV +  L   F  +PSFI A V ++  +  S G+G+++FG ++ A+ A E  
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 246 QGFELNGRALRINWASKREP 265
              ++    +RI   S R+P
Sbjct: 151 NYSKVLNNEIRI-MPSMRDP 169

>Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043W
           (REAL)
          Length = 690

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 55/123 (44%), Gaps = 22/123 (17%)

Query: 142 VEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLA 201
           +E  E   +NV+ Q  NG +++                      LFV  +  DV D  LA
Sbjct: 5   IENIESSKSNVSKQNDNGLDMK---------------------TLFVRSIPQDVTDEQLA 43

Query: 202 GTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWAS 261
             F  F     A V+ D    RSRG+GFVSF  +D  + A+   +  + NG  LR++ A 
Sbjct: 44  DFFSNFAPIKHAVVVKDTNK-RSRGFGFVSFAVEDDTKEALAKARKTKFNGHTLRVDVAK 102

Query: 262 KRE 264
           +R+
Sbjct: 103 RRD 105

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/199 (17%), Positives = 78/199 (39%), Gaps = 36/199 (18%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V ++P+ + D+ L  +F     I    ++ D N +   + FV +    D   A   
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAK 85

Query: 157 LNGKEVEGKVLKINWAFQSQQVNSD---------ETF------------------NLFVG 189
               +  G  L+++ A +  + +           E+F                  +L  G
Sbjct: 86  ARKTKFNGHTLRVDVAKRRDRTSKSPEGAEKSTPESFEKISGQKNENDNDADDEDSLLKG 145

Query: 190 DLNVDV--------DDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVA 241
              + +        D   L   F  + + ++A +    + G+  G+ FV+  +    ++A
Sbjct: 146 KPKLIIRNMPWSCRDPTKLKKIFTRYGTVVEATIPR-KRDGKLCGFAFVTMKKISNCRIA 204

Query: 242 METKQGFELNGRALRINWA 260
           +E  +  +++GR + +++A
Sbjct: 205 LENTKDLKIDGRKVAVDFA 223

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 99  LYVGNLPKSIDDDL-LKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           L + N+P S  D   LK+ F   G++    I   ++ + C +AFV   +  +  +A +  
Sbjct: 149 LIIRNMPWSCRDPTKLKKIFTRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALENT 208

Query: 158 NGKEVEGKVLKINWAFQSQQ 177
              +++G+ + +++A Q  +
Sbjct: 209 KDLKIDGRKVAVDFAVQKNR 228

>ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON}
           similar to uniprot|P39684 Saccharomyces cerevisiae or to
           YHR015W uniprot|P38760 Saccharomyces cerevisiae
          Length = 654

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 42/80 (52%)

Query: 178 VNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQ 237
           + S  T  LF+GDL+  +D+  L   FK+F S     V  D ++G+S GYG+++F  +  
Sbjct: 97  IESQPTIALFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYLNFSRRQD 156

Query: 238 AQVAMETKQGFELNGRALRI 257
              A E      + G+ +RI
Sbjct: 157 TLAATEEFNYRPIFGKEVRI 176

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/180 (20%), Positives = 83/180 (46%), Gaps = 10/180 (5%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           L++G+L + ID+++L Q F+   S++SVK+  D  + +   Y ++ +    D   A +  
Sbjct: 105 LFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYLNFSRRQDTLAATEEF 164

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDL---NVDVDDATLAGTFKEFPSFIQAH 214
           N + + GK ++I  + ++     +   N+F  +L   N ++       TFK + + +   
Sbjct: 165 NYRPIFGKEVRIMPSLRNTFYRKNIGTNIFFSNLPLENSNLTTRVFYDTFKVYGNILSCK 224

Query: 215 VMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRR 274
           +       + +  GF+ F     A+V ++   G E  G  +       +E ++  + ++R
Sbjct: 225 L------DKRKNIGFIYFDNDHAARVVIKEFNGSEFFGNKILCGIHFDKELRKFPEFEKR 278

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           ++V NLP S  DD +  YF   G + SV      +  E ++AFV Y +  D N A +  +
Sbjct: 316 IFVKNLPPSCPDDEILDYFSNLGPVKSV-FSSTSHKYESSWAFVTYKKGSDTNKAVKIYH 374

Query: 159 GKEVEGKVLKI 169
           G + +G+ L +
Sbjct: 375 GAQFKGRKLSV 385

>TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {ON}
           Anc_1.357 YHR015W
          Length = 713

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           L++GDL  DV +  L   F  + SF+ A +  D ++G S GYG+++   +++A   +E  
Sbjct: 154 LYIGDLGKDVTEGMLNSIFNSYNSFVSAKICIDSKTGESLGYGYLNLSNREEAYSLLERY 213

Query: 246 QGFELNGRALRINWASKREPQQSQQG 271
               + GR +RI  + +    + Q G
Sbjct: 214 NYTNIFGREVRIMPSLRNSTMRKQIG 239

>YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}
           NOP4Nucleolar protein, essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis; constituent of 66S pre-ribosomal particles;
           contains four RNA recognition motifs (RRMs)
          Length = 685

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFV  +  DV D  LA  F  F     A V+ D    RSRG+GFVSF  +D  + A+   
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNK-RSRGFGFVSFAVEDDTKEALAKA 86

Query: 246 QGFELNGRALRINWASKRE 264
           +  + NG  LR++ A +R+
Sbjct: 87  RKTKFNGHILRVDIAKRRD 105

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 34/199 (17%), Positives = 77/199 (38%), Gaps = 36/199 (18%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V ++P+ + D+ L  +F     I    ++ D N +   + FV +    D   A   
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAK 85

Query: 157 LNGKEVEGKVLKINWAFQSQ---------QVNSDETFNLFVGDLNVDV------------ 195
               +  G +L+++ A +           + ++ E+     G  N D             
Sbjct: 86  ARKTKFNGHILRVDIAKRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSMLKG 145

Query: 196 --------------DDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVA 241
                         D   L   F  + + ++A +    + G+  G+ FV+  +    ++A
Sbjct: 146 KPKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPR-KRDGKLCGFAFVTMKKISNCRIA 204

Query: 242 METKQGFELNGRALRINWA 260
           +E  +  +++GR + +++A
Sbjct: 205 LENTKDLKIDGRKVAVDFA 223

>Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043W
           (REAL)
          Length = 680

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFV  +  DV D  LA  F  F     A V+ D    RSRG+GFVSF  +D  + A+   
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNK-RSRGFGFVSFAVEDDTKEALIKA 86

Query: 246 QGFELNGRALRINWASKRE-PQQSQQG 271
           +  + NG  LR++ A +R+  ++S +G
Sbjct: 87  RKTKFNGHTLRVDVAKRRDRSKKSSEG 113

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/199 (17%), Positives = 82/199 (41%), Gaps = 36/199 (18%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V ++P+ + D+ L  +F     I    ++ D N +   + FV +    D   A   
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALIK 85

Query: 157 LNGKEVEGKVLKINWAFQSQQ---------VNSDETFNLFVG-----DLNVDVDDATLAG 202
               +  G  L+++ A +  +         + + E+F   +G     + + D +D+ L G
Sbjct: 86  ARKTKFNGHTLRVDVAKRRDRSKKSSEGAPMKASESFEKTIGQKTENEHDADGEDSMLKG 145

Query: 203 ---------------------TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVA 241
                                 F  + + ++A +    + G+  G+ FV+  +    ++A
Sbjct: 146 KPKLIIRNMPWSCRDSTKLKDIFSRYGTVVEATIPR-KRDGKLCGFAFVTMKKISNCRIA 204

Query: 242 METKQGFELNGRALRINWA 260
           +E  +  +++GR + +++A
Sbjct: 205 LENSKDLKIDGRKVAVDFA 223

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/188 (20%), Positives = 72/188 (38%), Gaps = 51/188 (27%)

Query: 99  LYVGNLPKSIDDDL-LKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           L + N+P S  D   LK  F   G++    I   ++ + C +AFV   +  +  +A +  
Sbjct: 149 LIIRNMPWSCRDSTKLKDIFSRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALENS 208

Query: 158 NGKEVEGKVLKINWAFQS--------------------------------QQVNSD---- 181
              +++G+ + +++A Q                                 +QV  D    
Sbjct: 209 KDLKIDGRKVAVDFAVQKNRWEDYKKAQPEVKDESNNESQDEDEEVDDEDKQVEEDSDDD 268

Query: 182 --------------ETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGY 227
                         E F++FV ++  D  + +L   F +F S   A  + D  +G ++G 
Sbjct: 269 PKTEEPTRKVQNKKEEFSVFVRNVPYDATEESLVAHFSKFGSVKYALPVIDRSTGLAKGT 328

Query: 228 GFVSFGEQ 235
            FV+F +Q
Sbjct: 329 AFVAFKDQ 336

>Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C
           (NSR1) - nuclear localization sequence binding protein
           [contig 667] PARTIAL
          Length = 222

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/138 (19%), Positives = 69/138 (50%), Gaps = 13/138 (9%)

Query: 139 YAFVEYFEPHDANVAYQTLNGKEVEGKVLKINW-------------AFQSQQVNSDETFN 185
           Y +V++ +   A  A + ++GKE++G+ + ++              A Q     S  +  
Sbjct: 11  YGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPAGNPRNDRAKQYGDTPSQPSDT 70

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LF+G+L+ + +   +   F E+   +   +    ++ + +G+G+V +   + AQ A++  
Sbjct: 71  LFLGNLSFNTERDNVFEIFSEYGDVVSVRLPTHPETNQPKGFGYVQYSSVENAQKALDAL 130

Query: 246 QGFELNGRALRINWASKR 263
           QG  ++ R +R+++++ +
Sbjct: 131 QGHYIDNRPVRLDFSTPK 148

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 28/41 (68%)

Query: 223 RSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           RSRGYG+V F ++  A+ A++   G E++GR + ++ ++ +
Sbjct: 7   RSRGYGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSK 47

>KAFR0L00970 Chr12 (181689..182546) [858 bp, 285 aa] {ON} Anc_7.250
           YIL061C
          Length = 285

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 46/79 (58%), Gaps = 3/79 (3%)

Query: 179 NSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQA 238
           N+D    +F+G L  +V +  L   F +F    +  ++ D+++ + +GYGF+ F E + A
Sbjct: 101 NTDPYKTIFIGRLPYNVTEIELQKIFIKFGEIEKIRIVKDIKTDKPKGYGFILFNEANAA 160

Query: 239 QVAME---TKQGFELNGRA 254
           ++A+    T +G E+NGR+
Sbjct: 161 KMAVREIGTHRGIEINGRS 179

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 4/73 (5%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPD-KNSQECNYAFVEYFEPHDANVAYQ 155
           K +++G LP ++ +  L++ F   G I  ++I+ D K  +   Y F+ + E + A +A +
Sbjct: 106 KTIFIGRLPYNVTEIELQKIFIKFGEIEKIRIVKDIKTDKPKGYGFILFNEANAAKMAVR 165

Query: 156 ---TLNGKEVEGK 165
              T  G E+ G+
Sbjct: 166 EIGTHRGIEINGR 178

>KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.491
           YPL043W
          Length = 690

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 1/93 (1%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFV  +  DV D  L G F  F     A V+ D+   +SRG+GFVSF  ++  + A+   
Sbjct: 24  LFVRSIPFDVTDEELGGFFSNFAPTKHAVVVKDVNK-KSRGFGFVSFATEEDTKDALGKA 82

Query: 246 QGFELNGRALRINWASKREPQQSQQGQRRFNGP 278
           +  +LNG  LR++ A +R+  +    ++  + P
Sbjct: 83  RRSKLNGNVLRVDIAKRRDRNKKNGEEKAISLP 115

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/195 (18%), Positives = 80/195 (41%), Gaps = 31/195 (15%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V ++P  + D+ L  +F          ++ D N +   + FV +    D   A   
Sbjct: 22  KTLFVRSIPFDVTDEELGGFFSNFAPTKHAVVVKDVNKKSRGFGFVSFATEEDTKDALGK 81

Query: 157 LNGKEVEGKVLKINWAFQ---SQQVNSDETFNL---FVGDLNVD-VDDATLAGTFKEFPS 209
               ++ G VL+++ A +   +++   ++  +L    +GD  V+  DD      FK  P 
Sbjct: 82  ARRSKLNGNVLRVDIAKRRDRNKKNGEEKAISLPLDTIGDKEVEQSDDEEEDSQFKGKPK 141

Query: 210 FIQAHVMWDMQS------------------------GRSRGYGFVSFGEQDQAQVAMETK 245
            I  ++ W  +                         G+  G+ FV+  +    ++A+E  
Sbjct: 142 LIIRNMPWSCRDPNKLKKIFGRFGNVVEASIPRKRDGKLCGFAFVTMKKISNCRLALENT 201

Query: 246 QGFELNGRALRINWA 260
           +  +++GR + +++A
Sbjct: 202 KDLKIDGRNVAVDFA 216

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 99  LYVGNLPKSIDD-DLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           L + N+P S  D + LK+ F   G++    I   ++ + C +AFV   +  +  +A +  
Sbjct: 142 LIIRNMPWSCRDPNKLKKIFGRFGNVVEASIPRKRDGKLCGFAFVTMKKISNCRLALENT 201

Query: 158 NGKEVEGKVLKINWAFQSQQ 177
              +++G+ + +++A Q  +
Sbjct: 202 KDLKIDGRNVAVDFAVQKNR 221

>KLTH0C04268g Chr3 (367879..369231) [1353 bp, 450 aa] {ON} similar
           to uniprot|P49960 Saccharomyces cerevisiae YMR268C PRP24
           Splicing factor that reanneals U4 and U6 snRNPs during
           spliceosome recycling
          Length = 450

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 85/190 (44%), Gaps = 20/190 (10%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYF-QIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151
           E S   L+  N P + D   L Q F Q GG++ SV++   +      +A+++     +A+
Sbjct: 113 ELSKSTLWATNFPPTYDQGKLMQLFGQFGGTVLSVRLPSLRFDSRRRFAYIDMASKQEAS 172

Query: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNSD-----ETFNLFVGDLNVDVDDATLAGTFKE 206
           +A + L+G E+E   + +  +  S           E   + V +LN + ++A L+  F +
Sbjct: 173 LALEKLDGVEIENYKMIVKLSQPSNAAARTDKAVIERRQVLVRNLNYNTNEAALSAIFAK 232

Query: 207 FPSFIQAHV-------------MWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGR 253
           F    Q ++               + +   + G+ F++F +   A+ ++ +  G E++ R
Sbjct: 233 FGHVEQINLPRTRENKHGEIDTKGETKERLNEGFAFITFSDASCARSSL-SLNGTEIDNR 291

Query: 254 ALRINWASKR 263
            L +  A +R
Sbjct: 292 ILDVTLADRR 301

>Ecym_5574 Chr5 complement(1175694..1178309) [2616 bp, 871 aa] {ON}
           similar to Ashbya gossypii AEL217W
          Length = 871

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 89/236 (37%), Gaps = 54/236 (22%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE-CNYAFVEYFEPHDANVAYQTL 157
           LY+  +PK +  D +   F   G++ S+KII D  + E   Y F+ Y     A    + L
Sbjct: 253 LYIRGIPKDLTVDDVLPLFSKFGTVLSLKIIVDIGTGESLGYGFISYPLGSQAARCIKEL 312

Query: 158 NGKEVEGKVLKINWAFQSQQV-----------NSDETFN-LFVGDLNVDVDDATLAG--- 202
           NG  + G +L IN+  + ++            N DE F  +FVG+L  + +D TL     
Sbjct: 313 NGNLMNGSLLFINYHVERKERERIHLDHLKEDNDDERFRGVFVGNLPTEYEDGTLTTPEQ 372

Query: 203 TFKEFPSFIQAHVMW---------------------------------DMQSGRS--RGY 227
            FK+F   +    +                                  D Q+  S  +GY
Sbjct: 373 VFKKFKELLDPVEILSYYFPKRNSNTNIEYKDDYDYFHAASKENAETCDSQNEDSPLKGY 432

Query: 228 GFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRFNGPASGRG 283
           GF+ F + + A  A+ET          L +N A +        G  R   P S R 
Sbjct: 433 GFIKFSKHEMALKAIETLNNLNWLNHCLVVNKAVQNRSLYHNHGNYR---PPSNRA 485

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           NL++  +  D+    +   F +F + +   ++ D+ +G S GYGF+S+    QA   ++ 
Sbjct: 252 NLYIRGIPKDLTVDDVLPLFSKFGTVLSLKIIVDIGTGESLGYGFISYPLGSQAARCIKE 311

Query: 245 KQGFELNGRALRINWASKREPQQ 267
             G  +NG  L IN+  +R+ ++
Sbjct: 312 LNGNLMNGSLLFINYHVERKERE 334

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 29/77 (37%), Gaps = 6/77 (7%)

Query: 362 YIGNIPHFAQEHDLIPLLQNFG------FIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           YI  IP      D++PL   FG       I+D       G  FI Y    QAA CI  L 
Sbjct: 254 YIRGIPKDLTVDDVLPLFSKFGTVLSLKIIVDIGTGESLGYGFISYPLGSQAARCIKELN 313

Query: 416 NFPFQGRNLRTGWGKEK 432
                G  L   +  E+
Sbjct: 314 GNLMNGSLLFINYHVER 330

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 40/95 (42%), Gaps = 16/95 (16%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW---------------DMQSGRSRGYGF 229
           NL++  + +   D  L   + ++   I A ++                D+  G SRGYGF
Sbjct: 640 NLYIKHIPLSWRDRDLNEFYSQYGEIISAKIITVGGSKNGSGDKESLDDVPIGTSRGYGF 699

Query: 230 VSFGEQDQAQVAMETKQGFELN-GRALRINWASKR 263
           V F     A  AM     F+++    L +++A KR
Sbjct: 700 VCFKNPLDASRAMMATDRFQVDRNHVLYVSFAQKR 734

>KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]
           {ON} some similarities with uniprot|P37838 Saccharomyces
           cerevisiae YPL043W NOP4 Nucleolar protein essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis contains four RNA
           recognition motifs (RRMs)
          Length = 693

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 47/96 (48%), Gaps = 1/96 (1%)

Query: 175 SQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGE 234
           S   NS +   LFV  +  +  D  L   F E      A ++ D +   SRG+GFVSF  
Sbjct: 12  SSAKNSLDMKTLFVRSIPFEATDEELTNYFSELAPIKHAVIVKDNEKN-SRGFGFVSFAV 70

Query: 235 QDQAQVAMETKQGFELNGRALRINWASKREPQQSQQ 270
           +D  + A+E  +  +  GR LR++ A +RE  +  Q
Sbjct: 71  EDDTKDALEKARKTKFKGRLLRVDIAKRRERSKGDQ 106

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 35/189 (18%), Positives = 75/189 (39%), Gaps = 28/189 (14%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V ++P    D+ L  YF     I    I+ D       + FV +    D   A + 
Sbjct: 21  KTLFVRSIPFEATDEELTNYFSELAPIKHAVIVKDNEKNSRGFGFVSFAVEDDTKDALEK 80

Query: 157 LNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDL-NVDVDDATLAGTFKEFPSFIQAHV 215
               + +G++L+++ A + ++   D+  +       NV+  +  L G     P  I  ++
Sbjct: 81  ARKTKFKGRLLRVDIAKRRERSKGDQRSSSSSEQAGNVENKENELMGG---KPKLIIRNM 137

Query: 216 MWDMQS------------------------GRSRGYGFVSFGEQDQAQVAMETKQGFELN 251
            W ++                         G+  G+ FV+  +    + A+E  +  +++
Sbjct: 138 PWSVRKPEQLKQIFMRFGTVVEAKIPKKPDGKLCGFAFVTMKKLAACKKAIEDSKDLKID 197

Query: 252 GRALRINWA 260
           GR + +++A
Sbjct: 198 GRQVAVDFA 206

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 90  GGREKSDKILYVGNLPKSIDD-DLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPH 148
           GG+ K    L + N+P S+   + LKQ F   G++   KI    + + C +AFV   +  
Sbjct: 127 GGKPK----LIIRNMPWSVRKPEQLKQIFMRFGTVVEAKIPKKPDGKLCGFAFVTMKKLA 182

