Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E08405g2.284ON77777735580.0
SAKL0E07722g2.284ON79170116050.0
Kwal_27.115422.284ON79169615410.0
YIL095W (PRK1)2.284ON81078614710.0
Smik_9.842.284ON80876714690.0
Skud_9.782.284ON80976314260.0
KLTH0G10318g2.284ON79070914130.0
KAFR0J013702.284ON78071913880.0
TPHA0C033802.284ON69750913361e-174
KAFR0H033302.284ON36932812891e-172
TDEL0G021502.284ON66131613141e-171
Suva_9.1042.284ON80532013131e-169
Ecym_33232.284ON74849612981e-168
CAGL0G02607g2.284ON68831712901e-167
NDAI0B035602.284ON75633212851e-166
ADL217W2.284ON75049412841e-166
NCAS0G038102.284ON66132812711e-165
NCAS0B062602.284ON72331812691e-164
NDAI0G006402.284ON62131512541e-163
TBLA0B059302.284ON71731812601e-163
Kpol_1003.352.284ON71331712471e-161
Smik_14.3112.284ON63730912391e-160
Skud_14.3092.284ON63941912391e-160
ZYRO0A01848g2.284ON70431512451e-160
YNL020C (ARK1)2.284ON63831312341e-160
KNAG0H020202.284ON59231112111e-157
Suva_14.3272.284ON63230812001e-155
Kpol_1039.332.284ON70131611991e-154
TBLA0B069402.284ON144331812271e-150
CAGL0J03432g2.284ON62231111181e-143
TPHA0D015402.284ON70732510651e-134
KNAG0A054302.284ON78831810601e-132
KAFR0A010403.273ON9123257987e-93
SAKL0D03234g3.273ON8583157913e-92
KNAG0H012203.273ON9133267857e-91
CAGL0H10208g3.273ON10273227881e-90
KLTH0C07260g3.273ON9013167812e-90
ZYRO0E06864g3.273ON11153217893e-90
Kwal_27.109453.273ON9353187805e-90
KNAG0J008203.273ON10913207867e-90
Kpol_251.43.273ON8383167739e-90
TBLA0E025903.273ON10613187822e-89
Kpol_1052.223.273ON11013207772e-88
Ecym_26503.273ON8943137644e-88
TDEL0D035203.273ON10493167672e-87
Smik_2.1913.273ON11083197641e-86
NCAS0A105903.273ON10953197631e-86
KAFR0C004303.273ON9493227561e-86
Suva_4.2973.273ON11073197603e-86
YBR059C (AKL1)3.273ON11083197594e-86
CAGL0K11990g3.273ON9913217546e-86
KLLA0F18612g3.273ON8143117439e-86
Skud_2.1793.273ON10903197551e-85
TPHA0M011203.273ON7883237392e-85
NDAI0A057003.273ON11573287543e-85
AGR027C3.273ON9613137394e-84
TPHA0A040303.273ON10543187303e-82
TBLA0I019303.273ON13613167356e-82
KAFR0A050906.31ON6682912664e-23
Suva_16.706.262ON3643412326e-20
Kpol_1037.206.31ON7042742397e-20
Skud_16.426.262ON3643352328e-20
Kpol_1065.36.222ON3762702311e-19
TDEL0G043806.31ON7222742361e-19
Suva_16.1608.668ON9182952371e-19
YPL236C (ENV7)6.262ON3643352292e-19
KNAG0E008506.31ON7112742362e-19
KAFR0B028008.279ON10952052353e-19
NCAS0D021006.31ON7262742333e-19
CAGL0M02299g8.668ON8932962326e-19
SAKL0H06754g8.668ON8842982309e-19
Smik_6.4416.262ON3643352231e-18
Smik_13.1596.31ON7052752291e-18
TPHA0J004206.31ON7072742291e-18
Ecym_10301.24ON4402772251e-18
Kpol_1023.266.31ON7392712272e-18
SAKL0A03344g6.262ON3643562203e-18
Skud_16.1328.668ON9242952263e-18
KNAG0F001701.24ON5432102234e-18
Ecym_30356.31ON7402752244e-18
ACL006W6.31ON7082872244e-18
Kpol_1072.198.668ON8962942245e-18
KLTH0H03080g6.262ON3463302175e-18
Suva_13.1636.31ON7052752235e-18
Skud_13.1546.31ON7052752236e-18
YMR001C (CDC5)6.31ON7052752227e-18
TPHA0F024306.31ON7982772228e-18
ZYRO0C07480g6.31ON7742742229e-18
YPL150W8.668ON9012952211e-17
NDAI0C026806.31ON7502752201e-17
AFR724C1.24ON4402782162e-17
ZYRO0F07194g8.668ON9382972202e-17
ZYRO0F18062g1.24ON4712362162e-17
CAGL0J11638g6.31ON7462752192e-17
CAGL0K08514g2.479ON14892182192e-17
Kwal_56.242746.262ON3463352112e-17
ABL034W2.479ON14252182193e-17
TDEL0F040608.279ON11262062183e-17
Smik_6.3478.668ON9172942173e-17
NCAS0B050908.279ON12102062183e-17
Smik_4.3678.279ON10662062164e-17
CAGL0M11396g8.279ON11922102165e-17
KAFR0G026906.31ON7132742155e-17
SAKL0C00946g1.24ON5641972136e-17
YDR122W (KIN1)8.279ON10642062156e-17
Kwal_26.87518.668ON8482442147e-17
Suva_2.2838.279ON10892062157e-17
Ecym_73922.479ON14341982159e-17
ZYRO0D06776g8.279ON12042092149e-17
ZYRO0G03366g2.479ON16162032159e-17
Suva_11.1232.479ON15262002149e-17
KLTH0D05566g2.479ON11282252149e-17
Kwal_56.224766.31ON6972742121e-16
KLLA0C06138g6.31ON7082742121e-16
KLTH0C10912g6.31ON6972742121e-16
TBLA0C046008.279ON13152072131e-16
NCAS0C041008.141ON9053312121e-16
TDEL0A025502.479ON13692202121e-16
TDEL0A067506.262ON3723012062e-16
Kpol_2002.241.24ON4872662092e-16
KNAG0D048107.86ON14401832122e-16
KLLA0F11319g8.668ON8431952112e-16
Skud_4.3838.279ON10652062112e-16
Kwal_26.77882.479ON12672252122e-16
TBLA0I011502.479ON17452132122e-16
TBLA0A047207.86ON12622412112e-16
KLLA0F13552g2.479ON12672292112e-16
TBLA0B004906.31ON7872752102e-16
KAFR0G012001.24ON5072312082e-16
Kpol_431.92.479ON15521992113e-16
NDAI0B020708.279ON12582062103e-16
NDAI0J012508.279ON11761932085e-16
YKL101W (HSL1)2.479ON15182302076e-16
Ecym_42918.279ON11452062076e-16
NCAS0A057702.479ON14611902076e-16
CAGL0B01925g8.279ON9442102067e-16
Kwal_33.131121.24ON5052342047e-16
KLTH0D10714g8.654ON8722032067e-16
SAKL0E02860g2.479ON13771982069e-16
SAKL0H07084g8.654ON9192002059e-16
YLR096W (KIN2)8.279ON11471952051e-15
TBLA0D022308.141ON11543042051e-15
SAKL0E01584g6.31ON6952752041e-15
KAFR0D032002.479ON14482112051e-15
Skud_3.391.52ON10172152041e-15
KLTH0D11044g8.668ON8492032041e-15