Query: 149 DANVAYQTLNGKEVEGKVLKINWAFQSQQ 177
               A +     +++G+ + +++A Q  +
Sbjct: 183 ACKKAIEDSKDLKIDGRQVAVDFAIQKNK 211

>Kwal_56.24709 s56 complement(1113983..1116469) [2487 bp, 828 aa]
           {ON} YGR250C - Hypothetical ORF [contig 160] FULL
          Length = 828

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 86/218 (39%), Gaps = 51/218 (23%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQEC-NYAFVEYFEPHDANVAYQTL 157
           LYV  +PK +  D L   F   G + S+KII D +S +   Y F+ Y     A+   + L
Sbjct: 243 LYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKEL 302

Query: 158 NGKEVEGKVLKINWAFQSQQV-----------NSDETFN-LFVGDLNVDVDDATLA---- 201
           NG  + G  L IN+  + ++            N D+ F  +F+G+L  +  D +L     
Sbjct: 303 NGNLMNGSALFINYHVERKERERIHWDHFKEDNDDDRFKGVFIGNLPTNHPDGSLVTPEH 362

Query: 202 --GTFK-------EFPSFIQAHVMWDMQSGRS-------------------------RGY 227
               F+       E P  I ++ +    S                            +GY
Sbjct: 363 VIAKFQDQLRSKGEQPVHIVSYYLPKRNSESDIEYRDDDDKTDDIETCISKHEESPLKGY 422

Query: 228 GFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREP 265
           GF+ F   DQA  A++    FE  G  L +N A + +P
Sbjct: 423 GFIKFVSHDQALTAIDLFNNFEWLGNKLVVNKAVQSKP 460

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           NL+V  +  D+    L   F +F   +   ++ D  SG S GYGF+S+    QA   ++ 
Sbjct: 242 NLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKE 301

Query: 245 KQGFELNGRALRINWASKREPQQ 267
             G  +NG AL IN+  +R+ ++
Sbjct: 302 LNGNLMNGSALFINYHVERKERE 324

>YIR005W Chr9 (364889..365335) [447 bp, 148 aa] {ON}  IST3Component
           of the U2 snRNP, required for the first catalytic step
           of splicing and for spliceosomal assembly; interacts
           with Rds3p and is required for Mer1p-activated splicing
          Length = 148

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 61/116 (52%), Gaps = 4/116 (3%)

Query: 155 QTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAH 214
           Q +N KE++  +L      QS      +   +++G+LN ++ +  +   F E+   +   
Sbjct: 5   QQINDKELQSGILS---PHQSWHNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVI 61

Query: 215 VMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQ 270
           +  D  +G S+G+ ++ + +Q    +A++   GF++ GRAL+I+    R P++S Q
Sbjct: 62  LSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYR-PKRSLQ 116

 Score = 35.8 bits (81), Expect = 0.089,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 51/103 (49%), Gaps = 1/103 (0%)

Query: 94  KSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANV 152
           K +  +Y+GNL + + +  +   F   G    V +  D+N+ E   +A+++Y +     +
Sbjct: 28  KDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTIL 87

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDV 195
           A   LNG ++ G+ LKI+  F   + +  + +     +L+ D+
Sbjct: 88  AVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYEAVKEELDRDI 130

>TBLA0A03300 Chr1 (785613..786701) [1089 bp, 362 aa] {ON} Anc_5.382
           YHR086W
          Length = 362

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 39/79 (49%)

Query: 356 PRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           P  TT +IG +     E++L  L Q FG I+  K    KGC F++Y+T + A L I  + 
Sbjct: 252 PTNTTVFIGGLSSLVTENELRSLFQPFGEIVYVKIPFGKGCGFVQYETRKAAELAIHKMK 311

Query: 416 NFPFQGRNLRTGWGKEKPT 434
               +   +R  WGK   T
Sbjct: 312 GVSIKNSKIRLSWGKAAKT 330

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/86 (18%), Positives = 39/86 (45%), Gaps = 6/86 (6%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
            +F+G L+  V +  L   F+ F   +   + +       +G GFV +  +  A++A+  
Sbjct: 256 TVFIGGLSSLVTENELRSLFQPFGEIVYVKIPF------GKGCGFVQYETRKAAELAIHK 309

Query: 245 KQGFELNGRALRINWASKREPQQSQQ 270
            +G  +    +R++W    +   +++
Sbjct: 310 MKGVSIKNSKIRLSWGKAAKTSNTRK 335

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 40/86 (46%), Gaps = 5/86 (5%)

Query: 95  SDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAY 154
           ++  +++G L   + ++ L+  FQ  G I  VKI   K        FV+Y     A +A 
Sbjct: 253 TNTTVFIGGLSSLVTENELRSLFQPFGEIVYVKIPFGKGC-----GFVQYETRKAAELAI 307

Query: 155 QTLNGKEVEGKVLKINWAFQSQQVNS 180
             + G  ++   ++++W   ++  N+
Sbjct: 308 HKMKGVSIKNSKIRLSWGKAAKTSNT 333

>CAGL0B04807g Chr2 (460721..461980) [1260 bp, 419 aa] {ON} similar
           to uniprot|P25555 Saccharomyces cerevisiae YCL011c GBP2
           or uniprot|P38922 Saccharomyces cerevisiae YNL004w HRB1
          Length = 419

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 78/179 (43%), Gaps = 19/179 (10%)

Query: 96  DKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQ 155
           D  +++GNL      + L  +F   G +    II  +         VE+  P   + A +
Sbjct: 118 DNSIFIGNLSFDATPEDLHDFFGQAGEVLRADIITSRGRHR-GMGTVEFTSPEGVDNAIR 176

Query: 156 TLNGKEVEGKVLKI-----------NWAFQSQQVNS------DETFNLFVGDLNVDVDDA 198
             NG E  G+ L +           +     ++ N          F +F+ +L   +   
Sbjct: 177 DFNGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYSMTWQ 236

Query: 199 TLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRI 257
           TL   F+E    I+A +  D ++G SRG+G V +G Q++   A+E   GF+++GR L++
Sbjct: 237 TLKDLFREAGDVIRADIELD-RNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRILQV 294

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 90  GGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHD 149
           GG E+S  ++Y  NLP +     L   F+  G +   ++  D++      A +EY    D
Sbjct: 335 GGGERS-TLIYCSNLPLTTATGDLYDLFETIGRVRHAELKFDESGAPTGIAVIEYENVED 393

Query: 150 ANVAYQTLNGKEVEGKVLKINWA 172
           A+   Q LN     G  L I++A
Sbjct: 394 ADFCIQRLNNYNYGGCDLDISYA 416

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 32/80 (40%), Gaps = 7/80 (8%)

Query: 357 RVTTAYIGNIPHFAQEHDLIPLLQNFGFI------IDFKHYPEKGCCFIKYDTHEQAALC 410
           R T  Y  N+P      DL  L +  G +       D    P  G   I+Y+  E A  C
Sbjct: 339 RSTLIYCSNLPLTTATGDLYDLFETIGRVRHAELKFDESGAP-TGIAVIEYENVEDADFC 397

Query: 411 IVALTNFPFQGRNLRTGWGK 430
           I  L N+ + G +L   + K
Sbjct: 398 IQRLNNYNYGGCDLDISYAK 417

>Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 49/72 (68%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LF+GDL+  V + TL   FK++PSF+ + V  D  + +S G+G+++F ++++A+ AME  
Sbjct: 93  LFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 246 QGFELNGRALRI 257
              ++NG+ +RI
Sbjct: 153 NYTKVNGKEIRI 164

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 30/158 (18%), Positives = 75/158 (47%), Gaps = 4/158 (2%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE-CNYAFVEYFEPHDANVAYQTL 157
           L++G+L +++ ++ LK+ F+   S  S K+  D  +++   + ++ + +  +A  A + L
Sbjct: 93  LFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           N  +V GK ++I  + ++     +   N+F  +L +   +  L  T   + +F +   + 
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPL---NNPLLTTRVFYDTFSRYGKIL 209

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRAL 255
             +    +  GFV F ++  A+  ++        G+ +
Sbjct: 210 SCKLDSRKDIGFVYFEDEKTARSVIKMYNNTNFFGKKI 247

>YGR250C Chr7 complement(991176..993521) [2346 bp, 781 aa] {ON}
           Putative RNA binding protein; localizes to stress
           granules induced by glucose deprivation; interacts with
           Rbg1p in a two-hybrid
          Length = 781

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 94/234 (40%), Gaps = 58/234 (24%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQTL 157
           ++VG + KS+    L   F   G I S+K+I DK   E N Y F+ Y     A++  + L
Sbjct: 197 IFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKEL 256

Query: 158 NGKEVEGKVLKINWAFQSQQV-----------NSDETFN-LFVGDLNV------------ 193
           NG+ V G  L IN+  + ++            N+D+ F  LF+G+L              
Sbjct: 257 NGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPEKVETLITP 316

Query: 194 -DVDDATLAGTFKEFPSF--------------------------IQAHVMWDMQSGRS-- 224
            +V +       K+FP F                          ++++   +  +G +  
Sbjct: 317 KEVIEVIKKELSKKFPDFDIISYYFPKRSNTRSSSSVSFNEEGSVESNKSSNNTNGNAQD 376

Query: 225 ----RGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRR 274
               +GYGF+     +QA  A+ET  GF  +G  L +N A + +   +     R
Sbjct: 377 EDMLKGYGFIKLINHEQALAAIETFNGFMWHGNRLVVNKAVQHKVYNNHNSHDR 430

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 43/83 (51%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           N+FVG +   +    L+  F ++   +   +++D   G   GYGF+S+    QA + ++ 
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKE 255

Query: 245 KQGFELNGRALRINWASKREPQQ 267
             G  +NG  L IN+  +R+ ++
Sbjct: 256 LNGRTVNGSTLFINYHVERKERE 278

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 20/99 (20%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW-------------------DMQSGRSR 225
           NL+V  + +   D  L   +K F   I   V+                    D+  G SR
Sbjct: 541 NLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPVGSSR 600

Query: 226 GYGFVSFGEQDQAQVAMETKQGFELN-GRALRINWASKR 263
           GYGFVSF     A  A+    G++++  + L +++A KR
Sbjct: 601 GYGFVSFESPLDAAKAILNTDGYQVSKDQVLSVSFAQKR 639

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 21/95 (22%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIP-----DKNSQECN--------------- 138
           LYV ++P S  D+ L  +++  G I SVK+I      +K  Q+ N               
Sbjct: 542 LYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPVGSSRG 601

Query: 139 YAFVEYFEPHDANVAYQTLNGKEV-EGKVLKINWA 172
           Y FV +  P DA  A    +G +V + +VL +++A
Sbjct: 602 YGFVSFESPLDAAKAILNTDGYQVSKDQVLSVSFA 636

>TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.491
           YPL043W
          Length = 692

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFV  +  DV D  +   F  F     A ++ D Q  +SRG+GFVSF  +D    A++  
Sbjct: 28  LFVRSIPADVTDEEMGEFFSNFAPIKHAVIVKDAQK-KSRGFGFVSFAVEDDTLAALKEA 86

Query: 246 QGFELNGRALRINWASKREPQQSQ 269
           +  +L  R LRI+ A +R+  + +
Sbjct: 87  RKTKLKDRLLRIDIAKRRDRNKKK 110

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/190 (17%), Positives = 80/190 (42%), Gaps = 27/190 (14%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V ++P  + D+ + ++F     I    I+ D   +   + FV +    D   A + 
Sbjct: 26  KTLFVRSIPADVTDEEMGEFFSNFAPIKHAVIVKDAQKKSRGFGFVSFAVEDDTLAALKE 85

Query: 157 LNGKEVEGKVLKINWAF----------QSQQVNSD--------ETFNLFVGDLNVDV--- 195
               +++ ++L+I+ A           +S+  + D        +  +L  G   + +   
Sbjct: 86  ARKTKLKDRLLRIDIAKRRDRNKKKGEESKPTSEDTESADGPIDEESLLKGKPKIIIRNM 145

Query: 196 -----DDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFEL 250
                D   L   F  F + ++A +    + G+  G+ FV+  +    + A+E  +  ++
Sbjct: 146 PWSCRDPEKLKNIFSRFGTVVEAKI-PKKKDGKLCGFAFVTMKKLVNCKTAIENSKDLKI 204

Query: 251 NGRALRINWA 260
           +GR + +++A
Sbjct: 205 DGRKVAVDFA 214

 Score = 33.9 bits (76), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 99  LYVGNLPKSIDD-DLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           + + N+P S  D + LK  F   G++   KI   K+ + C +AFV   +  +   A +  
Sbjct: 140 IIIRNMPWSCRDPEKLKNIFSRFGTVVEAKIPKKKDGKLCGFAFVTMKKLVNCKTAIENS 199

Query: 158 NGKEVEGKVLKINWAFQSQQ 177
              +++G+ + +++A Q  +
Sbjct: 200 KDLKIDGRKVAVDFAVQKNK 219

>TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON}
           Anc_8.797 YOR319W
          Length = 210

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 87/175 (49%), Gaps = 15/175 (8%)

Query: 99  LYVGNL-PKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ-ECNYAFVEYFEPHDANVAYQT 156
           +YVGN+ PK   ++L + + Q+   I++++   DK  Q    +AFVE++ P D     Q 
Sbjct: 12  VYVGNIDPKVTKENLYELFVQVS-PIANIRYPKDKVLQLHQGFAFVEFYTPEDCQYVVQL 70

Query: 157 LNGK-EVEGKVLKINWAFQSQQVNSDETFN--------LFVGDLNVDVDDATLAGTFKEF 207
           LN   ++  + LK+  A  + Q +  +T +        +FV +L+  +D+  L+  F +F
Sbjct: 71  LNNTVQLYDRFLKVRKA--NVQSSGSDTIDVTIQPIAKVFVKNLDPSIDEPHLSRLFGKF 128

Query: 208 PSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
               +   ++ +  G+ R   ++ F   D + +A+ T  G  +  + + +++A K
Sbjct: 129 GPLAKGPEIFYLSDGQLRC-AYIYFKNYDHSDLALATLNGQLVVNKKVTVDYAFK 182

>NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.491
           YPL043W
          Length = 701

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFV  + +DV D  L   F  F     A V+ D+   +SRG+GFVSF  +D  + A++  
Sbjct: 28  LFVRSIPMDVTDEELTDYFSNFAPTKHAVVVKDVNK-KSRGFGFVSFAVEDDTKEALKKA 86

Query: 246 QGFELNGRALRINWASKRE 264
           +  +L G  LR++ A +R+
Sbjct: 87  RQTKLKGHLLRVDIAKRRD 105

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/203 (19%), Positives = 79/203 (38%), Gaps = 42/203 (20%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V ++P  + D+ L  YF          ++ D N +   + FV +    D   A + 
Sbjct: 26  KTLFVRSIPMDVTDEELTDYFSNFAPTKHAVVVKDVNKKSRGFGFVSFAVEDDTKEALKK 85

Query: 157 LNGKEVEGKVLKINWAFQSQ-----------QVNSDETFNLFVGDLNVD----VDDATLA 201
               +++G +L+++ A +             +V +D       GD N D    VD+ +L 
Sbjct: 86  ARQTKLKGHLLRVDIAKRRDRSSKSDDKNEGKVKTDTIAVGTRGDDNGDEPEEVDEESL- 144

Query: 202 GTFKEFPSFIQAHVMWDM------------------------QSGRSRGYGFVSFGEQDQ 237
              K  P  I  ++ W                          + G+  G+ FV+  +   
Sbjct: 145 --LKGKPKLIIRNMPWSCRDPEKLKKVFGRFGNVVEATIPRKRDGKLCGFAFVTMKKLSN 202

Query: 238 AQVAMETKQGFELNGRALRINWA 260
             +A+E  +  +++GR + +++A
Sbjct: 203 CHLALENTKDLKIDGRPVAVDFA 225

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 42/80 (52%), Gaps = 1/80 (1%)

Query: 99  LYVGNLPKSIDD-DLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           L + N+P S  D + LK+ F   G++    I   ++ + C +AFV   +  + ++A +  
Sbjct: 151 LIIRNMPWSCRDPEKLKKVFGRFGNVVEATIPRKRDGKLCGFAFVTMKKLSNCHLALENT 210

Query: 158 NGKEVEGKVLKINWAFQSQQ 177
              +++G+ + +++A Q  +
Sbjct: 211 KDLKIDGRPVAVDFAVQKNR 230

>Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 nt,
           265 aa]
          Length = 264

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 49/89 (55%), Gaps = 1/89 (1%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           NLFV +L+  VDD  L   F  F + I A VM   + G+S+ +GFV F   ++A  A+  
Sbjct: 22  NLFVKNLDDSVDDEKLQEEFSPFGTIISAKVMRT-EDGKSKNFGFVCFSTPEEATRAITE 80

Query: 245 KQGFELNGRALRINWASKREPQQSQQGQR 273
           K    + G+ L +  A ++E +++Q  Q+
Sbjct: 81  KNQQIVAGKPLYVAIAQRKEVRRAQLAQQ 109

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           L+V NL  S+DD+ L++ F   G+I S K++  ++ +  N+ FV +  P +A  A    N
Sbjct: 23  LFVKNLDDSVDDEKLQEEFSPFGTIISAKVMRTEDGKSKNFGFVCFSTPEEATRAITEKN 82

Query: 159 GKEVEGKVLKINWA 172
            + V GK L +  A
Sbjct: 83  QQIVAGKPLYVAIA 96

>TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.80
           YNL175C
          Length = 400

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 4/100 (4%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFVG+L+ D  D  L   F+     ++  +     SG+ +G+ FV F  ++ A  A+  K
Sbjct: 235 LFVGNLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGFAFVDFKNEEGATKALSDK 294

Query: 246 QGFELNGRALRINWASKREPQQSQQGQRRFNGPASGRGGF 285
              ++ GR LR+ +   R    S++  +R   PAS R  F
Sbjct: 295 SCRKIAGRPLRMEFGEDR----SKRVVKRKEQPASKREAF 330

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQ 155
           +IL+VGNL     D+LL+++FQ  G I  +++   ++S +C  +AFV++     A  A  
Sbjct: 233 RILFVGNLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGFAFVDFKNEEGATKALS 292

Query: 156 TLNGKEVEGKVLKINW 171
             + +++ G+ L++ +
Sbjct: 293 DKSCRKIAGRPLRMEF 308

>KNAG0I02030 Chr9 (396201..396890) [690 bp, 229 aa] {ON} Anc_2.167
           YNL110C
          Length = 229

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 1/90 (1%)

Query: 81  SAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQEC-NY 139
           +AA    + G R++   ILYV  LP    +  L +YF   G +  V++  +K +    +Y
Sbjct: 84  TAAAGGKSSGARDEHSSILYVSRLPHGFHERELSRYFSQFGDLKEVRLARNKKTGNSRHY 143

Query: 140 AFVEYFEPHDANVAYQTLNGKEVEGKVLKI 169
            F+E+ E  DA VA +T+N   + G +L++
Sbjct: 144 GFIEFAEVGDAQVAQETMNNYLLMGHLLQV 173

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           L+V  L     +  L+  F +F    +  +  + ++G SR YGF+ F E   AQVA ET 
Sbjct: 102 LYVSRLPHGFHERELSRYFSQFGDLKEVRLARNKKTGNSRHYGFIEFAEVGDAQVAQETM 161

Query: 246 QGFELNGRALRINWASK 262
             + L G  L++    K
Sbjct: 162 NNYLLMGHLLQVRLLGK 178

>TDEL0B06060 Chr2 complement(1071469..1072506) [1038 bp, 345 aa]
           {ON} Anc_1.408 YNL004W
          Length = 345

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 183 TFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAM 242
            + +FV +L   ++   L   FKE  + I+A V  D ++G SRG+G   FG  ++ Q A+
Sbjct: 152 AYEVFVANLPYSINWQALKDMFKEVGNVIRADVELD-RNGYSRGFGTAIFGTSEEMQAAI 210

Query: 243 ETKQGFELNGRALRI 257
           E   G+EL GR L +
Sbjct: 211 ERYNGYELEGRVLDV 225

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 90  GGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHD 149
           GG E+++ ++Y  NLP S     L   F+  G +++ ++  D + Q    A VEY    D
Sbjct: 261 GGGERNN-LIYCTNLPLSTATSDLYDLFETIGKVNNAELKYDADGQPLGIAVVEYANIED 319

Query: 150 ANVAYQTLNGKEVEGKVLKINWA 172
           A+V  + LN     G  L I++A
Sbjct: 320 ADVCMERLNNYNYGGCDLDISYA 342

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 72/193 (37%), Gaps = 29/193 (15%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           ++V NLP SI+   LK  F+  G++    +  D+N     +    +    +   A +  N
Sbjct: 155 VFVANLPYSINWQALKDMFKEVGNVIRADVELDRNGYSRGFGTAIFGTSEEMQAAIERYN 214

Query: 159 GKEVEGKVLKINWA--------------------------FQSQQVNSDETFNL-FVGDL 191
           G E+EG+VL +                             F    +   E  NL +  +L
Sbjct: 215 GYELEGRVLDVREGRNAPGPETAPVAPPVAAEAEVPQKSEFTEGVLGGGERNNLIYCTNL 274

Query: 192 NVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELN 251
            +    + L   F+       A + +D   G+  G   V +   + A V ME    +   
Sbjct: 275 PLSTATSDLYDLFETIGKVNNAELKYDA-DGQPLGIAVVEYANIEDADVCMERLNNYNYG 333

Query: 252 GRALRINWASKRE 264
           G  L I++A KRE
Sbjct: 334 GCDLDISYA-KRE 345

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 176 QQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQ 235
           ++VN +   ++F+G+L  D     L   F E    ++A ++     G  RG G V F   
Sbjct: 38  EKVNRNYANSIFIGNLTYDCTPEDLKDHFSEVGEVVRADII--TSRGHHRGMGTVEFTNS 95

Query: 236 DQAQVAM 242
           D    A+
Sbjct: 96  DDVDEAI 102

>Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL250W
          Length = 675

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFV ++     DA L   F +F     A ++ D   G SRG+GFVSF   +  Q A+   
Sbjct: 18  LFVRNIPFTATDAELTDFFSQFAPLKHAIIVKD-GDGNSRGFGFVSFAVDEDTQTALNEG 76

Query: 246 QGFELNGRALRINWASKRE 264
           +  +  GR LR++ A +RE
Sbjct: 77  RKMKFQGRLLRVDIAKRRE 95

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 35/193 (18%), Positives = 76/193 (39%), Gaps = 30/193 (15%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V N+P +  D  L  +F     +    I+ D +     + FV +    D   A   
Sbjct: 16  KTLFVRNIPFTATDAELTDFFSQFAPLKHAIIVKDGDGNSRGFGFVSFAVDEDTQTALNE 75

Query: 157 LNGKEVEGKVLKINWAFQSQQ---------------------VNSDETFNLFVGDLNVDV 195
               + +G++L+++ A + ++                     V  D +  +  G   + +
Sbjct: 76  GRKMKFQGRLLRVDIAKRRERSKKSEGDEGEGGKETASRDKTVEEDSSDAMMKGKPKLII 135

Query: 196 --------DDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQG 247
                   D   L   F  F + ++  +    + GR  G+ FV+  +    + A+E  +G
Sbjct: 136 RNMPWSCRDAEKLKKIFSRFGTVVETTIPRK-RDGRLCGFAFVTMKKLANCEKAIEGSKG 194

Query: 248 FELNGRALRINWA 260
            +++GR + +++A
Sbjct: 195 LKIDGRDVAVDFA 207

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 99  LYVGNLPKSIDD-DLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           L + N+P S  D + LK+ F   G++    I   ++ + C +AFV   +  +   A +  
Sbjct: 133 LIIRNMPWSCRDAEKLKKIFSRFGTVVETTIPRKRDGRLCGFAFVTMKKLANCEKAIEGS 192

Query: 158 NGKEVEGKVLKINWAFQSQQ 177
            G +++G+ + +++A Q  +
Sbjct: 193 KGLKIDGRDVAVDFAVQKNK 212

>NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408
          Length = 435

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 87/211 (41%), Gaps = 37/211 (17%)

Query: 83  APVLATQGGREKSDKI-------LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDK--- 132
            PVLA +      +K+       ++VGNL      + L+ YF   G +    II  K   
Sbjct: 84  GPVLARELDSTYEEKVNRNYANSIFVGNLTYDCTPEDLRDYFSGIGEVVRADIITSKGHH 143

Query: 133 ---------NSQECNYAFVEYFEPH--DANVAYQTLNGKEVEGKVLK------------- 168
                    NS++   A  +Y   +  D  +  +  N     G+  +             
Sbjct: 144 RGMGTVEFTNSRDVEEAIRQYDSSYFMDRQIFVRQDNPPPDNGRNERTPSRRTTAPSSRQ 203

Query: 169 --INWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRG 226
             I+    S Q N  + + +FV +L   ++   L   FKE    ++A V  D ++GRSRG
Sbjct: 204 QDISSGAYSMQSNMKQGYEIFVANLPYSINWQALKDMFKECGDVMRADVELD-RAGRSRG 262

Query: 227 YGFVSFGEQDQAQVAMETKQGFELNGRALRI 257
           +G V F  +D  + A++    FE++GR L +
Sbjct: 263 FGTVIFRTRDDMERAIDRYNRFEVDGRTLDV 293

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           ++Y  NLP S     L   F+  G + + ++  D+N +    A VE+    DA+V  + L
Sbjct: 358 LIYCSNLPPSTARSDLYDLFESIGKVRNAELKYDRNGETTGVAIVEFISQDDADVCIERL 417

Query: 158 NGKEVEGKVLKINWA 172
           N     G  L+I++A
Sbjct: 418 NKYNYGGCDLEISYA 432

>Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {ON}
           YPL043W (NOP4) - RNA recognition motif-containing
           protein [contig 27] FULL
          Length = 686

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 1/85 (1%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFV  +  D  D  LA  F        A ++ D Q   SRG+GFVSF  +D  + A++  
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKN-SRGFGFVSFAVEDDTKDALDKA 81

Query: 246 QGFELNGRALRINWASKREPQQSQQ 270
           +  +  GR LR++ A +R+  +  Q
Sbjct: 82  RKTKFKGRLLRVDIAKRRDRTKKDQ 106

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/192 (19%), Positives = 75/192 (39%), Gaps = 34/192 (17%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V ++P    D+ L  YF     I    I+ D       + FV +    D   A   
Sbjct: 21  KTLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDK 80

Query: 157 LNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNV----DVDDATLAGTFKEFPSFIQ 212
               + +G++L+++ A +  +   D+  N   G  +     D +D  L G     P  I 
Sbjct: 81  ARKTKFKGRLLRVDIAKRRDRTKKDQ--NAAAGSEDTSGPQDKEDELLGGK----PKLIV 134

Query: 213 AHVMWDMQS------------------------GRSRGYGFVSFGEQDQAQVAMETKQGF 248
            ++ W +++                        G+  G+ FV+  +    ++A+E  +  
Sbjct: 135 RNMPWSVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSL 194

Query: 249 ELNGRALRINWA 260
           ++ GR + +++A
Sbjct: 195 KIGGRQVAVDFA 206

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 51/104 (49%), Gaps = 7/104 (6%)

Query: 81  SAAPVLATQGGREKSDKIL------YVGNLPKSIDD-DLLKQYFQIGGSISSVKIIPDKN 133
           +AA    T G ++K D++L       V N+P S+ + D LK+ F   G++   KI    +
Sbjct: 108 AAAGSEDTSGPQDKEDELLGGKPKLIVRNMPWSVRNPDELKKIFMRYGTVVEAKIPKRPD 167

Query: 134 SQECNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQ 177
            + C +AFV   +     +A +     ++ G+ + +++A Q  +
Sbjct: 168 GKLCGFAFVTMKKLASCKIAIEESKSLKIGGRQVAVDFAVQKNK 211

>ADR017W Chr4 (734484..735005) [522 bp, 173 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIR005W (IST3)
          Length = 173

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 58/108 (53%), Gaps = 7/108 (6%)

Query: 153 AYQTLNGKEVEGKVL--KINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSF 210
           + Q L+  E+E  +L  + +W +Q +    D+ +  F G LNV++ +  +   F +F   
Sbjct: 6   SIQKLSETELEHGILSEEASWHYQYK----DQAYIHFSG-LNVELTEGDILTVFSQFGVP 60

Query: 211 IQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRIN 258
               ++ D ++G SRG+GF+ + +Q    +A++   G  L GR L+++
Sbjct: 61  TDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVLKVD 108

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 111 DLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQTLNGKEVEGKVLKI 169
           D+L  + Q G   + +K++ D+ + E   + F++Y +     +A   LNG  + G+VLK+
Sbjct: 49  DILTVFSQFGVP-TDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVLKV 107

Query: 170 NWAF 173
           +  F
Sbjct: 108 DHCF 111

>CAGL0L12672g Chr12 complement(1361933..1363981) [2049 bp, 682 aa]
           {ON} similar to uniprot|P37838 Saccharomyces cerevisiae
           YPL043w nucleolar protein
          Length = 682

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 53/100 (53%), Gaps = 4/100 (4%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFV  +   V D  LA  F  F     A V+ D+   +SRG+GFVSF  +D  ++A++  
Sbjct: 24  LFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNK-KSRGFGFVSFAVEDDTKIALKEA 82

Query: 246 QGFELNGRALRINWASKRE---PQQSQQGQRRFNGPASGR 282
           +  +L+G  L+++ A +R+     + +  Q+  +  +S R
Sbjct: 83  RKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKR 122

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/199 (18%), Positives = 78/199 (39%), Gaps = 35/199 (17%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V ++P+S+ D+ L  +F     I    ++ D N +   + FV +    D  +A + 
Sbjct: 22  KTLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKE 81

Query: 157 LNGKEVEGKVLKINWAFQSQQVNSDE-----------TFNLFVGDLNVDVDDATLAGTFK 205
               +++G  LK++ A +  +   +E           +     GD N +  +   +   K
Sbjct: 82  ARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLK 141

Query: 206 EFPSFIQAHVMWDM------------------------QSGRSRGYGFVSFGEQDQAQVA 241
             P  I  ++ W                          + G+  G+ FV+  +    + A
Sbjct: 142 GKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKA 201

Query: 242 METKQGFELNGRALRINWA 260
           +E  +   ++GR + +++A
Sbjct: 202 LEDTKNLTIDGRKVAVDFA 220

>ZYRO0G04862g Chr7 complement(387238..388368) [1131 bp, 376 aa] {ON}
           highly similar to gnl|GLV|CAGL0J11154g Candida glabrata
           CAGL0J11154g and similar to YNL175C uniprot|P53883
           Saccharomyces cerevisiae
          Length = 376

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFVG+L+ D  D  L   F+     I+  +     SG+ +G+ FV F E+  A  A++ K
Sbjct: 216 LFVGNLSFDTSDDLLRKHFQHCGDIIKVRMATFQDSGKCKGFAFVDFKEEQGATNALKDK 275

Query: 246 QGFELNGRALRINWASKREPQQ 267
              ++ GR++R+ +   R  +Q
Sbjct: 276 SCRKIAGRSIRMEYGEDRSKRQ 297

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQ 155
           +IL+VGNL     DDLL+++FQ  G I  V++   ++S +C  +AFV++ E   A  A +
Sbjct: 214 RILFVGNLSFDTSDDLLRKHFQHCGDIIKVRMATFQDSGKCKGFAFVDFKEEQGATNALK 273

Query: 156 TLNGKEVEGKVLKINW 171
             + +++ G+ +++ +
Sbjct: 274 DKSCRKIAGRSIRMEY 289

>CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae YFR023w PES4
           DNA-directed DNA polymerase epsilon suppressor
          Length = 602

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 41/72 (56%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFVG+L  ++    L   FK + SFI A V  +    RS G+G+++FG ++ A+ A E  
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 246 QGFELNGRALRI 257
              ++ G+ +RI
Sbjct: 126 NYNKIMGKEIRI 137

 Score = 37.4 bits (85), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 76/175 (43%), Gaps = 9/175 (5%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +++ NLP   +++ +   F   G I SV + P   S+E  +AFV Y +      A    N
Sbjct: 278 IFIKNLPLDTNNNEILAIFSEVGPIKSVFLSPLNESREYLWAFVTYKDKASVEKAISLFN 337

Query: 159 GKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEF---PSFIQAHV 215
           GK +  + + +  A+    + + +   LF+ +L+   D   L     +    P  I+ H 
Sbjct: 338 GKAIGNRNVFVTHAYSKYNIPTPKPI-LFLSNLSPICDRKFLKQIMNQLSVKPEDIKVHQ 396

Query: 216 MWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQ 270
             + +   S G   + F  QD    A +      ++G  +   +A+ R+ +++Q+
Sbjct: 397 SENPEHVTSTGT--IQFKTQDDLDKAKKFLNNKLVSGSII---YATTRKSKKNQE 446

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 66/142 (46%), Gaps = 4/142 (2%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPD-KNSQECNYAFVEYFEPHDANVAYQTL 157
           L+VGNL + I  + L + F++  S  S K+  +  +++   + ++ +    DA  A +  
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           N  ++ GK ++I  + +      +   N+F  +L +  +  T    +  F  +   +V+ 
Sbjct: 126 NYNKIMGKEIRIMPSIRDSVYRKNFGTNIFFSNLPLQKEKLTHRMFYDIFRKY--GNVL- 182

Query: 218 DMQSGRSRGYGFVSFGEQDQAQ 239
            ++   S+  GFV F +   A+
Sbjct: 183 SVKLDSSKNIGFVYFEDDTIAR 204

>TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {ON}
           Anc_1.357 YHR015W
          Length = 622

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 78/165 (47%), Gaps = 14/165 (8%)

Query: 94  KSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANV 152
           KS   L++G+L  S+ +++L+  F    S++SVKI  D NS +   Y ++ +    DA  
Sbjct: 94  KSVVALFIGDLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFANSEDAEK 153

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLA-----GTFKEF 207
           A +  N + +EG+ ++I  + ++     +   N+F    N+ ++D+ L       TFK++
Sbjct: 154 ATEEFNYRPIEGQEVRIMPSLRNSFYRKNVGTNVFFS--NLPLEDSRLTTRVFYDTFKKY 211

Query: 208 PSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNG 252
              +   +       + +  GF+ F     A+  ++   G E  G
Sbjct: 212 GKILSCKL------DKRKDIGFIYFNNDQSARKVIKDYNGKEFFG 250

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%)

Query: 175 SQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGE 234
           S  + S     LF+GDL   V +  L   F +F S     +  D  SG+S GYG+++F  
Sbjct: 88  SSTLESKSVVALFIGDLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFAN 147

Query: 235 QDQAQVAMETKQGFELNGRALRI 257
            + A+ A E      + G+ +RI
Sbjct: 148 SEDAEKATEEFNYRPIEGQEVRI 170

>Kwal_23.5864 s23 (1347244..1348080) [837 bp, 278 aa] {ON} YIL061C
           (SNP1) - U1snRNP 70K protein homolog [contig 11] FULL
          Length = 278

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 50/109 (45%), Gaps = 8/109 (7%)

Query: 158 NGKEVEGKVLKINWAF-----QSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQ 212
           N +++E   LK   +       +  V SD    +FVG L   V +  L   F  F    +
Sbjct: 70  NARQIEADALKEKLSHWHPNEDANIVGSDPYRTVFVGRLPYTVTEVELQKEFVRFGEIEK 129

Query: 213 AHVMWDMQSGRSRGYGFVSFGEQDQAQVAME---TKQGFELNGRALRIN 258
             V+ D  S +SRGYGF+ F E+  A+ A       +G E+ GR + ++
Sbjct: 130 VRVVRDKTSNKSRGYGFIMFKEELFARTACREIGVHRGVEIGGRPVIVD 178

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQ 155
           + ++VG LP ++ +  L++ F   G I  V+++ DK S +   Y F+ + E   A  A +
Sbjct: 101 RTVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACR 160

Query: 156 TL---NGKEVEGKVLKIN 170
            +    G E+ G+ + ++
Sbjct: 161 EIGVHRGVEIGGRPVIVD 178

>Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W
           (IST3) - U2 snRNP associated protein [contig 135] FULL
          Length = 135

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 60/106 (56%), Gaps = 7/106 (6%)

Query: 155 QTLNGKEVEGKVLK--INWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQ 212
           Q L+ +E+E  +L    +W F+ +    D+ + +FVG L+ D+ +  +   F ++   + 
Sbjct: 8   QNLSFRELEQGILSPTASWHFEYK----DQAY-IFVGGLHKDLTEGDILTIFSQYGIPVD 62

Query: 213 AHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRIN 258
             ++ D +SG S+G+ ++ + +Q    +A++   G ++ GR++R++
Sbjct: 63  LKLVRDRESGESKGFAYLKYEDQRSTVLAVDNLNGVKIAGRSIRVD 108

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/71 (21%), Positives = 30/71 (42%), Gaps = 6/71 (8%)

Query: 362 YIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPE------KGCCFIKYDTHEQAALCIVALT 415
           ++G +     E D++ +   +G  +D K   +      KG  ++KY+      L +  L 
Sbjct: 37  FVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNLN 96

Query: 416 NFPFQGRNLRT 426
                GR++R 
Sbjct: 97  GVKIAGRSIRV 107

>Suva_7.546 Chr7 complement(946681..949020) [2340 bp, 779 aa] {ON}
           YGR250C (REAL)
          Length = 779

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 85/220 (38%), Gaps = 58/220 (26%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQTL 157
           ++VG + KS+    L   F   G + S+K+I DK   E N Y F  Y     A++  + L
Sbjct: 197 IFVGGIAKSLSIGELSFLFSKYGPVLSMKLIYDKTKGEPNGYGFFSYPLGSQASLCIREL 256

Query: 158 NGKEVEGKVL------------KINWAFQSQQVNSDETFNLFVGDLN------------- 192
           NGK V G  L            +I+W    +  N D    LF+G+L              
Sbjct: 257 NGKTVSGSTLFINYHVERKERERIHWDHVKENNNDDNYRCLFIGNLPYHNTEKEESLITP 316

Query: 193 ---VDVDDATLAGTFKEFPSF-----------------------IQAHVMWDMQSGRS-- 224
              +DV    L+  F +F                          + ++ + ++ +G +  
Sbjct: 317 KDVIDVIKRELSKRFSDFDIISYYFPKKSNARSSSSVSFQDDGSVDSNKISNITAGAAQE 376

Query: 225 ----RGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
               +GYGF+     +QA  A+E   GF  +G  L +N A
Sbjct: 377 EDMLKGYGFIKLINHEQALAAIEIFNGFMWHGNRLVVNKA 416

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           N+FVG +   +    L+  F ++   +   +++D   G   GYGF S+    QA + +  
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPVLSMKLIYDKTKGEPNGYGFFSYPLGSQASLCIRE 255

Query: 245 KQGFELNGRALRINWASKREPQQ 267
             G  ++G  L IN+  +R+ ++
Sbjct: 256 LNGKTVSGSTLFINYHVERKERE 278

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 43/99 (43%), Gaps = 20/99 (20%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVM-------------------WDMQSGRSR 225
           NL+V  + +   D  L G +K F   I   V+                    D+  G SR
Sbjct: 541 NLYVKHIPLSWTDEDLYGFYKTFGEIISVKVITVGGSKNKYRQQSNDSSSDSDLPVGSSR 600

Query: 226 GYGFVSFGEQDQAQVAMETKQGFELN-GRALRINWASKR 263
           GYGFVSF     A  A+    G++++  + L +++A KR
Sbjct: 601 GYGFVSFESPLDAAKAISNTDGYQVSKDQVLSVSFAQKR 639