NDAI0F045201.24ON4892132011e-15
Ecym_21536.262ON3633541981e-15
TPHA0G016308.668ON8713002032e-15
ZYRO0D05500g7.86ON12621792042e-15
SAKL0H16632g8.279ON10622132032e-15
KLTH0F16676g5.406ON8782552032e-15
Smik_11.1392.479ON15342302042e-15
ZYRO0E07876g6.262ON3693561972e-15
TDEL0A061408.668ON8613172022e-15
TPHA0E038501.24ON4822101992e-15
Kpol_1066.468.279ON12252152023e-15
KNAG0F029006.31ON6492032003e-15
Kwal_56.237178.279ON8582082013e-15
NDAI0E023908.668ON8831952013e-15
YDR490C (PKH1)3.92ON7661992013e-15
NCAS0C016708.668ON8962992013e-15
ACR133C8.668ON8511952013e-15
TBLA0B038608.668ON9882962013e-15
KAFR0H025108.668ON8792492013e-15
TPHA0J008208.279ON12182152013e-15
KLTH0G13288g8.279ON11422082013e-15
SAKL0C01716g1.52ON12153052013e-15
KNAG0G021108.279ON11921952014e-15
NCAS0B044906.222ON3492031944e-15
KLLA0E21693g5.406ON10162252004e-15
NCAS0B037408.279ON10492082004e-15
KAFR0C014403.92ON10952512004e-15
KNAG0A030408.654ON6442011984e-15
AGR058W8.279ON10712061995e-15
TPHA0G032002.479ON15342002005e-15
Kwal_56.240916.222ON3811871945e-15
KLTH0F00946g1.24ON5122351966e-15
Suva_10.1808.279ON11591951996e-15
TDEL0H036407.86ON12371841996e-15
Skud_11.1262.479ON15181921996e-15
TDEL0C067801.24ON4682441957e-15
KLLA0F19536g8.279ON11042051987e-15
Skud_12.1648.279ON11601951987e-15
Smik_4.7673.92ON7582481978e-15
KLLA0C12485g3.92ON9252521961e-14
NCAS0A002801.24ON5352731941e-14
KNAG0F002901.52ON11252921961e-14
TBLA0A071501.52ON13911931961e-14
AFL101C6.222ON3672681911e-14
CAGL0L03520g1.271ON14472871961e-14
NDAI0E012908.654ON7292061951e-14
YCL024W (KCC4)1.52ON10371981951e-14
Kpol_1072.298.654ON8932001951e-14
Ecym_21946.222ON3662681902e-14
TBLA0A074601.24ON5161871932e-14
NDAI0D027502.479ON15152111952e-14
TDEL0D053203.92ON10571941952e-14
YAR019C (CDC15)3.177ON9742491942e-14
KNAG0J016708.668ON10092001942e-14
Kwal_55.215455.406ON8652431933e-14
KLTH0C09548g3.92ON9932001933e-14
KNAG0A065402.479ON14322091933e-14
Kpol_463.81.271ON14472401933e-14
TBLA0B082503.92ON13472181933e-14
Suva_6.1691.271ON14842851933e-14
KLLA0F14190g1.271ON13382851933e-14
KLLA0C01650g1.52ON11121931923e-14
Smik_12.1558.279ON11621951923e-14
Smik_1.793.177ON9742491924e-14
Kwal_26.71547.86ON12131921924e-14
Suva_3.1901.52ON10241941914e-14
TPHA0D011408.654ON6222041905e-14
KLLA0F07623g7.86ON12291931916e-14
KAFR0D041001.52ON11171921916e-14
Kwal_26.87098.654ON8292041906e-14
Skud_4.7643.92ON7562021906e-14
Smik_4.7891.52ON11361921906e-14
CAGL0E05720g6.222ON3582691856e-14
KAFR0D012207.86ON10551911906e-14
CAGL0F00913g7.86ON12061831906e-14
Suva_2.6871.52ON11281921907e-14
Smik_3.541.52ON10322401907e-14
YPL141C (FRK1)8.654ON8652061897e-14
Kwal_56.226933.92ON9841941897e-14
YDR523C (SPS1)1.24ON4901901878e-14
CAGL0I07513g3.92ON10761981898e-14
Skud_3.1656.371ON7161951888e-14
Ecym_35863.92ON10771931898e-14
KLLA0E03587g5.591ON6472001889e-14
Ecym_24058.668ON8552971889e-14
YJL095W (BCK1)1.271ON14782851891e-13
NDAI0F016006.222ON4121931841e-13
Sklu_YGOB_Anc_2.4962.496ON6192281871e-13
KLLA0B02332g6.222ON3612741831e-13
Skud_4.7831.52ON11351921881e-13
YCR091W (KIN82)6.371ON7202161871e-13
NCAS0B086001.52ON11172251871e-13
YDR507C (GIN4)1.52ON11421921871e-13
CAGL0J03872g8.654ON6612021861e-13
ZYRO0C06776g5.591ON8902741871e-13
Skud_1.723.177ON9742481872e-13
TBLA0B023103.92ON8191951862e-13
KNAG0H031408.279ON9362101862e-13
Kwal_47.183075.591ON6212751852e-13
CAGL0G04609g3.92ON9652011862e-13
Suva_15.2975.406ON10741881862e-13
TDEL0D014001.271ON14292791862e-13
Ecym_60406.371ON8962891862e-13
KNAG0D002106.371ON8332041852e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08405g
         (777 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...  1375   0.0  
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   622   0.0  
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   598   0.0  
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   571   0.0  
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   570   0.0  
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   553   0.0  
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   548   0.0  
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   539   0.0  
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   519   e-174
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   501   e-172
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   510   e-171
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   510   e-169
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   504   e-168
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   501   e-167
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   499   e-166
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   499   e-166
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   494   e-165
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   493   e-164
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    487   e-163
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   489   e-163