>KLLA0C08019g Chr3 complement(704199..705104) [906 bp, 301 aa] {ON}
           weakly similar to uniprot|Q00916 Saccharomyces
           cerevisiae YIL061C SNP1 U1snRNP 70K protein homolog,
          Length = 301

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 6/100 (6%)

Query: 160 KEVEGKVLKI-NWAFQSQ-QVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           KE E  + KI  W  +S   ++SD    LFVG L+  VD+  L  +F ++       ++ 
Sbjct: 89  KEQEELMKKIQEWHPESDANISSDPYRTLFVGRLHYAVDEVELQKSFVKYGDIESCRIVR 148

Query: 218 DMQSGRSRGYGFVSFGE-QDQAQVAME--TKQGFELNGRA 254
           D Q G+SRGYGFV F   +D  Q   E   ++G E+ GR 
Sbjct: 149 D-QDGKSRGYGFVQFTSYEDSKQCFRELGVRKGIEIMGRT 187

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           + L+VG L  ++D+  L++ F   G I S +I+ D++ +   Y FV++    D+   ++ 
Sbjct: 115 RTLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFRE 174

Query: 157 L---NGKEVEGKV 166
           L    G E+ G+ 
Sbjct: 175 LGVRKGIEIMGRT 187

>TBLA0A01570 Chr1 (364733..366961) [2229 bp, 742 aa] {ON} Anc_8.491
           YPL043W
          Length = 742

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 3/110 (2%)

Query: 161 EVEGKVLKINWAFQSQQVNSDETF-NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDM 219
           +VE  V K N    S   ++D  F  LFV  + +D  D  LA  F  F     A ++ D 
Sbjct: 11  KVENPVTK-NNKNDSNSTDNDLDFKTLFVRSIPLDTTDGELADYFSNFAPIRHAVIVKDD 69

Query: 220 QSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ 269
           Q  RSRG+GFV+F  ++  + A++  +  +L    +R++ A +R+  +++
Sbjct: 70  QK-RSRGFGFVTFAVEEDTKEALKQARKTKLKNHLIRVDIAKRRDRNKTK 118

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 38/202 (18%), Positives = 80/202 (39%), Gaps = 39/202 (19%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V ++P    D  L  YF     I    I+ D   +   + FV +    D   A + 
Sbjct: 34  KTLFVRSIPLDTTDGELADYFSNFAPIRHAVIVKDDQKRSRGFGFVTFAVEEDTKEALKQ 93

Query: 157 LNGKEVEGKVLKINWAFQ---------SQQVNSDETFNLFV-----GDLNVDVDDATLAG 202
               +++  +++++ A +         S+Q+++D+           G+ N D +D     
Sbjct: 94  ARKTKLKNHLIRVDIAKRRDRNKTKASSEQISNDQNSEKKQVIDNHGEYNNDNEDPE-DS 152

Query: 203 TFKEFPSFIQAHVMWD------------------------MQSGRSRGYGFVSFGEQDQA 238
            FK  P  I  ++ W                          + G+  G+ FV+  +    
Sbjct: 153 EFKGKPKLIIRNMPWSCRDPIKLKKIFSRFGNVVDASIPRKRDGKLCGFAFVTMKKISNC 212

Query: 239 QVAMETKQGFELNGRALRINWA 260
           ++A+E  +  +++GRA+ +++A
Sbjct: 213 RIALENTKDLKIDGRAVAVDFA 234

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 99  LYVGNLPKSIDDDL-LKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           L + N+P S  D + LK+ F   G++    I   ++ + C +AFV   +  +  +A +  
Sbjct: 160 LIIRNMPWSCRDPIKLKKIFSRFGNVVDASIPRKRDGKLCGFAFVTMKKISNCRIALENT 219

Query: 158 NGKEVEGKVLKINWAFQSQQ 177
              +++G+ + +++A Q  +
Sbjct: 220 KDLKIDGRAVAVDFAIQKNR 239

>Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON}
           similar to Ashbya gossypii ABL059W
          Length = 204

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 78/168 (46%), Gaps = 5/168 (2%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQTL 157
           +YVGNL   +  + L + F   G +  ++   DK +QE   +AFVE++   D   A ++L
Sbjct: 9   IYVGNLDGQVTKEHLYELFVQMGPVYRIRYRKDKITQEYQGFAFVEFYTNSDCEFAIKSL 68

Query: 158 NGK-EVEGKVLKINWAFQSQQVNSD--ETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAH 214
           N    + GK+LK+    ++            LFV +L+  VD   L   F +F   ++  
Sbjct: 69  NNSVSLFGKILKVRRTLENTHYGGPLISGAKLFVKNLDDSVDFQQLQKLFGKFGPLVKQP 128

Query: 215 VMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262
            ++ +++G  +   ++ +     +  A++      L  R + I++A K
Sbjct: 129 EIFTLKNGTLKC-AYIYYSTFKHSDEALQKLNKQILANRVISIDYAFK 175

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 44/87 (50%), Gaps = 7/87 (8%)

Query: 354 APPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL--CI 411
           AP R  T Y+GNIP      +L+  +++ G + D K  PEK C FI +     A L    
Sbjct: 166 APSR--TVYLGNIPTTLTVKELLDHVRS-GVVEDVKILPEKMCAFISFVDDSSALLFHSD 222

Query: 412 VALTNFPFQGRNLRTGWGKEKPTFIRP 438
             L     +GR+++ GWG  KPT I P
Sbjct: 223 AILKRLNIEGRDIKIGWG--KPTKIDP 247

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 10/81 (12%)

Query: 361 AYIGNI---------PHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCI 411
            YIGNI              E +L  L Q +G +      P K CCFI Y     A   I
Sbjct: 502 VYIGNIDFEEDSKRNERVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAI 561

Query: 412 VALTNFPFQGRNLRTGWGKEK 432
             + + P+  ++L+  +GK++
Sbjct: 562 DKIKSNPY-FKDLKINFGKDR 581

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 59/127 (46%), Gaps = 16/127 (12%)

Query: 90  GGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHD 149
           G     ++ +Y+GNLPK I  + +    +  G + SVK++ D+     +  FV + +P  
Sbjct: 402 GPNNLGNRTVYLGNLPKGIKIEEICNTVR-SGLLQSVKLLSDR-----HVCFVTFIDPTA 455

Query: 150 AN--VAYQTLNGKEVEGKVLKINWAFQS--------QQVNSDETFNLFVGDLNVDVDDAT 199
           A    A  +L+G  ++ K  K+ W   S          V++  + N+++G+++ + D   
Sbjct: 456 AAQFYAMSSLHGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFEEDSKR 515

Query: 200 LAGTFKE 206
               F E
Sbjct: 516 NERVFTE 522

>TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON}
           Anc_1.102
          Length = 334

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 58/129 (44%), Gaps = 4/129 (3%)

Query: 143 EYFEPHDANVAYQTLNGKEVEGK--VLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATL 200
           E  E H A  +  +L   E+E +   L+I     S  +   +T  LFV  LN   +   L
Sbjct: 201 ELIEKHQAK-SKMSLLKSEIENQELALEIIGDIPSSTIKPLKTV-LFVCKLNAMTNAKDL 258

Query: 201 AGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
           A  F  F   I   ++ D  +GRS GYGF+ F  +   ++A    +G  ++ + + ++++
Sbjct: 259 AQIFSRFGQIISVEIVRDKDTGRSLGYGFIEFDSEGAVELAYSNMEGVIIDDKKIHVDFS 318

Query: 261 SKREPQQSQ 269
                  SQ
Sbjct: 319 QSVSKLASQ 327

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQT 156
           +L+V  L    +   L Q F   G I SV+I+ DK++ +   Y F+E+       +AY  
Sbjct: 243 VLFVCKLNAMTNAKDLAQIFSRFGQIISVEIVRDKDTGRSLGYGFIEFDSEGAVELAYSN 302

Query: 157 LNGKEVEGKVLKINWA 172
           + G  ++ K + ++++
Sbjct: 303 MEGVIIDDKKIHVDFS 318

>NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80
          Length = 399

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 53/115 (46%), Gaps = 18/115 (15%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFVG+L+ D  D  L   F+     I+  +     SG+ +G+ FV F  ++ A  A++ K
Sbjct: 240 LFVGNLSFDTTDELLRKHFQHCGEIIKIRMATFEDSGKCKGFAFVDFKNEEGATNALKDK 299

Query: 246 QGFELNGRALRINWAS-------KREPQQSQ-----------QGQRRFNGPASGR 282
              ++ GR LR+ +         +R+P Q Q           Q Q+R N PA  R
Sbjct: 300 TCRKIAGRPLRMEFGEDRSKRQVRRKPDQEQKRTIDIPNKDPQLQQRENNPAKFR 354

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQ 155
           +IL+VGNL     D+LL+++FQ  G I  +++   ++S +C  +AFV++     A  A +
Sbjct: 238 RILFVGNLSFDTTDELLRKHFQHCGEIIKIRMATFEDSGKCKGFAFVDFKNEEGATNALK 297

Query: 156 TLNGKEVEGKVLKINW 171
               +++ G+ L++ +
Sbjct: 298 DKTCRKIAGRPLRMEF 313

>KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [1332
           bp, 443 aa] {ON} similar to uniprot|P38922 Saccharomyces
           cerevisiae YNL004W
          Length = 443

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 70/175 (40%), Gaps = 18/175 (10%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +++GNL  +   + LK+YF   G +    II  +         VE+    D + A +  +
Sbjct: 143 IFIGNLTYNTTPEDLKEYFGKIGEVRRADIITSRGHHR-GMGTVEFNNSTDVDTAIRDCD 201

Query: 159 GKEVEGKVLKIN----------------WAFQSQQVNSDETFNLFVGDLNVDVDDATLAG 202
           G  + G+ + +                       +   DE F +FV  L   V+   L  
Sbjct: 202 GAFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDEGFEVFVAQLPFSVNWQELKD 261

Query: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRI 257
            FK     + A V+ D + G+SRG+G V    ++Q   A+    G E  GR L +
Sbjct: 262 MFKPCGDVLHADVVTD-RDGKSRGFGTVYMATKEQQNDAIRHWTGTEYKGRVLDV 315

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 2/80 (2%)

Query: 176 QQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQ 235
           ++VN +   ++F+G+L  +     L   F +     +A ++     G  RG G V F   
Sbjct: 133 EKVNRNYANSIFIGNLTYNTTPEDLKEYFGKIGEVRRADII--TSRGHHRGMGTVEFNNS 190

Query: 236 DQAQVAMETKQGFELNGRAL 255
                A+    G  LNGRA+
Sbjct: 191 TDVDTAIRDCDGAFLNGRAI 210

>Skud_7.583 Chr7 complement(965719..968058) [2340 bp, 779 aa] {ON}
           YGR250C (REAL)
          Length = 779

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 88/220 (40%), Gaps = 58/220 (26%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQTL 157
           ++VG + K +    L   F   G +SS+K+I DK   + N Y F  Y     A+V  + L
Sbjct: 196 IFVGGIAKGLSMGELSFLFSKYGPVSSMKLIYDKTKGDTNGYGFFSYPLGSQASVCIKEL 255

Query: 158 NGKEVEGKVLKINWAFQSQQV-----------NSDETFN-LFVGDL---NVDVDDATLA- 201
           NG  V G  L IN+  + ++            N+D+ F  LF+G+L   N D ++A +  
Sbjct: 256 NGSTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPDKEEALITP 315

Query: 202 ---------GTFKEFPSF-IQAHVMWDMQSGRS--------------------------- 224
                       + FP F I ++      + RS                           
Sbjct: 316 KEVIDVIKKELSRNFPDFDIISYYFPKRSNTRSSSSVSFNDEGSIDSSKFSLNANGPAQD 375

Query: 225 ----RGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
               +GYGF+     +QA  A+ET  G+  +G  L +N A
Sbjct: 376 EDMLKGYGFIKLINHEQALAAIETFNGYMWHGNRLVVNKA 415

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           N+FVG +   +    L+  F ++       +++D   G + GYGF S+    QA V ++ 
Sbjct: 195 NIFVGGIAKGLSMGELSFLFSKYGPVSSMKLIYDKTKGDTNGYGFFSYPLGSQASVCIKE 254

Query: 245 KQGFELNGRALRINWASKREPQQ 267
             G  +NG  L IN+  +R+ ++
Sbjct: 255 LNGSTVNGSTLFINYHVERKERE 277

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 20/99 (20%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW-------------------DMQSGRSR 225
           NL+V  + +   D  L G +K F   I   V+                    D+  G SR
Sbjct: 540 NLYVKHIPLSWTDEDLYGFYKTFGEIISVKVITVGGSKNKYRQQSNDTSSDSDLPVGSSR 599

Query: 226 GYGFVSFGEQDQAQVAMETKQGFEL-NGRALRINWASKR 263
           GYGFVSF     A  A+    G+++   + L +++A KR
Sbjct: 600 GYGFVSFESPLDAAKAILNTDGYQVGKDQVLSVSFAQKR 638

>Suva_9.214 Chr9 (351853..352293) [441 bp, 146 aa] {ON} YIR005W
           (REAL)
          Length = 146

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 67/123 (54%), Gaps = 6/123 (4%)

Query: 155 QTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAH 214
           Q++N +E++  +L  + ++ ++    D  + +++G+LN ++ +  +   F E+   +   
Sbjct: 5   QSINDEELQSGILSPHLSWHNEY--RDNAY-IYIGNLNKELTEGDILTIFSEYGVPVDIT 61

Query: 215 VMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRIN---WASKREPQQSQQG 271
           +  D  +G S+G+ ++ + +Q    +A++   G ++ GRAL+I+   +  KR  Q+  + 
Sbjct: 62  LSRDENTGESQGFAYLKYEDQRSTILAVDNLNGVKIGGRALKIDHTFYRPKRNLQRYHEA 121

Query: 272 QRR 274
            R+
Sbjct: 122 VRQ 124

 Score = 36.6 bits (83), Expect = 0.044,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 94  KSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANV 152
           + +  +Y+GNL K + +  +   F   G    + +  D+N+ E   +A+++Y +     +
Sbjct: 28  RDNAYIYIGNLNKELTEGDILTIFSEYGVPVDITLSRDENTGESQGFAYLKYEDQRSTIL 87

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQVN 179
           A   LNG ++ G+ LKI+  F   + N
Sbjct: 88  AVDNLNGVKIGGRALKIDHTFYRPKRN 114

>KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {ON}
           Anc_5.76 YGR250C
          Length = 625

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 87/194 (44%), Gaps = 32/194 (16%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDK----NSQECNYAFVEYFEPHDANVAY 154
           L++G + K+I    L   F + G I S+K+I D      + E NY FV Y     A    
Sbjct: 170 LFIGGIDKAITLSQLTTIFSVYGPIISIKLISDTNNNSKNNETNYGFVSYQFGSQAANCI 229

Query: 155 QTLNGKEVEGKVLKINWAF------QSQQVNSDETFN------LFVGDL-NVDVDD---- 197
             LNGK++    L IN+        + Q +++DE  N      +F+G+L  V V+     
Sbjct: 230 NDLNGKKIHDSNLFINYHVDVKERERIQWLDADENNNAKNFKCVFIGNLPKVAVNGEPIT 289

Query: 198 -----ATLAGTFKE-FPSF-IQAHVM----WDMQSGRSRGYGFVSFGEQDQAQVAMETKQ 246
                 T+    KE F +F I +H       D +S   +GYGFV     ++A   + +  
Sbjct: 290 CGMILETIKDRLKEQFANFEILSHYFPEDTVDDRSELLKGYGFVKVATHEEAIEIINSFN 349

Query: 247 GFELNGRALRINWA 260
           G+E +G  L +N A
Sbjct: 350 GYEFHGSKLIVNRA 363

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 51/115 (44%), Gaps = 19/115 (16%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW------------------DMQSGRSRG 226
           NL+V  + ++  D  L   +++F   I A V+                    +  G+SRG
Sbjct: 440 NLYVKHIPLEWRDTELFDFYRKFGEIISAKVITVGGSRNNSHVDIGESESGTLVHGQSRG 499

Query: 227 YGFVSFGEQDQAQVAMETKQGFELN-GRALRINWASKREPQQSQQGQRRFNGPAS 280
           YGFV F     A  A+    GFE++    L  ++A K+  +++++     N P+S
Sbjct: 500 YGFVCFENPVDASRAILGTDGFEIDENNTLSASFAQKKNLKKNKRDNVNGNNPSS 554

>AAL018W Chr1 (309542..310555) [1014 bp, 337 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL004W (HRB1) and
           YCL011C (GBP2)
          Length = 337

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 66/173 (38%), Gaps = 16/173 (9%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +++GNL      + L+Q F   G +    II  +         VEY    D + A +  N
Sbjct: 9   VFIGNLTYDTTPEDLRQLFGEVGHVVRADIITSRGHHR-GMGTVEYTNAQDVDEAIRRFN 67

Query: 159 GKEVEGKVLKINWAFQSQQVNSDET--------------FNLFVGDLNVDVDDATLAGTF 204
           G +   + L +            E               F +FV +L   +   TL   F
Sbjct: 68  GMDFMHRELFVRRDNPPPVGERRERRGPGPLPRRTHPGGFEIFVANLPYSISWQTLKDMF 127

Query: 205 KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRI 257
           KE    I A V  D   G SRG+G V    ++    A+E   G+EL GR L +
Sbjct: 128 KECSEVIHADVSVDAD-GYSRGFGTVYVTTRENQIAAIERWNGYELEGRILEV 179

>Kpol_487.6 s487 (35743..36873) [1131 bp, 376 aa] {ON}
           (35743..36873) [1131 nt, 377 aa]
          Length = 376

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 184 FNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAME 243
           + +F+ +L   ++   L   FKE  S I+A V  D ++G SRG+G V  G Q+  + A+ 
Sbjct: 176 YEVFIANLPYSINWQALKDMFKECGSVIRADVELD-RNGYSRGFGTVILGSQEDMERAIS 234

Query: 244 TKQGFELNGRALRI 257
              G+EL GR L +
Sbjct: 235 MYNGYELEGRVLEV 248

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 78/204 (38%), Gaps = 43/204 (21%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +++ NLP SI+   LK  F+  GS+    +  D+N     +  V      D   A    N
Sbjct: 178 VFIANLPYSINWQALKDMFKECGSVIRADVELDRNGYSRGFGTVILGSQEDMERAISMYN 237

Query: 159 GKEVEGKVLKINWAFQSQQVNSDETF----NLFVGDLNVDVDDATLAGTFKEF------- 207
           G E+EG+VL++    + +  N DE      ++ + D   D++D   AGT  +F       
Sbjct: 238 GYELEGRVLEVR---EGRSNNQDEEMPISEDIEINDNGNDINDEN-AGTSDQFTDGVVGG 293

Query: 208 ------------PSFIQAHVMWDM---------------QSGRSRGYGFVSFGEQDQAQV 240
                       P       ++D+               Q G   G   V +   D AQV
Sbjct: 294 GEKNELIYCSNLPFSTAKSDLFDLFETIGKLKNAELKFDQKGNPTGVAIVEYENVDDAQV 353

Query: 241 AMETKQGFELNGRALRINWASKRE 264
            ++    +   G  L I++  KRE
Sbjct: 354 CVDRLNNYNYGGCDLDISYG-KRE 376

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 7/77 (9%)

Query: 362 YIGNIPHFAQEHDLIPLLQNFGFI------IDFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           Y  N+P    + DL  L +  G +       D K  P  G   ++Y+  + A +C+  L 
Sbjct: 301 YCSNLPFSTAKSDLFDLFETIGKLKNAELKFDQKGNP-TGVAIVEYENVDDAQVCVDRLN 359

Query: 416 NFPFQGRNLRTGWGKEK 432
           N+ + G +L   +GK +
Sbjct: 360 NYNYGGCDLDISYGKRE 376

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 90  GGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHD 149
           GG EK+ +++Y  NLP S     L   F+  G + + ++  D+       A VEY    D
Sbjct: 292 GGGEKN-ELIYCSNLPFSTAKSDLFDLFETIGKLKNAELKFDQKGNPTGVAIVEYENVDD 350

Query: 150 ANVAYQTLNGKEVEGKVLKINWA 172
           A V    LN     G  L I++ 
Sbjct: 351 AQVCVDRLNNYNYGGCDLDISYG 373

>KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.167
           YNL110C
          Length = 220

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           ++V  L     +  L+  F +F    +A +  + +SG SR YGFV F  ++ A+VA ET 
Sbjct: 93  IYVSRLPNGFHEKELSKYFSQFGDLKEARLARNKKSGNSRHYGFVEFANKEDAKVAQETM 152

Query: 246 QGFELNGRALRINWASK 262
             + L G  LR+    K
Sbjct: 153 DNYLLMGHLLRVRLMGK 169

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQT 156
           I+YV  LP    +  L +YF   G +   ++  +K S    +Y FVE+    DA VA +T
Sbjct: 92  IIYVSRLPNGFHEKELSKYFSQFGDLKEARLARNKKSGNSRHYGFVEFANKEDAKVAQET 151

Query: 157 LNGKEVEGKVLKI 169
           ++   + G +L++
Sbjct: 152 MDNYLLMGHLLRV 164

>KLTH0A04554g Chr1 (380152..380988) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q00916 Saccharomyces cerevisiae
           YIL061C SNP1 U1snRNP 70K protein homolog
          Length = 278

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (46%), Gaps = 8/109 (7%)

Query: 158 NGKEVEGKVLKINWAFQSQQ-----VNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQ 212
           N ++VE K L    A  +        +SD    +FVG L   V +  L   F  F    +
Sbjct: 71  NARQVEAKALNAKLAIWNPDEDPNIADSDPYRTIFVGRLPFAVTEVELQKEFVRFGEIEK 130

Query: 213 AHVMWDMQSGRSRGYGFVSFGEQDQAQVA---METKQGFELNGRALRIN 258
             V+ D  S +SRGYGF+ F ++  A+ A   +   +G ++ GR + ++
Sbjct: 131 VRVVRDKTSNKSRGYGFIMFKDEISARSACREIGVHRGVQIGGRPVIVD 179

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 43/83 (51%), Gaps = 7/83 (8%)

Query: 354 APPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCI-- 411
           AP R  T Y+GNIP F     L+  +++ G I + K  P++ C FI +   E +AL    
Sbjct: 158 APSR--TVYLGNIPPFLPAKQLLDHVRS-GVIEELKILPDRMCAFISF-VDESSALLFHS 213

Query: 412 -VALTNFPFQGRNLRTGWGKEKP 433
              L     +GR+++ GWGK  P
Sbjct: 214 DAILKRLNIEGRDIKVGWGKPTP 236

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 84/187 (44%), Gaps = 32/187 (17%)

Query: 96  DKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN--VA 153
           ++ +Y+GNLPK +  + +    + GG + SVK++ D+     +  FV + +P  A    A
Sbjct: 400 NRTVYLGNLPKDVKIEEICNAVR-GGLLQSVKLLSDR-----HVCFVTFIDPTAAAQFYA 453

Query: 154 YQTLNGKEVEGKVLKINWAFQS--------QQVNSDETFNLFVGDLNVDVDDAT------ 199
             +L+G  +  K  KI W   S          V+   + N++VG+++ +  D T      
Sbjct: 454 MSSLHGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAIDETGETIFT 513

Query: 200 ---LAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALR 256
              L  TF+EF    Q + + +      +   F++F     A +A++ K       + L+
Sbjct: 514 EQNLRETFQEFGEVEQINFLHE------KNCCFINFTNISNAILAID-KIKCNPYFKNLK 566

Query: 257 INWASKR 263
           +N+   R
Sbjct: 567 VNFGKDR 573

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 14/82 (17%)

Query: 362 YIGNIPHFA---------QEHDLIPLLQNFGFI--IDFKHYPEKGCCFIKYDTHEQAALC 410
           Y+GNI   A          E +L    Q FG +  I+F H  EK CCFI +     A L 
Sbjct: 495 YVGNIDFNAIDETGETIFTEQNLRETFQEFGEVEQINFLH--EKNCCFINFTNISNAILA 552

Query: 411 IVALTNFPFQGRNLRTGWGKEK 432
           I  +   P+  +NL+  +GK++
Sbjct: 553 IDKIKCNPY-FKNLKVNFGKDR 573

>CAGL0L03806g Chr12 (440385..441152) [768 bp, 255 aa] {ON} similar
           to uniprot|P53927 Saccharomyces cerevisiae YNL110c
          Length = 255

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQEC-NYAFVEYFEPHDANVAYQT 156
           I+YVG LPK   +  L +YF   G +  V++  +K +    +Y FV++    D+ VAY T
Sbjct: 126 IIYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAYDT 185

Query: 157 LNGKEVEGKVLKIN 170
           +N   + G +L++ 
Sbjct: 186 MNNYLLMGHLLQVR 199

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 50/106 (47%), Gaps = 2/106 (1%)

Query: 179 NSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQA 238
           +SD +  ++VG L     +  L+  F +F    +  +  + ++G SR YGFV F   D +
Sbjct: 120 DSDISGIIYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDS 179

Query: 239 QVAMETKQGFELNGRALRINWASK--REPQQSQQGQRRFNGPASGR 282
           +VA +T   + L G  L++    K  +  +  +  QR F  P   +
Sbjct: 180 RVAYDTMNNYLLMGHLLQVRLLPKGSKIEKLYKYKQRAFMSPPKAK 225

>Smik_16.57 Chr16 (103313..105661) [2349 bp, 782 aa] {ON} YGR250C
           (REAL)
          Length = 782

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 90/220 (40%), Gaps = 58/220 (26%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQTL 157
           ++VG + KS+    L   F   G+I S+K+I D+   E N Y F+ Y     A++  + L
Sbjct: 196 IFVGGIAKSLSIGELSFLFSKYGTILSMKLIYDRTKGEPNGYGFISYPLGSQASLCIKEL 255

Query: 158 NGKEVEGKVLKINWAFQSQQV-----------NSDETFN-LFVGDLNVDVDDA--TLAG- 202
           NG+ V G  L IN+  + ++            N+D+ F  LF+G+L  +  D   TL   
Sbjct: 256 NGRVVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYNNPDKVETLITP 315

Query: 203 ----------TFKEFPSF--------------------------IQAHVMWDMQSGRS-- 224
                       K+ P F                          I ++ + +  +G +  
Sbjct: 316 KEIIEVIKKELSKKLPDFDIISYYFPKRSNTRSSSSVSFNDEGSIDSNKLSNNTNGPAQD 375

Query: 225 ----RGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
               +GYGF+     +QA   +ET  GF  +G  L +N A
Sbjct: 376 EEMLKGYGFIKLINHEQALAVIETFNGFMWHGHRLVVNKA 415

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           N+FVG +   +    L+  F ++ + +   +++D   G   GYGF+S+    QA + ++ 
Sbjct: 195 NIFVGGIAKSLSIGELSFLFSKYGTILSMKLIYDRTKGEPNGYGFISYPLGSQASLCIKE 254

Query: 245 KQGFELNGRALRINWASKREPQQ 267
             G  +NG  L IN+  +R+ ++
Sbjct: 255 LNGRVVNGSTLFINYHVERKERE 277

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 20/99 (20%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVM-------------------WDMQSGRSR 225
           NL+V  + +   D  L   +K F   I   V+                    D+  G SR
Sbjct: 542 NLYVKHIPLSWTDEDLYDFYKTFGEIISVKVITVGGSKNKYRQQSNDSSSDSDLPVGSSR 601

Query: 226 GYGFVSFGEQDQAQVAMETKQGFELNG-RALRINWASKR 263
           GYGFVSF     A  A+    G++++  + L +++A KR
Sbjct: 602 GYGFVSFESPLDAAKAILNTDGYQVSKEQVLSVSFAQKR 640

>KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2.80
           YNL175C
          Length = 381

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 5/102 (4%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFVG+L+ D  D  L   F+     I+  +     SG+ +G+ FV F  ++ A  A++ K
Sbjct: 225 LFVGNLSFDTTDEVLKKHFQHCGEIIKIRMATFQDSGKCKGFAFVDFKSEEGATNALKDK 284

Query: 246 QGFELNGRALRINWASKREPQQ-----SQQGQRRFNGPASGR 282
               +  R +R+ +   R  +Q       + Q+ F+ PA+ +
Sbjct: 285 TCRRIASRPIRMEYGEDRSKRQVIRKKPMEEQKSFDLPAATK 326

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQ 155
           +IL+VGNL     D++LK++FQ  G I  +++   ++S +C  +AFV++     A  A +
Sbjct: 223 RILFVGNLSFDTTDEVLKKHFQHCGEIIKIRMATFQDSGKCKGFAFVDFKSEEGATNALK 282

Query: 156 TLNGKEVEGKVLKINW 171
               + +  + +++ +
Sbjct: 283 DKTCRRIASRPIRMEY 298

>KLLA0D13420g Chr4 complement(1157491..1157991) [501 bp, 166 aa]
           {ON} similar to uniprot|P40565 YIR005W Saccharomyces
           cerevisiae IST3 Component of the U2 snRNP required for
           the first catalytic step of splicing and for
           spliceosomal assembly
          Length = 166

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 62/111 (55%), Gaps = 3/111 (2%)

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQ 212
           + Q L+ +E+E  +LK   ++  +    D+ +  F G +++++ +A +   F ++   + 
Sbjct: 6   SIQKLSERELECGILKPESSWHHEY--KDQAYINF-GGMHLELTEADILTIFSQYGCPVD 62

Query: 213 AHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
             ++ D  +G+S+G+GF+ + +Q    +A++   G ++ GR +R++ A  R
Sbjct: 63  IKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRVDHAFYR 113

>SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} similar
           to uniprot|P37838 Saccharomyces cerevisiae YPL043W NOP4
           Nucleolar protein essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis contains four RNA recognition motifs (RRMs)
          Length = 697

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFV  +  D +D   A  F +F     + ++ D +  +SRG+GFVSF  +D  + A+   
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEK-QSRGFGFVSFAVEDDTKEALAQA 86

Query: 246 QGFELNGRALRINWASKRE 264
           +  +   R LRI+ A +RE
Sbjct: 87  RKAKFKNRLLRIDIAKRRE 105

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%)

Query: 176 QQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSF 232
           Q+ N  E+F++FV ++  D    +L   F +F     A  + D ++G ++G  FV+F
Sbjct: 290 QKKNKQESFSIFVRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAF 346

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 99  LYVGNLPKSIDDD-LLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           L + N+P S  D  +LK+ F   G++   KI      + C +AFV   +      A +  
Sbjct: 136 LIIRNMPWSCRDAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEG 195

Query: 158 NGKEVEGKVLKINWAFQSQQ 177
              +++G+ + I++A Q  +
Sbjct: 196 KDMKIDGRQVAIDFAIQKNK 215

>CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON}
           similar to uniprot|P53883 Saccharomyces cerevisiae
           YNL175c NOP13
          Length = 380

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 54/113 (47%), Gaps = 3/113 (2%)

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           N K  EG+  K +    S+   S     LFVG+L+ D  D  L   F+     ++  +  
Sbjct: 200 NSKSYEGRPDKTDLVSMSKNPPS---RILFVGNLSFDTTDELLRKHFQHCGEIVKIRMAT 256

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQ 270
              SG+ +G+ FV F  ++ A  A++ K   ++ GR LR+ +   R  +Q ++
Sbjct: 257 FQDSGKCKGFAFVDFKNEEGATNALKDKSCRKIAGRPLRMEFGEDRSKRQVRK 309

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQ 155
           +IL+VGNL     D+LL+++FQ  G I  +++   ++S +C  +AFV++     A  A +
Sbjct: 223 RILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALK 282

Query: 156 TLNGKEVEGKVLKINW 171
             + +++ G+ L++ +
Sbjct: 283 DKSCRKIAGRPLRMEF 298

>KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.491
           YPL043W
          Length = 682

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 46/85 (54%), Gaps = 1/85 (1%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFV  +   V D  L   F  F     A V+ D+   +SRG+GFVSF  ++  + A+   
Sbjct: 19  LFVRAIPFAVTDEQLTEFFANFAPTKHAVVVKDVNK-KSRGFGFVSFASEEDTKEALLKA 77

Query: 246 QGFELNGRALRINWASKREPQQSQQ 270
           +  +LNG+ LR++ A +RE  + ++
Sbjct: 78  RKEKLNGQLLRVDIAKRRERNKRKE 102

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/191 (17%), Positives = 80/191 (41%), Gaps = 30/191 (15%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           L+V  +P ++ D+ L ++F          ++ D N +   + FV +    D   A     
Sbjct: 19  LFVRAIPFAVTDEQLTEFFANFAPTKHAVVVKDVNKKSRGFGFVSFASEEDTKEALLKAR 78

Query: 159 GKEVEGKVLKINWAFQSQQV------------------------NSDETF----NLFVGD 190
            +++ G++L+++ A + ++                         + D+ F     L + +
Sbjct: 79  KEKLNGQLLRVDIAKRRERNKRKEDASNGIAAPKPEHKEKRTYGDEDDQFKGKPKLIIRN 138

Query: 191 LNVDVDDA-TLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFE 249
           +     D  TL   F  F + + AH+    + G+  G+ FV+  +    + A+E  +  +
Sbjct: 139 MPWSCRDPNTLKNIFGRFGTVVDAHIPR-KRDGKLCGFAFVTMNKISNCKNALENTKDLK 197

Query: 250 LNGRALRINWA 260
           ++GR + +++A
Sbjct: 198 IDGRQVAVDFA 208

>NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408
          Length = 377

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 76/204 (37%), Gaps = 43/204 (21%)

Query: 100 YVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLNG 159
           +V NLP SI    LK  F+  G +    +  D N     +  V Y    D   A  + NG
Sbjct: 175 FVVNLPYSITWQNLKDIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNG 234

Query: 160 KEVEGKVLKI---------------------------------------NWAFQSQQVNS 180
            E+EG++L++                                       N +F ++ V+ 
Sbjct: 235 AELEGRILEVREGKFNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSF-TEGVSG 293

Query: 181 DETFN--LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQA 238
           D   N  ++  +L +      L   F        A +++D ++G S G   V +  QD A
Sbjct: 294 DGERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYD-ETGTSTGAAVVEYASQDAA 352

Query: 239 QVAMETKQGFELNGRALRINWASK 262
            V +    G+   GR L I +AS+
Sbjct: 353 DVCINKLNGYNYGGRDLHITYASR 376

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 75/167 (44%), Gaps = 10/167 (5%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +++GNL     ++ L+ +F   G + + +++  +   +     VE+  P DA  A +  N
Sbjct: 80  IFIGNLSFDATEEDLRDFFSQVGEVVNAEVMSYRGRSK-GMGTVEFTNPADAEEAIRQYN 138

Query: 159 GKEVEGKVLKINW----AFQSQQVNSDET----FNLFVGDLNVDVDDATLAGTFKEFPSF 210
           G    G+ + +          Q+  S E     +  FV +L   +    L   F+E    
Sbjct: 139 GVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQQGYEAFVVNLPYSITWQNLKDIFRECGDV 198

Query: 211 IQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRI 257
           I+A V  D  +G SRG+G V +  ++    A+++  G EL GR L +
Sbjct: 199 IRADVELDY-NGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEV 244

 Score = 37.0 bits (84), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 35/82 (42%)

Query: 91  GREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDA 150
           G  + +  +Y  NLP S     L   F   G I+  +++ D+       A VEY     A
Sbjct: 293 GDGERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAA 352

Query: 151 NVAYQTLNGKEVEGKVLKINWA 172
           +V    LNG    G+ L I +A
Sbjct: 353 DVCINKLNGYNYGGRDLHITYA 374

>CAGL0J01914g Chr10 complement(191912..192421) [510 bp, 169 aa] {ON}
           similar to uniprot|P40565 Saccharomyces cerevisiae
           YIR005w IST3
          Length = 169

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 56/106 (52%), Gaps = 3/106 (2%)

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQ 212
           A Q +N KE+E  +LK   ++   Q   D+ + +F+G LN  + +  L   F ++   + 
Sbjct: 6   AIQRINEKELEAGILKPEHSWH--QEYKDQAY-IFIGGLNRQLTEGDLLTIFSQYGVPVD 62

Query: 213 AHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRIN 258
             ++ D ++  S+G+ F+ + +Q    +A++   G  + GR ++++
Sbjct: 63  VLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAGRQIKVD 108

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 99  LYVGNLPKSIDD-DLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQT 156
           +++G L + + + DLL  + Q G  +  V ++ DK + E   +AF++Y +     +A   
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVD-VLLVRDKETHESKGFAFLKYEDQRSTILAVDN 94

Query: 157 LNGKEVEGKVLKINWAF 173
           LNG  V G+ +K++  F
Sbjct: 95  LNGITVAGRQIKVDHIF 111

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 9/88 (10%)

Query: 354 APPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCI-- 411
           AP R  T Y+GN+P +    +L+  +++ G + D K  PEK C FI +   E +AL    
Sbjct: 153 APSR--TVYLGNVPPYITTRELLDHVRS-GVVEDVKILPEKMCAFISF-VDENSALLFHS 208

Query: 412 -VALTNFPFQGRNLRTGWGKEKPTFIRP 438
              L       R+++ GWG  KPT I P
Sbjct: 209 DAILKRLNIDDRDIKIGWG--KPTQIDP 234

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 84/187 (44%), Gaps = 32/187 (17%)

Query: 96  DKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN--VA 153
           ++ +Y+GNLPK +  + +    + GG +  +K++ D+     +  FV + +P  A    A
Sbjct: 394 NRTIYLGNLPKDVKLEEICNSVR-GGLLQHIKLLNDR-----HVCFVTFIDPTAAAQFYA 447

Query: 154 YQTLNGKEVEGKVLKINWAFQS--------QQVNSDETFNLFVGDLNVDVD--------- 196
             +L+G  +  K  KI W   S          V+   + N+++G+++ + D         
Sbjct: 448 MSSLHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFEDDRKLEQPIFT 507

Query: 197 DATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALR 256
           + +L   F+EF    Q + +++      R   F++F     A +A++  +      + L+
Sbjct: 508 ETSLRSVFQEFGEVEQINFLYE------RNCCFINFANISSAILAIDKIKSIP-TFKDLK 560

Query: 257 INWASKR 263
           IN+   R
Sbjct: 561 INFGKDR 567

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 12/81 (14%)

Query: 362 YIGNI----------PHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCI 411
           Y+GNI          P F  E  L  + Q FG +       E+ CCFI +     A L I
Sbjct: 489 YLGNIDFEDDRKLEQPIFT-ETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAI 547

Query: 412 VALTNFPFQGRNLRTGWGKEK 432
             + + P   ++L+  +GK++
Sbjct: 548 DKIKSIP-TFKDLKINFGKDR 567

>TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON}
           Anc_8.797 YOR319W
          Length = 220

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 85/184 (46%), Gaps = 17/184 (9%)

Query: 95  SDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVA 153
           S+K +YVGN+   +  D+L + F     ISS+K   DK  Q    YAF+++F   D    
Sbjct: 10  SNKTVYVGNIDPQVTLDILYELFVQVAPISSIKYPKDKVLQAYQGYAFIDFFTEDDVQYV 69

Query: 154 YQTLNGK-EVEGKVLKI---NWAFQSQQVNSD---ETFN--------LFVGDLNVDVDDA 198
            + +N    + GK+LK+   N+A  +   N+    ET N        +F+ D++      
Sbjct: 70  IKVMNNTVRLYGKLLKVRLSNYALSASTANASNKTETANVEILPVPKVFIKDIDSTTTTE 129

Query: 199 TLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRIN 258
           TL+  FK+    ++    + +  G+ R   ++     D +  A++      +  + ++++
Sbjct: 130 TLSSLFKKIGPVLKEPEFFYLSYGKLRC-AYLYMKNYDDSDKAIKILNNSLVGNKRVKVD 188

Query: 259 WASK 262
           +A K
Sbjct: 189 YAFK 192

>Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {ON}
           YNL175C (REAL)
          Length = 403