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   484   e-161
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   481   e-160
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   481   e-160
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   484   e-160
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   479   e-160
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   471   e-157
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   466   e-155
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   466   e-154
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   477   e-150
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   435   e-143
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   414   e-134
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   412   e-132
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   311   7e-93
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   309   3e-92
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   306   7e-91
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   308   1e-90
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   305   2e-90
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   308   3e-90
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   305   5e-90
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   307   7e-90
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   302   9e-90
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   305   2e-89
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   303   2e-88
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   298   4e-88
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   300   2e-87
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   298   1e-86
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   298   1e-86
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   295   1e-86
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   297   3e-86
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   296   4e-86
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   295   6e-86
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   290   9e-86
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   295   1e-85
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   289   2e-85
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   295   3e-85
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   289   4e-84
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   285   3e-82
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   287   6e-82
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            107   4e-23
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    94   6e-20
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    97   7e-20
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    94   8e-20
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    94   1e-19
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    96   1e-19
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    96   1e-19
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    93   2e-19
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    96   2e-19
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    95   3e-19
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      94   3e-19
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    94   6e-19
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    93   9e-19
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    91   1e-18
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    93   1e-18
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    93   1e-18
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    91   1e-18
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    92   2e-18
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    89   3e-18
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    92   3e-18
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    91   4e-18
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    91   4e-18
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    91   4e-18
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    91   5e-18
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    88   5e-18
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    91   5e-18
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    91   6e-18
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    90   7e-18
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    90   8e-18
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    90   9e-18
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    90   1e-17
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    89   1e-17
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    88   2e-17
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    89   2e-17
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    88   2e-17