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFVG+L+ DV D  L   F+     ++  +     SG+ +G+ F+ F  ++ +  A++ K
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 246 QGFELNGRALRINWASKREPQQSQQ 270
              ++ GR LR+ +   R  +Q ++
Sbjct: 301 SCRKIAGRPLRMEYGEDRSKRQVRK 325

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQ 155
           +IL+VGNL   + DDLL+++FQ  G I  +++   ++S +C  +AF+++     +  A +
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 156 TLNGKEVEGKVLKINW 171
             + +++ G+ L++ +
Sbjct: 299 DKSCRKIAGRPLRMEY 314

>KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} similar
           to uniprot|P37838 Saccharomyces cerevisiae YPL043W NOP4
           Nucleolar protein essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis contains four RNA recognition motifs (RRMs),
          Length = 685

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 50/101 (49%), Gaps = 4/101 (3%)

Query: 173 FQSQQVNSDETFNL---FVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGF 229
              ++V  DE  +L   FV  +  +  D      F +F     A ++ D + G SRG+GF
Sbjct: 1   MSDKKVIKDEGLDLKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGE-GASRGFGF 59

Query: 230 VSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQ 270
           VSF  +D  + A+   +  +  GR LRI+ A +RE  + ++
Sbjct: 60  VSFAVEDDTKTALNQARKTKFMGRLLRIDIAKRRERSRGKK 100

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 39/80 (48%), Gaps = 1/80 (1%)

Query: 99  LYVGNLPKSIDDDL-LKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           L + N+P S  D   LK+ F + G++    I   ++ + C +AFV      +   A +  
Sbjct: 135 LIIRNMPWSCRDPTKLKKIFGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAIEGT 194

Query: 158 NGKEVEGKVLKINWAFQSQQ 177
              +++G+ + +++A Q  +
Sbjct: 195 KDLKIDGRKVAVDFAIQKNR 214

>YNL175C Chr14 complement(307401..308612) [1212 bp, 403 aa] {ON}
           NOP13Nucleolar protein found in preribosomal complexes;
           contains an RNA recognition motif (RRM)
          Length = 403

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFVG+L+ DV D  L   F+     ++  +     SG+ +G+ F+ F  ++ +  A++ K
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 246 QGFELNGRALRINWASKREPQQSQQ 270
              ++ GR LR+ +   R  +Q ++
Sbjct: 301 SCRKIAGRPLRMEYGEDRSKRQVRK 325

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQ 155
           +IL+VGNL   + DDLL+++FQ  G I  +++   ++S +C  +AF+++     +  A +
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 156 TLNGKEVEGKVLKINW 171
             + +++ G+ L++ +
Sbjct: 299 DKSCRKIAGRPLRMEY 314

>Skud_14.159 Chr14 complement(298222..299424) [1203 bp, 400 aa] {ON}
           YNL175C (REAL)
          Length = 400

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFVG+L+ DV D  L   F+     ++  +     SG+ +G+ F+ F  ++ +  A++ K
Sbjct: 238 LFVGNLSFDVTDDLLRKHFQHCGDVVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 297

Query: 246 QGFELNGRALRINWASKREPQQSQQ 270
              ++ GR LR+ +   R  +Q ++
Sbjct: 298 SCRKIAGRPLRMEYGEDRSKRQVRK 322

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQ 155
           +IL+VGNL   + DDLL+++FQ  G +  +++   ++S +C  +AF+++     +  A +
Sbjct: 236 RILFVGNLSFDVTDDLLRKHFQHCGDVVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 295

Query: 156 TLNGKEVEGKVLKINW 171
             + +++ G+ L++ +
Sbjct: 296 DKSCRKIAGRPLRMEY 311

>Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {ON}
           YNL175C (REAL)
          Length = 403

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 45/85 (52%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFVG+L+ DV D  L   F+     I+  +     SG+ +G+ F+ F  ++ +  A++ K
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIIKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 246 QGFELNGRALRINWASKREPQQSQQ 270
              ++ GR LR+ +   R  +Q ++
Sbjct: 301 GCRKIAGRPLRMEYGEDRSKRQVRK 325

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 46/76 (60%), Gaps = 1/76 (1%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQ 155
           +IL+VGNL   + DDLL+++FQ  G I  +++   ++S +C  +AF+++     +  A +
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIIKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 156 TLNGKEVEGKVLKINW 171
               +++ G+ L++ +
Sbjct: 299 DKGCRKIAGRPLRMEY 314

>TPHA0J00920 Chr10 (217471..218400) [930 bp, 309 aa] {ON} Anc_7.250
           YIL061C
          Length = 309

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 49/99 (49%), Gaps = 13/99 (13%)

Query: 178 VNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQS----------GRSRGY 227
           +N+D    +FVG L  D+D+ +L   F ++    +  ++ +             G+SRGY
Sbjct: 106 INTDPYRTIFVGRLPYDIDEISLQKIFIKYGQIEKVRIIRNSHGKKENSNTPTVGKSRGY 165

Query: 228 GFVSFGEQDQAQVAME---TKQGFELNGRALRINWASKR 263
           GF+ F +   +++A +   T +G E+NGR   ++    R
Sbjct: 166 GFIVFEDTYSSKMAFKDIGTHKGIEINGRTCIVDIERGR 204

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 44/88 (50%), Gaps = 14/88 (15%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-----------YAFVEYF 145
           + ++VG LP  ID+  L++ F   G I  V+II + + ++ N           Y F+ + 
Sbjct: 112 RTIFVGRLPYDIDEISLQKIFIKYGQIEKVRIIRNSHGKKENSNTPTVGKSRGYGFIVFE 171

Query: 146 EPHDANVAYQ---TLNGKEVEGKVLKIN 170
           + + + +A++   T  G E+ G+   ++
Sbjct: 172 DTYSSKMAFKDIGTHKGIEINGRTCIVD 199

>Skud_8.67 Chr8 (116061..118019) [1959 bp, 652 aa] {ON} YHR015W
           (REAL)
          Length = 652

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVA 241
           LF+G L   V +  L  TFK++ SF  A +  D  + +S GYG+++FG +  A+ A
Sbjct: 113 LFIGKLKSTVTEEMLRKTFKKYQSFESAKICRDFLTKKSLGYGYLNFGNKKDAEAA 168

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 83/187 (44%), Gaps = 32/187 (17%)

Query: 96  DKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN--VA 153
           ++ +Y+GNLPK +  + +    + GG +  +K++ D+     +  FV + +P  A    A
Sbjct: 341 NRTIYLGNLPKDVKLEEICNSVR-GGLLQHIKLLSDR-----HVCFVTFIDPTAAAQFYA 394

Query: 154 YQTLNGKEVEGKVLKINWAFQS--------QQVNSDETFNLFVGDLNVDVD--------- 196
             +L+G  +  K  KI W   S          V+   + N+++G+++   D         
Sbjct: 395 MSSLHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFAADKKSQHPIFT 454

Query: 197 DATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALR 256
           +A L   F+EF    Q + +++      R   F++F     A +A++  +      + L+
Sbjct: 455 EAALRAVFQEFGEVEQINFLYE------RNCCFINFANISSAILAIDKIKSIP-TFKDLK 507

Query: 257 INWASKR 263
           IN+   R
Sbjct: 508 INFGKDR 514

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 9/93 (9%)

Query: 354 APPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCI-- 411
           AP R  T Y+GN+P +    +L+  +++ G + + K  PEK C FI +   E +AL    
Sbjct: 100 APSR--TVYLGNVPPYITTKELLDHVRS-GVVEEVKILPEKMCAFISF-VEENSALLFHS 155

Query: 412 -VALTNFPFQGRNLRTGWGKEKPTFIRPQQQMG 443
              L       R+++ GWG  KPT I P    G
Sbjct: 156 DAILKRLNIDDRDIKIGWG--KPTQIDPIVAAG 186

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 35/80 (43%), Gaps = 10/80 (12%)

Query: 362 YIGNIPHFAQ---------EHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIV 412
           Y+GNI   A          E  L  + Q FG +       E+ CCFI +     A L I 
Sbjct: 436 YLGNIDFAADKKSQHPIFTEAALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAID 495

Query: 413 ALTNFPFQGRNLRTGWGKEK 432
            + + P   ++L+  +GK++
Sbjct: 496 KIKSIP-TFKDLKINFGKDR 514

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 379 LQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNF-PFQGRNLRTGWGKEKPTFIR 437
           L +FG + + K  PEKG  F+ + +   A   +  L N  P+  +  +  +GK++  FI 
Sbjct: 229 LSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANLANINPYYAQK-KIFYGKDRCAFIT 287

Query: 438 PQQQ 441
             QQ
Sbjct: 288 KTQQ 291

>Smik_9.204 Chr9 (340893..341342) [450 bp, 149 aa] {ON} YIR005W
           (REAL)
          Length = 149

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 63/116 (54%), Gaps = 4/116 (3%)

Query: 155 QTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAH 214
           Q +N  E++  +L  + ++ ++    D  + +++G+LN ++ +  +   F E+   +   
Sbjct: 5   QKINDAELQSGILSPHHSWHNEY--KDNAY-IYIGNLNRELTEGDILTVFSEYGVPVDII 61

Query: 215 VMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQ 270
           +  D  +G S+GY ++ + +Q    +A++   G+++  RAL+++    R P++S Q
Sbjct: 62  ISRDENTGESQGYAYLKYEDQRSTILAVDNLNGYKIGERALKVDHTFYR-PKKSLQ 116

 Score = 34.7 bits (78), Expect = 0.20,   Method: Composition-based stats.
 Identities = 23/103 (22%), Positives = 49/103 (47%), Gaps = 1/103 (0%)

Query: 94  KSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANV 152
           K +  +Y+GNL + + +  +   F   G    + I  D+N+ E   YA+++Y +     +
Sbjct: 28  KDNAYIYIGNLNRELTEGDILTVFSEYGVPVDIIISRDENTGESQGYAYLKYEDQRSTIL 87

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDV 195
           A   LNG ++  + LK++  F   + +  + +     +L  D+
Sbjct: 88  AVDNLNGYKIGERALKVDHTFYRPKKSLQKYYEAVKKELERDI 130

>ABL134C Chr2 complement(140623..141750) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL175C
           (NOP13)
          Length = 375

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQ 155
           +IL+VGNL     D+LLK++FQ  G I  +++   ++S +C  +AFV++ +   A  A  
Sbjct: 216 RILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALT 275

Query: 156 TLNGKEVEGKVLKINW 171
             + + + G+ L++ +
Sbjct: 276 DRSCRAIAGRPLRMEY 291

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFVG+L+ D  D  L   F+     ++  +     SG+ +G+ FV F ++  A  A+  +
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDR 277

Query: 246 QGFELNGRALRINWASKR 263
               + GR LR+ +   R
Sbjct: 278 SCRAIAGRPLRMEYGEDR 295

>AFL224W Chr6 (18862..19482) [621 bp, 206 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL110C (NOP15)
          Length = 206

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 89  QGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQEC-NYAFVEYFEP 147
           Q  R     I+Y+  LP    +  L  YF   G +  V++  +K +    +YAF+E+  P
Sbjct: 70  QAARTDLSGIIYISRLPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFANP 129

Query: 148 HDANVAYQTLNGKEVEGKVLKIN 170
            DA VA +T++   + G +L+++
Sbjct: 130 DDAVVAQETMHNYLLMGHLLQVS 152

>Skud_7.240 Chr7 complement(418142..419098) [957 bp, 318 aa] {ON}
           YGL044C (REAL)
          Length = 318

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 46/91 (50%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +++G +  D  +  +          I   +M+D Q+GRS+GY F+ F + + +  A+   
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 246 QGFELNGRALRINWASKREPQQSQQGQRRFN 276
            G++L  R L+  ++S  +     Q Q+++N
Sbjct: 80  NGYQLGSRFLKCGYSSNSDISGVSQQQQQYN 110

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 8/81 (9%)

Query: 355 PPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHY--PE----KGCCFIKYDTHEQAA 408
           P RV   Y+G+IP+   E  ++ L  N G +I+ K    P+    KG  FI++   E +A
Sbjct: 16  PSRVV--YLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSA 73

Query: 409 LCIVALTNFPFQGRNLRTGWG 429
             +  L  +    R L+ G+ 
Sbjct: 74  SAVRNLNGYQLGSRFLKCGYS 94

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/80 (21%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 97  KILYVGNLP-KSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQ 155
           +++Y+G++P    ++ +L     +G  I+   +   +  +   YAF+E+ +   +  A +
Sbjct: 18  RVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVR 77

Query: 156 TLNGKEVEGKVLKINWAFQS 175
            LNG ++  + LK  ++  S
Sbjct: 78  NLNGYQLGSRFLKCGYSSNS 97

>NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {ON} 
          Length = 474

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 69/163 (42%), Gaps = 21/163 (12%)

Query: 118 QIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLNGKEVEG------------- 164
           ++  S+ S+K       ++ NY  VE+    +A  A  TLNG  +               
Sbjct: 84  KVAASVDSIK----SEHKQANYCLVEFESQQEAAEAL-TLNGLPLPNFFSRSRNSVINAS 138

Query: 165 --KVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKE-FPSFIQAHVMWDMQS 221
              V ++NWA           + LFVG+L+    +A L   F+  + S     +M +   
Sbjct: 139 QLSVFRLNWAVWPTVNGLSPEYPLFVGNLSSITREADLLLLFRSRYKSVKTVRMMTEPIP 198

Query: 222 GRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKRE 264
           G+S  +GF+ F   ++ ++A E   G     + +++  A+ R+
Sbjct: 199 GKSDSFGFICFANCEERRLAAEEMNGICFQDKYIKVAIANPRD 241

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 6/74 (8%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           +FVG L+ DV +  L   F+ F       +M D++    +  GFV+F  +  A+ A++  
Sbjct: 310 IFVGGLSTDVSEQELNELFRPF-----GEIM-DVKIPLGKKCGFVTFKRRIDAKAAIKGL 363

Query: 246 QGFELNGRALRINW 259
            GF + G  +R++W
Sbjct: 364 HGFLVRGCPIRLSW 377

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%)

Query: 359 TTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNFP 418
           +T ++G +     E +L  L + FG I+D K    K C F+ +     A   I  L  F 
Sbjct: 308 STIFVGGLSTDVSEQELNELFRPFGEIMDVKIPLGKKCGFVTFKRRIDAKAAIKGLHGFL 367

Query: 419 FQGRNLRTGWGK 430
            +G  +R  WGK
Sbjct: 368 VRGCPIRLSWGK 379

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

Query: 91  GREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDA 150
           G    +  ++VG L   + +  L + F+  G I  VKI   K   +C   FV +    DA
Sbjct: 302 GSNSKNSTIFVGGLSTDVSEQELNELFRPFGEIMDVKIPLGK---KC--GFVTFKRRIDA 356

Query: 151 NVAYQTLNGKEVEGKVLKINW 171
             A + L+G  V G  ++++W
Sbjct: 357 KAAIKGLHGFLVRGCPIRLSW 377

>NDAI0A02810 Chr1 complement(633738..634247) [510 bp, 169 aa] {ON}
           Anc_7.159 YIR005W
          Length = 169

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 57/106 (53%), Gaps = 3/106 (2%)

Query: 153 AYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQ 212
           + Q +N KE++  +L    ++  +    D+ + +++G L  D+ +A +   F +F   + 
Sbjct: 6   SIQRINQKELDVGILSEEQSWHHEY--KDQAY-IYIGGLPRDLTEADILTVFSQFGIPVD 62

Query: 213 AHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRIN 258
             ++ D QSG S+G+ ++ + +Q    +A++   G +LNG  + ++
Sbjct: 63  IFLVRDHQSGESKGFAYLKYEDQRSTILAVDNLNGTKLNGNTIHVD 108

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 16/76 (21%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 99  LYVGNLPKSIDD-DLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTL 157
           +Y+G LP+ + + D+L  + Q G  +    +   ++ +   +A+++Y +     +A   L
Sbjct: 36  IYIGGLPRDLTEADILTVFSQFGIPVDIFLVRDHQSGESKGFAYLKYEDQRSTILAVDNL 95

Query: 158 NGKEVEGKVLKINWAF 173
           NG ++ G  + ++  F
Sbjct: 96  NGTKLNGNTIHVDHTF 111

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 87/188 (46%), Gaps = 34/188 (18%)

Query: 96  DKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN--VA 153
           ++ +Y+GNLPK++  + +    + GG + ++K++ D+     +  FV + +P  A    A
Sbjct: 471 NRTVYLGNLPKNVKLEEICNAIR-GGLLQNIKLLNDR-----HVCFVTFIDPTAAAQFYA 524

Query: 154 YQTLNGKEVEGKVLKINWAFQS--------QQVNSDETFNLFVGDLNVDVD--------- 196
             +L+G  +  K  KI W   S          V+   + N+++G++N + D         
Sbjct: 525 MSSLHGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLGNINFEEDAKQEESVFA 584

Query: 197 DATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAME-TKQGFELNGRAL 255
           + TL   F+EF +  Q + +++      +   F++F     A +A++  K     N   L
Sbjct: 585 EDTLRAIFEEFGTVEQINFLYE------KNCCFINFANISNAILAIDKIKSNPHFNN--L 636

Query: 256 RINWASKR 263
           +IN+   R
Sbjct: 637 KINFGKDR 644

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 5/82 (6%)

Query: 354 APPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAL--CI 411
           AP R  T Y+GNIP       L+  ++  G + + K   EK C F+ +     A L    
Sbjct: 230 APSR--TVYLGNIPATITYKALLDYVRT-GVVEEVKILSEKMCAFVSFVDENDALLFHSD 286

Query: 412 VALTNFPFQGRNLRTGWGKEKP 433
             L      GR+++ GWGK +P
Sbjct: 287 AILKRLNIDGRDIKIGWGKPQP 308

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 66/155 (42%), Gaps = 25/155 (16%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQ- 155
           + +Y+GN+P +I    L  Y +  G +  VKI+ +K    C  AFV + + +DA + +  
Sbjct: 233 RTVYLGNIPATITYKALLDYVRT-GVVEEVKILSEK---MC--AFVSFVDENDALLFHSD 286

Query: 156 -TLNGKEVEGKVLKINWA--------FQSQQVNSDETFNLFVGDLNVDVDDA-------- 198
             L    ++G+ +KI W          ++   N   T N+++G LN + D          
Sbjct: 287 AILKRLNIDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIGKLNTNKDSCEKWGADPK 346

Query: 199 -TLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSF 232
             L    K +    Q   +  ++    RG  FV F
Sbjct: 347 EILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHF 381

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 1/61 (1%)

Query: 372 EHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNFPFQGRNLRTGWGKE 431
           E  L  + + FG +       EK CCFI +     A L I  + + P    NL+  +GK+
Sbjct: 585 EDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIKSNP-HFNNLKINFGKD 643

Query: 432 K 432
           +
Sbjct: 644 R 644

>TDEL0F01220 Chr6 complement(216951..217589) [639 bp, 212 aa] {ON}
           Anc_2.167 YNL110C
          Length = 212

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDK-NSQECNYAFVEYFEPHDANVAYQT 156
           I+YV  LP    +  L +YF   G +  V++  +K N    +Y F+E+    DA VA++T
Sbjct: 84  IIYVSRLPHGFHERELSKYFSQFGDLKEVRLARNKKNGNSRHYGFIEFANKDDAKVAHET 143

Query: 157 LNGKEVEGKVLKI 169
           +N   + G +L++
Sbjct: 144 MNNYLIMGHLLQV 156

>KLLA0E11045g Chr5 (968674..969972) [1299 bp, 432 aa] {ON} similar
           to uniprot|P49960 Saccharomyces cerevisiae YMR268C PRP24
           Splicing factor that reanneals U4 and U6 snRNPs during
           spliceosome recycling
          Length = 432

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 80/190 (42%), Gaps = 14/190 (7%)

Query: 95  SDKILYVGNLPKSID----DDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDA 150
           +D  ++V N P   D     +LL QY  I   I S+++     +    +A+V+   P  A
Sbjct: 111 TDSTIWVTNFPPGYDASKLRNLLSQY--IDSPILSIRLPSLAFNSRRRFAYVDLVSPEVA 168

Query: 151 NVAYQTLNGKEVE-----GKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFK 205
             A   LNG E+       K+  +N   +       +   + V +L  D+    L   F 
Sbjct: 169 KKATNRLNGIEINNYKLVAKISNVNERTERTDNAISDGREIIVKNLPDDITIDDLIKMFN 228

Query: 206 EFPSFIQAHVMW--DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263
           EF    +A ++   +   GR   Y F++F  +  A  A+    G  +NG+ L ++   ++
Sbjct: 229 EFGDTEKARIVTGDETNPGRHSRYAFITFKNKASADNALSL-NGAVMNGKPLHVSKVMRK 287

Query: 264 EPQQSQQGQR 273
              + Q+ +R
Sbjct: 288 AYLERQEVKR 297

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 42/83 (50%), Gaps = 7/83 (8%)

Query: 354 APPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCI-- 411
           AP R  T Y+GNIP      DL+  +++ G I + K  PEK C FI +   E ++L    
Sbjct: 165 APSR--TVYLGNIPPTLTASDLLDHVRS-GVIEEVKILPEKMCAFISF-LDENSSLLFHS 220

Query: 412 -VALTNFPFQGRNLRTGWGKEKP 433
              L      G++++ GWGK  P
Sbjct: 221 DAILKRLNIDGKDIKIGWGKPSP 243

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 3/81 (3%)

Query: 360 TAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAA--LCIVALTNF 417
           T Y+GN+P+  +  D+   ++  G + + K   ++  CF+ +     AA    + ++  F
Sbjct: 416 TVYLGNLPNDIRIEDICNTIR-CGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSIYGF 474

Query: 418 PFQGRNLRTGWGKEKPTFIRP 438
             Q +  + GWGK       P
Sbjct: 475 VLQKKRCKVGWGKHSGPLSNP 495

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 83/193 (43%), Gaps = 32/193 (16%)

Query: 90  GGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHD 149
           G     ++ +Y+GNLP  I  + +    +  G + ++K++ D+     +  FV + +P  
Sbjct: 408 GSNNLGNRTVYLGNLPNDIRIEDICNTIRC-GLLQNIKLLSDR-----HVCFVTFIDPVS 461

Query: 150 AN--VAYQTLNGKEVEGKVLKINWAFQSQQVNSDETF--------NLFVGDLNVDVD--- 196
           A    A  ++ G  ++ K  K+ W   S  +++  T         N+++G+++   D   
Sbjct: 462 AAQFYAMSSIYGFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNIDFTADGTK 521

Query: 197 ------DATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFEL 250
                 D+ L   F E+    Q + ++      S+   FV++   + A  A++  +    
Sbjct: 522 RERYFTDSNLRRIFSEYGEVEQINFLY------SKNCCFVNYTNINNAISAIDKIKN-NP 574

Query: 251 NGRALRINWASKR 263
             + L+IN+   R
Sbjct: 575 TFKNLKINFGKDR 587

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 33/81 (40%), Gaps = 10/81 (12%)

Query: 361 AYIGNIPHFAQ---------EHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCI 411
            YIGNI   A          + +L  +   +G +        K CCF+ Y     A   I
Sbjct: 508 VYIGNIDFTADGTKRERYFTDSNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAI 567

Query: 412 VALTNFPFQGRNLRTGWGKEK 432
             + N P   +NL+  +GK++
Sbjct: 568 DKIKNNP-TFKNLKINFGKDR 587

>NDAI0G00180 Chr7 complement(23120..24514) [1395 bp, 464 aa] {ON}
           Anc_1.408 YCL011C
          Length = 464

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 184 FNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAME 243
           + +F+ +L   ++   L   FKEF   ++A +  D + GRSRG+G V   E+   + A+ 
Sbjct: 229 YKVFIANLPFSINWQALKDMFKEFGDVLRADIELDSR-GRSRGFGTVILREKSAMEKAIA 287

Query: 244 TKQGFELNGRALRIN--WASKREPQQSQQG 271
           T  G E+ GR + +   ++++++P   + G
Sbjct: 288 TLNGTEMEGRRIDVKEGYSNRQDPSDYKYG 317

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 6/100 (6%)

Query: 82  AAPVLATQG------GREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQ 135
           A P+L          G  + + ++Y  NLP S     L   F+  G IS+ ++  +   +
Sbjct: 365 APPILKNSTFTENVTGSGERNHLIYCNNLPASTARSDLYDLFESIGRISNAELKYNDKGE 424

Query: 136 ECNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQS 175
             + A VEY    DA+V  + LNG    G  L+I++  +S
Sbjct: 425 PTSEAVVEYINLEDADVCIERLNGYNYGGCELQISYGKRS 464

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 45/96 (46%), Gaps = 1/96 (1%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           +++ NLP SI+   LK  F+  G +    I  D   +   +  V   E      A  TLN
Sbjct: 231 VFIANLPFSINWQALKDMFKEFGDVLRADIELDSRGRSRGFGTVILREKSAMEKAIATLN 290

Query: 159 GKEVEGKVLKINWAFQSQQVNSDETF-NLFVGDLNV 193
           G E+EG+ + +   + ++Q  SD  + N +  D+N 
Sbjct: 291 GTEMEGRRIDVKEGYSNRQDPSDYKYGNDYRNDINT 326

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 362 YIGNIPHFAQEHDLIPLLQNFGFIIDFK-HYPEKGC----CFIKYDTHEQAALCIVALTN 416
           Y  N+P      DL  L ++ G I + +  Y +KG       ++Y   E A +CI  L  
Sbjct: 389 YCNNLPASTARSDLYDLFESIGRISNAELKYNDKGEPTSEAVVEYINLEDADVCIERLNG 448

Query: 417 FPFQGRNLRTGWGK 430
           + + G  L+  +GK
Sbjct: 449 YNYGGCELQISYGK 462

>Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON}
           (12746..13900) [1155 nt, 385 aa]
          Length = 384

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFVG+L+ D  D  L   F+     I+  +     +G+ +G+ FV F  ++ A  A+  K
Sbjct: 224 LFVGNLSFDTTDDLLRKHFQHCGEIIKIRMATFQDTGKCKGFAFVDFKNEEGATKALTDK 283

Query: 246 QGFELNGRALRINWASKREPQQSQQ 270
              ++ GR LR+ +   R  +Q ++
Sbjct: 284 SCRKIAGRPLRMEFGEDRSKRQVKR 308

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQ 155
           +IL+VGNL     DDLL+++FQ  G I  +++   +++ +C  +AFV++     A  A  
Sbjct: 222 RILFVGNLSFDTTDDLLRKHFQHCGEIIKIRMATFQDTGKCKGFAFVDFKNEEGATKALT 281

Query: 156 TLNGKEVEGKVLKINW 171
             + +++ G+ L++ +
Sbjct: 282 DKSCRKIAGRPLRMEF 297

>AFR649W Chr6 (1619582..1620514) [933 bp, 310 aa] {ON} NOHBY659; No
           homolog in Saccharomyces cerevisiae
          Length = 310

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFV  LN     A LA  F +F       ++ D  SGRS GYGFV F  +   ++A    
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 246 QGFELNGRALRINWA 260
            G  ++ R + ++++
Sbjct: 292 DGALIDDRRVHVDFS 306

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 47/86 (54%), Gaps = 3/86 (3%)

Query: 89  QGGREKSDKILYVGNL-PKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFE 146
           + G   ++ +L+V  L P +   DL   + Q G  ++SV+II D++S +   Y FVE+  
Sbjct: 222 RAGIAPAENVLFVCKLNPLTRAADLATVFAQFG-HVNSVEIIRDRDSGRSLGYGFVEFAT 280

Query: 147 PHDANVAYQTLNGKEVEGKVLKINWA 172
                +AY  ++G  ++ + + ++++
Sbjct: 281 KAACELAYTKMDGALIDDRRVHVDFS 306

>TPHA0B02950 Chr2 complement(672465..673121) [657 bp, 218 aa] {ON}
           Anc_2.167 YNL110C
          Length = 218

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQEC-NYAFVEYFEPHDANVAYQT 156
           I+Y+  LPK   +  L +YF   G +  VK+  +K +    +Y F+E+    DA +A ++
Sbjct: 90  IIYISRLPKGFHERQLSKYFSQFGDLKQVKLARNKKTGNSRHYGFIEFVNKDDAKIAQES 149

Query: 157 LNGKEVEGKVLKI 169
           +N   V G +LK+
Sbjct: 150 MNNYLVLGHLLKV 162

>KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.357
           YHR015W
          Length = 365

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 51/101 (50%)

Query: 175 SQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGE 234
           + ++ SD   +LF+G+L+ +V +  L G F  +P FI A + ++  + +S G+G+++F  
Sbjct: 83  TNKLASDSMESLFIGNLHKNVTEELLRGVFGVYPGFISAKICYNAITKKSLGHGYLNFSN 142

Query: 235 QDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRRF 275
           +  A  A +      +    +R+  + +    + Q G   F
Sbjct: 143 KIDAIRATKDLNYCNILSSEIRLMPSMRNAAYRKQIGTNVF 183

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 35/182 (19%), Positives = 78/182 (42%), Gaps = 4/182 (2%)

Query: 86  LATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE-CNYAFVEY 144
           +AT      S + L++GNL K++ ++LL+  F +     S KI  +  +++   + ++ +
Sbjct: 81  MATNKLASDSMESLFIGNLHKNVTEELLRGVFGVYPGFISAKICYNAITKKSLGHGYLNF 140

Query: 145 FEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF 204
               DA  A + LN   +    +++  + ++         N+F+ +L +D+   T    +
Sbjct: 141 SNKIDAIRATKDLNYCNILSSEIRLMPSMRNAAYRKQIGTNVFMSNLPLDIPFLTTRFFY 200

Query: 205 KEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKRE 264
             F  F +   +   +    +G GF+ F     A   +    G  L G+ +  +    +E
Sbjct: 201 VYFSGFGE---VLSCKLVEEKGIGFIYFESNTVANYVVNLFNGSLLYGKQVFCSIHKSKE 257

Query: 265 PQ 266
            +
Sbjct: 258 ER 259

>ADR189W Chr4 (1034091..1034900) [810 bp, 269 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR429C (TIF35)
          Length = 269

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 1/89 (1%)

Query: 177 QVNSDETFNLFVGDLNVDVDDATLA-GTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQ 235
           Q   D+   L +  LN + D+ T+       FP+  +  V+ + ++GRSRG  +V+F  +
Sbjct: 181 QRERDDAMTLKIMQLNENADEMTIKQKLLSPFPNVPRVAVVRNKETGRSRGIAYVTFASE 240

Query: 236 DQAQVAMETKQGFELNGRALRINWASKRE 264
             A+ A+    G       L+++W+  ++
Sbjct: 241 KDAETALRLLHGRGFMNLILQVDWSKPKK 269

>TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5.76
           YGR250C
          Length = 939

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 48/106 (45%)

Query: 162 VEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQS 221
           +E + L   W+    +       NL++  +  D+    L   F  F   +   ++ D+ +
Sbjct: 207 IESENLVQRWSISINKHALTHPGNLYIRGIPKDLTIDDLKPIFDTFGKVLSLKIICDLIT 266

Query: 222 GRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQ 267
           G S GYGF+SF    +A   +    G  +NG  L IN+  +R+ ++
Sbjct: 267 GESLGYGFISFKLGSEASNCINKLNGTAMNGSTLFINYHVERKERE 312

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 47/107 (43%), Gaps = 6/107 (5%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE-CNYAFVEYFEPHDANVAYQTL 157
           LY+  +PK +  D LK  F   G + S+KII D  + E   Y F+ +    +A+     L
Sbjct: 231 LYIRGIPKDLTIDDLKPIFDTFGKVLSLKIICDLITGESLGYGFISFKLGSEASNCINKL 290

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTF 204
           NG  + G  L IN+      V   E   +F  +   + DD    G F
Sbjct: 291 NGTAMNGSTLFINY-----HVERKEREKVFWNNFKENNDDNKFKGIF 332

>TPHA0C01740 Chr3 (398136..400229) [2094 bp, 697 aa] {ON} Anc_8.491
           YPL043W
          Length = 697

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/227 (20%), Positives = 94/227 (41%), Gaps = 46/227 (20%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           K L+V ++P    DD    +F     +    I+ D N +   + FV +    D+  A   
Sbjct: 22  KTLFVRSIPLQTTDDEFTDFFSNFAPLKHAVIVKDTNKKSRGFGFVSFASEEDSQEALTK 81

Query: 157 LNGKEVEGKVLKINWAF-------------QSQQV----------------NSDETFN-- 185
               +++  +L++++A              Q++++                + D+ F+  
Sbjct: 82  ARTSKIQNHLLRVDFAKRRDRSKTRTEGSEQTKEIVKKTFKKSATERDDGKDEDKDFDEE 141

Query: 186 --------LFVGDLNVDV-DDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQD 236
                   L + ++     D A L   F  + +  +A +    + G+  G+ FV+F    
Sbjct: 142 SSLKGKPKLIIRNMPWSCRDSAKLKNIFSRYGTVDEATIPRK-RDGKLCGFAFVTFKNLA 200

Query: 237 QAQVAMETKQGFELNGRALRINWASKR---EPQQSQQG--QRRFNGP 278
             +VA+E  +G +++GRA+ +++A ++   E  Q QQ   Q   NGP
Sbjct: 201 NCKVALEKSKGLKIDGRAVAVDFAVQKNRWENIQKQQDTQQEETNGP 247

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 54/108 (50%), Gaps = 6/108 (5%)

Query: 162 VEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQS 221
           VEGK+     A  S+  N  +   LFV  + +   D      F  F     A ++ D  +
Sbjct: 5   VEGKI-----ASPSKIDNEFDLKTLFVRSIPLQTTDDEFTDFFSNFAPLKHAVIVKDT-N 58

Query: 222 GRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ 269
            +SRG+GFVSF  ++ +Q A+   +  ++    LR+++A +R+  +++
Sbjct: 59  KKSRGFGFVSFASEEDSQEALTKARTSKIQNHLLRVDFAKRRDRSKTR 106

>KLLA0F23650g Chr6 (2210563..2211501) [939 bp, 312 aa] {ON} similar
           to uniprot|P53927 Saccharomyces cerevisiae YNL110C NOP15
           Constituent of 66S pre-ribosomal particles involved in
           60S ribosomal subunit biogenesis localizes to both
           nucleolus and cytoplasm
          Length = 312

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQT 156
           ILY+  LP+   +  L +YF   G +  V++  +K +    +YAF+EY    DA VA ++
Sbjct: 184 ILYISRLPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFLEYINKDDAVVAQES 243

Query: 157 LNGKEVEGKVLKI 169
           +N   + G +LK+
Sbjct: 244 MNNYLLMGHLLKV 256

>Kpol_150.1 s150 (1938..2354) [417 bp, 138 aa] {ON} (1938..2354)
           [417 nt, 139 aa]
          Length = 138

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 56/108 (51%), Gaps = 7/108 (6%)

Query: 153 AYQTLNGKEVEGKVLK--INWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSF 210
           A Q +N  E+E  VL   ++W         D+ + +++G LN D+ +  +   F +F   
Sbjct: 6   AIQKINENELENGVLSPSLSW----HDTYKDQAY-IYIGRLNKDLTEGDILTVFSQFGVP 60

Query: 211 IQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRIN 258
           +   ++ + ++G SRG+ ++ + +Q    +A++   G E+ G A+ ++
Sbjct: 61  VDIKLVRENETGSSRGFAYLKYEDQRSTILAVDNLNGAEIAGNAIVVD 108

 Score = 30.8 bits (68), Expect = 3.2,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 37/78 (47%), Gaps = 1/78 (1%)

Query: 94  KSDKILYVGNLPKSIDD-DLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           K    +Y+G L K + + D+L  + Q G  +    +  ++      +A+++Y +     +
Sbjct: 31  KDQAYIYIGRLNKDLTEGDILTVFSQFGVPVDIKLVRENETGSSRGFAYLKYEDQRSTIL 90

Query: 153 AYQTLNGKEVEGKVLKIN 170
           A   LNG E+ G  + ++
Sbjct: 91  AVDNLNGAEIAGNAIVVD 108

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 6/84 (7%)

Query: 354 APPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCI-- 411
           + PR  T Y+GNIP      +L+  +++ G + + K  PEK C F+ +   E AAL    
Sbjct: 159 SAPR-KTVYLGNIPPSLTVRELLDHVRS-GVVEEVKILPEKTCAFLTF-VDESAALLFHS 215

Query: 412 -VALTNFPFQGRNLRTGWGKEKPT 434
              L      GR+++ GWGK  P 
Sbjct: 216 DAILKRLHIDGRDIKIGWGKATPV 239

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 16/116 (13%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQ- 155
           K +Y+GN+P S+    L  + +  G +  VKI+P+K       AF+ + +   A + +  
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVR-SGVVEEVKILPEKTC-----AFLTFVDESAALLFHSD 216

Query: 156 -TLNGKEVEGKVLKINWA-------FQSQQVNSD-ETFNLFVGDLNVDVDDATLAG 202
             L    ++G+ +KI W          +  + SD  T N+++G LN D D A   G
Sbjct: 217 AILKRLHIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVG 272

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 12/82 (14%)

Query: 361 AYIGNI----------PHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALC 410
            YIGNI          P F  ++ L  + Q +G +      PEK C F+ Y     A   
Sbjct: 496 VYIGNIDFYEDSKRQEPIFTADY-LRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISA 554

Query: 411 IVALTNFPFQGRNLRTGWGKEK 432
           I  + + P   +NL+  +GK++
Sbjct: 555 IDKIKSNPL-FKNLKINFGKDR 575

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 22/113 (19%), Positives = 56/113 (49%), Gaps = 16/113 (14%)

Query: 90  GGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHD 149
           G     ++ +Y+GNLPK +  + +    + GG + ++K++ D+     +  FV + +P  
Sbjct: 396 GPNNLGNRTVYLGNLPKDVKIEEICNVVR-GGILQAIKVLSDR-----HVCFVTFIDPIA 449

Query: 150 AN--VAYQTLNGKEVEGKVLKINWAFQ--------SQQVNSDETFNLFVGDLN 192
           A    A  +L+G  ++ +  ++ W           +  V++  + N+++G+++
Sbjct: 450 AAQFYAMSSLHGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNID 502

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 360 TAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAA--LCIVALTNF 417
           T Y+GN+P   +  ++  +++  G +   K   ++  CF+ +     AA    + +L   
Sbjct: 404 TVYLGNLPKDVKIEEICNVVRG-GILQAIKVLSDRHVCFVTFIDPIAAAQFYAMSSLHGI 462

Query: 418 PFQGRNLRTGWGKE 431
             Q R  R GWGK 
Sbjct: 463 TIQKRRCRVGWGKH 476

>Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON}
           similar to Ashbya gossypii AAL018W
          Length = 288

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 39/88 (44%), Gaps = 1/88 (1%)

Query: 184 FNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAME 243
           F +FV +L   ++   L   FKE    I A V  D   G SRG+G V    +D    A++
Sbjct: 60  FEIFVANLPYSINWQALKDMFKECGDVIHADVSVDAD-GYSRGFGTVYVATKDNQLAAIK 118

Query: 244 TKQGFELNGRALRINWASKREPQQSQQG 271
              GFE+ GR L +      E     +G
Sbjct: 119 KWNGFEIEGRVLEVRKGKGSESVSGSRG 146

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 357 RVTTAYIGNIPHFAQEHDLIPLLQNFGFII--DFKHYPE---KGCCFIKYDTHEQAALCI 411
           R    Y  N+P    E DL  L +  G ++    K+  E   KG    +++T E A  CI
Sbjct: 208 RSRIIYCENMPPATVESDLYDLFETIGKVVRASLKYDEEGNSKGVSVCEFETTEDAEECI 267

Query: 412 VALTNFPFQGRNLRTGWGK 430
             L N+ + G +L+  + K
Sbjct: 268 QRLNNYHYGGCDLKISYAK 286

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 5/97 (5%)

Query: 83  APVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFV 142
            P  A  GG E     ++V NLP SI+   LK  F+  G +    +  D +     +  V
Sbjct: 51  TPRRAYYGGFE-----IFVANLPYSINWQALKDMFKECGDVIHADVSVDADGYSRGFGTV 105

Query: 143 EYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVN 179
                 +   A +  NG E+EG+VL++     S+ V+
Sbjct: 106 YVATKDNQLAAIKKWNGFEIEGRVLEVRKGKGSESVS 142

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

Query: 91  GREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDA 150
           G E+S +I+Y  N+P +  +  L   F+  G +    +  D+       +  E+    DA
Sbjct: 205 GGERS-RIIYCENMPPATVESDLYDLFETIGKVVRASLKYDEEGNSKGVSVCEFETTEDA 263

Query: 151 NVAYQTLNGKEVEGKVLKINWA 172
               Q LN     G  LKI++A
Sbjct: 264 EECIQRLNNYHYGGCDLKISYA 285

>SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar to
           uniprot|P53927 Saccharomyces cerevisiae YNL110C NOP15
           Constituent of 66S pre-ribosomal particles involved in
           60S ribosomal subunit biogenesis localizes to both
           nucleolus and cytoplasm
          Length = 221

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 4/86 (4%)

Query: 88  TQGGREKSDK---ILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVE 143
            +GG E + +   I+YV  LP+   +  L +YF   G +  V++  +K +    +YAF+E
Sbjct: 80  VEGGNESNKEQSSIIYVSRLPQGFHERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIE 139

Query: 144 YFEPHDANVAYQTLNGKEVEGKVLKI 169
           +    DA VA  T+N   + G +LK+
Sbjct: 140 FVNKDDALVAQDTMNNYLILGHLLKV 165

>KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 639

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           +LF+GDL+  V +  L   F  F +     +  D ++ +S GYG+++F    +A  A+E 
Sbjct: 95  SLFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEK 154

Query: 245 KQGFELNGRALRI 257
               +L G+ +RI
Sbjct: 155 FSYVKLFGKEVRI 167

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 83/177 (46%), Gaps = 4/177 (2%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE-CNYAFVEYFEPHDANVAYQTL 157
           L++G+L K + + +L   F    +++SVKI  D  +++   Y ++ +    +A+ A +  
Sbjct: 96  LFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEKF 155

Query: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMW 217
           +  ++ GK ++I  + ++     +   N+F  +L ++ + A     F E  SF +   + 
Sbjct: 156 SYVKLFGKEVRIMPSMRNSYFRKNIGTNVFFTNLPLE-NPALTTRVFYE--SFRKYGRVL 212

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQQGQRR 274
             +  R +  GFV F     A+ A++     E  G  +       ++ ++S Q ++R
Sbjct: 213 SCKLDRRKNIGFVYFESDISAKKAIDDFNSREYFGNKIACGLHFDKDIRKSPQFEKR 269

>SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some
           similarities with uniprot|P53316 Saccharomyces
           cerevisiae YGR250C Hypothetical ORF
          Length = 817

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 85/218 (38%), Gaps = 58/218 (26%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQTL 157
           LY+  +PK +  D L   F   G + S+KII   ++ Q   Y F+ +     A +  + L
Sbjct: 199 LYIRGIPKDLTVDDLVPVFSKFGPVLSLKIICHPSTGQSLGYGFISFPLGSQAALCIKEL 258

Query: 158 NGKEVEGKVLKINWAFQSQQV-----------NSDETFN-LFVGDLNVDVDDA-----TL 200
           NG  +    L IN+  + ++            N DE F  +F+G  N+  +DA     T 
Sbjct: 259 NGNLMNSSPLFINYHVERKERERIHWDHVKEDNDDERFRGIFIG--NLPTNDASGELLTP 316

Query: 201 AGTFKEFPSFI-----------------------QAHVMW----DMQSGRS--------- 224
            G   +F   +                       ++H+ +    DM+             
Sbjct: 317 EGVITKFKQELNDGEDGEQKEYEIVSYCFPKRNSKSHIEYKDEDDMRDNVETCESQYEES 376

Query: 225 --RGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWA 260
             RGYGF+ F   DQA  A+E  +  E +G  L +N A
Sbjct: 377 PLRGYGFIKFSTHDQALKAIEKCRELEWSGNKLIVNKA 414

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%)

Query: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
           NL++  +  D+    L   F +F   +   ++    +G+S GYGF+SF    QA + ++ 
Sbjct: 198 NLYIRGIPKDLTVDDLVPVFSKFGPVLSLKIICHPSTGQSLGYGFISFPLGSQAALCIKE 257

Query: 245 KQGFELNGRALRINWASKRE 264
             G  +N   L IN+  +R+
Sbjct: 258 LNGNLMNSSPLFINYHVERK 277

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 6/59 (10%)

Query: 362 YIGNIPHFAQEHDLIPLLQNFGFIIDFK--HYPEKGCC----FIKYDTHEQAALCIVAL 414
           YI  IP      DL+P+   FG ++  K   +P  G      FI +    QAALCI  L
Sbjct: 200 YIRGIPKDLTVDDLVPVFSKFGPVLSLKIICHPSTGQSLGYGFISFPLGSQAALCIKEL 258

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 218 DMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELN-GRALRINWASKREPQQSQQGQR-RF 275
           ++  G S+GYGFV F     A  AM     F+++    L +++A KR    S  G   ++
Sbjct: 630 ELPLGTSKGYGFVCFKNPLDASRAMMATDRFQIDENHTLYVSFAQKRAKSVSNPGSSAQY 689

Query: 276 NGPASGRGGFR 286
           +   S +G F 
Sbjct: 690 SKQHSRKGSFH 700

>NDAI0D04810 Chr4 complement(1135992..1137872) [1881 bp, 626 aa]
           {ON} Anc_4.33 YHL024W
          Length = 626

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 48/89 (53%), Gaps = 6/89 (6%)

Query: 84  PVLATQGGREKSDKILYVGNLPKSIDDDLL----KQYFQIGGSISSVKIIPDKNSQECNY 139
           P + T+  R +    ++V +L  ++ DD L      YF+  G I  VK++ D+ ++   Y
Sbjct: 45  PAMNTKPFRGRPSSCVFVASLTSTLTDDELCVSVTDYFKKFGEIVRVKVLRDQANRP--Y 102

Query: 140 AFVEYFEPHDANVAYQTLNGKEVEGKVLK 168
           AFV+Y    DAN A +T +G  + G+ L+
Sbjct: 103 AFVQYTNDKDANNALKTAHGSLLNGRRLR 131

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 186 LFVGDLNVDVDDATLAGT----FKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVA 241
           +FV  L   + D  L  +    FK+F   ++  V+ D  +   R Y FV +     A  A
Sbjct: 60  VFVASLTSTLTDDELCVSVTDYFKKFGEIVRVKVLRDQAN---RPYAFVQYTNDKDANNA 116

Query: 242 METKQGFELNGRALR 256
           ++T  G  LNGR LR
Sbjct: 117 LKTAHGSLLNGRRLR 131

>YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putative
           RNA-binding protein, interacts with Mex67p, which is a
           component of the nuclear pore involved in nuclear mRNA
           export
          Length = 659

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 37/62 (59%)

Query: 180 SDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQ 239
           + +T +LF+G+L   V +  L   FK + SF  A V  D  + +S GYG+++F +++ A+
Sbjct: 107 TSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAE 166

Query: 240 VA 241
            A
Sbjct: 167 SA 168

>TBLA0C05600 Chr3 complement(1357001..1357648) [648 bp, 215 aa] {ON}
           Anc_2.167 YNL110C
          Length = 215

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           ++V  L     +  L   F +F   I++ +  + +SG SR YGFV F  ++ A++A ET 
Sbjct: 88  IYVSRLPQGFHERELNKYFSQFGDLIESRLARNKKSGNSRHYGFVEFVNKEDAKIAQETM 147

Query: 246 QGFELNGRALRINWASK 262
             + L G  L++   +K
Sbjct: 148 NNYLLMGHLLQVRLLAK 164

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 98  ILYVGNLPKSIDDDLLKQYF-QIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQT 156
           I+YV  LP+   +  L +YF Q G  I S      K+    +Y FVE+    DA +A +T
Sbjct: 87  IIYVSRLPQGFHERELNKYFSQFGDLIESRLARNKKSGNSRHYGFVEFVNKEDAKIAQET 146

Query: 157 LNGKEVEGKVLKI 169
           +N   + G +L++
Sbjct: 147 MNNYLLMGHLLQV 159

>KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326
           bp, 441 aa] {ON} Anc_1.408 YNL004W intron location
           uncertain
          Length = 441

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 184 FNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAME 243
           F +FV +L   V+   L   FK   + ++A V  D   GRSRG+G V F  Q+  + A++
Sbjct: 242 FEIFVANLPFSVNWQALKDMFKPCGNVLRADVELD-HVGRSRGFGTVLFSNQEDMRRAID 300

Query: 244 TKQGFELNGRALRI 257
              G+E+ GR L +
Sbjct: 301 DYNGYEIEGRRLDV 314

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 38/198 (19%), Positives = 74/198 (37%), Gaps = 35/198 (17%)

Query: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158
           ++V NLP S++   LK  F+  G++    +  D   +   +  V +    D   A    N
Sbjct: 244 IFVANLPFSVNWQALKDMFKPCGNVLRADVELDHVGRSRGFGTVLFSNQEDMRRAIDDYN 303

Query: 159 GKEVEGKVLKINWAFQSQQ---------------------------------VNSDETFN 185
           G E+EG+ L +   +++ +                                 ++ DE  N
Sbjct: 304 GYEIEGRRLDVREGYRNSRNGNRNGADETNKDSNETEAQAQSNSTVDFTEGYISGDERNN 363

Query: 186 -LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244
            ++  +L    D + L   F+     I A + +D  + +  G   + +   + A V +E 
Sbjct: 364 FIYCSNLPFSTDRSDLYDLFETIGKVINAELRYD-SANQPTGVAVIEYENIEDADVCIER 422

Query: 245 KQGFELNGRALRINWASK 262
              +   G  L I++A K
Sbjct: 423 LNNYNYGGCDLVISYAKK 440

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 38/80 (47%)

Query: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANV 152
           ++ +  +Y  NLP S D   L   F+  G + + ++  D  +Q    A +EY    DA+V
Sbjct: 359 DERNNFIYCSNLPFSTDRSDLYDLFETIGKVINAELRYDSANQPTGVAVIEYENIEDADV 418

Query: 153 AYQTLNGKEVEGKVLKINWA 172
             + LN     G  L I++A
Sbjct: 419 CIERLNNYNYGGCDLVISYA 438

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 7/77 (9%)

Query: 362 YIGNIPHFAQEHDLIPLLQNFGFII------DFKHYPEKGCCFIKYDTHEQAALCIVALT 415
           Y  N+P      DL  L +  G +I      D  + P  G   I+Y+  E A +CI  L 
Sbjct: 366 YCSNLPFSTDRSDLYDLFETIGKVINAELRYDSANQP-TGVAVIEYENIEDADVCIERLN 424

Query: 416 NFPFQGRNLRTGWGKEK 432
           N+ + G +L   + K++
Sbjct: 425 NYNYGGCDLVISYAKKE 441

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 47/103 (45%), Gaps = 5/103 (4%)

Query: 155 QTLNGKEVEGKVL--KINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQ 212
           +T N K   G  L  +++ +++ ++VN + + ++FVG+L  D     L   F +    ++
Sbjct: 89  RTFNNKGDYGPRLARELDSSYE-EKVNRNYSNSIFVGNLTYDCTPDDLRDFFSQIGEVVR 147

Query: 213 AHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRAL 255
           A ++     G  RG G V F   D    A+    G +   R +
Sbjct: 148 ADII--TSRGHHRGMGTVEFTNNDDVTEAIRQYDGSDFMERQI 188

>Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {ON}
           YNL175C (NOP13) - nucleolar protein [contig 103] FULL
          Length = 393

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 42/82 (51%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFVG+L+ D  D  L   F+     ++  +     +G+ +G+ FV F +++    A++ K
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 246 QGFELNGRALRINWASKREPQQ 267
              ++ GR LR+ +   R  +Q
Sbjct: 297 TCRKIAGRPLRMEFGEDRSKRQ 318

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECN-YAFVEYFEPHDANVAYQ 155
           +IL+VGNL     D+LLK++FQ  G I  +++   +++ +C  +AFV++ +      A +
Sbjct: 235 RILFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALK 294

Query: 156 TLNGKEVEGKVLKINW 171
               +++ G+ L++ +
Sbjct: 295 DKTCRKIAGRPLRMEF 310

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 9/88 (10%)

Query: 354 APPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCI-- 411
           AP R  T Y+GNIP      +L+  +++ G + D K  PEK C FI +   E +AL    
Sbjct: 211 APSR--TVYLGNIPSNLTVKELLDHVRS-GVVEDVKIIPEKLCAFISF-VDESSALLFHS 266

Query: 412 -VALTNFPFQGRNLRTGWGKEKPTFIRP 438
              L      G++++ GWG  KPT + P
Sbjct: 267 DAILKRLNIGGKDIKIGWG--KPTTVDP 292

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 55/114 (48%), Gaps = 17/114 (14%)

Query: 97  KILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQ- 155
           + +Y+GN+P ++    L  + +  G +  VKIIP+K    C  AF+ + +   A + +  
Sbjct: 214 RTVYLGNIPSNLTVKELLDHVR-SGVVEDVKIIPEK---LC--AFISFVDESSALLFHSD 267

Query: 156 -TLNGKEVEGKVLKINWA--------FQSQQVNSDETFNLFVGDLN-VDVDDAT 199
             L    + GK +KI W           ++ +N D T N+F+G LN  D D  T
Sbjct: 268 AILKRLNIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFIGHLNKTDNDSCT 321

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 57/117 (48%), Gaps = 16/117 (13%)

Query: 90  GGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHD 149
           G     ++ +Y+GNLPK I  + +    + GG + SVK++ D+        FV + +P  
Sbjct: 441 GPNNLGNRTVYLGNLPKDIKIEEICNVVR-GGLLQSVKLLSDR-----YVCFVTFIDPTA 494

Query: 150 AN--VAYQTLNGKEVEGKVLKINWAFQS--------QQVNSDETFNLFVGDLNVDVD 196
           A    A  +L+G  ++ K  K+ W   S          V++  + N+++G++N + D
Sbjct: 495 AAQFYAMSSLHGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIGNINFEKD 551

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 10/81 (12%)

Query: 361 AYIGNI---------PHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCI 411
            YIGNI         P    E  L  L + +G +      PEK CCFI +     A L +
Sbjct: 541 VYIGNINFEKDAMRDPRIFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILAL 600

Query: 412 VALTNFPFQGRNLRTGWGKEK 432
             + + P    +L+  +GK++
Sbjct: 601 DKIKSNP-HFEDLKINFGKDR 620

 Score = 37.7 bits (86), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%)

Query: 379 LQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVALTNFPFQGRNLRTGWGKEKPTFIRP 438
           L++FG I   K  PEKG  F+ + +   A  C+  L +      N +  +GK++  FI  
Sbjct: 334 LEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNLRSMNPYYENKKIAYGKDRCAFITK 393

Query: 439 QQQ 441
            QQ
Sbjct: 394 TQQ 396

>ZYRO0F08294g Chr6 complement(670688..672832) [2145 bp, 714 aa] {ON}
           similar to uniprot|P37838 Saccharomyces cerevisiae
           YPL043W NOP4 Nucleolar protein essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis contains four RNA recognition motifs
           (RRMs)
          Length = 714

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245
           LFV  +  +  D  L+  F  F     A ++ D ++ +SRG+GFVSF  +D    A++  
Sbjct: 29  LFVRSIPPNTTDEDLSVFFSNFAPIKHAVLVKD-KNQKSRGFGFVSFAVEDDTMEALKQA 87

Query: 246 QGFELNGRALRINWASKR 263
           +  +LNG  +R++ A +R
Sbjct: 88  RRTKLNGHQVRVDLAKRR 105

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 32/55 (58%)

Query: 178 VNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSF 232
           +N  E +++FV ++  D  + +LA  F++F     A  + D ++G +RG  F++F
Sbjct: 303 LNRTEEYSVFVKNVPYDATEESLAEHFEKFGPVKYALPVIDRETGLARGTAFIAF 357

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 37/210 (17%), Positives = 83/210 (39%), Gaps = 36/210 (17%)

Query: 85  VLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEY 144
           V+A Q G +   K L+V ++P +  D+ L  +F     I    ++ DKN +   + FV +
Sbjct: 16  VVAAQDG-DVDMKTLFVRSIPPNTTDEDLSVFFSNFAPIKHAVLVKDKNQKSRGFGFVSF 74

Query: 145 FEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDE---------------------- 182
               D   A +     ++ G  ++++ A +  +   ++                      
Sbjct: 75  AVEDDTMEALKQARRTKLNGHQVRVDLAKRRHRSGKNDEGAQHQQQAAEVHIARHNEGDH 134

Query: 183 ----TFNLFVGDLNVDV--------DDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFV 230
                  L  G   + +        D   L   F ++   ++A +     +G+ RG+ FV
Sbjct: 135 EDDDEDALLKGKPKIIIRNMPWSCRDPEKLKSIFGKYGLVVEATIPR-KPNGQLRGFAFV 193

Query: 231 SFGEQDQAQVAMETKQGFELNGRALRINWA 260
           +  +    + A+E  +  +++GR + +++A
Sbjct: 194 TMKKISNCKKAIEDSKNLKIDGRPVAVDFA 223

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 44/88 (50%), Gaps = 9/88 (10%)

Query: 354 APPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCI-- 411
           AP R  T Y+GN+P      +L+  +++ G + D K  PEK C FI +   E AAL    
Sbjct: 182 APTR--TVYLGNVPPHLTVKELLDHVRS-GVVEDVKIIPEKMCAFISF-VDESAALLFHS 237

Query: 412 -VALTNFPFQGRNLRTGWGKEKPTFIRP 438
              L       R+++ GWG  KPT I P
Sbjct: 238 DAILKRLNIGDRDIKIGWG--KPTRIDP 263

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 12/82 (14%)

Query: 361 AYIGNIPHFAQ----------EHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALC 410
            Y+GNI  FA           E++L  + Q +G +      PEK CCFI Y     A L 
Sbjct: 508 VYVGNI-DFASDSLNDERIFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILA 566

Query: 411 IVALTNFPFQGRNLRTGWGKEK 432
           +  + + P+  ++L+  +GK++
Sbjct: 567 LDKIKSNPY-FKDLKINFGKDR 587

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 16/127 (12%)

Query: 90  GGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHD 149
           G     ++ +Y+G+LPK +  + +    + GG + S+K++ D+        FV + +P  
Sbjct: 408 GPNNLGNRTVYLGSLPKDVKIEEICNAVR-GGLLQSIKLLNDR-----YVCFVTFIDPTA 461

Query: 150 AN--VAYQTLNGKEVEGKVLKINWAFQS--------QQVNSDETFNLFVGDLNVDVDDAT 199
           A    A  +L G  V+ K  K+ W   S          V++  + N++VG+++   D   
Sbjct: 462 AAQFYAMSSLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFASDSLN 521

Query: 200 LAGTFKE 206
               F E
Sbjct: 522 DERIFTE 528

>NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON}
           Anc_2.167
          Length = 224

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 98  ILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNS-QECNYAFVEYFEPHDANVAYQT 156
           ILYV  LP+   +  L +YF   G +  V++  +K +    +Y F+E+    DAN+A   
Sbjct: 95  ILYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQDA 154

Query: 157 LNGKEVEGKVLKI 169
           +N   V G +L++
Sbjct: 155 MNNYLVMGHLLQV 167

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,204,128
Number of extensions: 1426818
Number of successful extensions: 5731
Number of sequences better than 10.0: 575
Number of HSP's gapped: 5254
Number of HSP's successfully gapped: 1295
Length of query: 475
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 362
Effective length of database: 40,524,141
Effective search space: 14669739042
Effective search space used: 14669739042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)