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    89   2e-17
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    89   2e-17
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    86   2e-17
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    89   3e-17
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    89   3e-17
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    88   3e-17
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              89   3e-17
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    88   4e-17
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    88   5e-17
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    87   5e-17
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    87   6e-17
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    87   6e-17
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    87   7e-17
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    87   7e-17
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    87   9e-17
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    87   9e-17
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    87   9e-17
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    87   9e-17
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    87   9e-17
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    86   1e-16
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    86   1e-16
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    86   1e-16
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    87   1e-16
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     86   1e-16
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    86   1e-16
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    84   2e-16
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    85   2e-16
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    86   2e-16
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    86   2e-16
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    86   2e-16
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    86   2e-16
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    86   2e-16
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    86   2e-16
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    86   2e-16
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    86   2e-16
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    85   2e-16
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    86   3e-16
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              86   3e-16
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    85   5e-16
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    84   6e-16
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    84   6e-16
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    84   6e-16
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    84   7e-16
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    83   7e-16
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    84   7e-16
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    84   9e-16
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    84   9e-16
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    84   1e-15
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    84   1e-15
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    83   1e-15
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    84   1e-15
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    83   1e-15
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    83   1e-15
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    82   1e-15
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    81   1e-15
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    83   2e-15
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    83   2e-15
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    83   2e-15
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    83   2e-15
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    83   2e-15
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    80   2e-15
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    82   2e-15
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    81   2e-15
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    82   3e-15
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               82   3e-15
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    82   3e-15
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    82   3e-15
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    82   3e-15
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    82   3e-15
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    82   3e-15
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    82   3e-15
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    82   3e-15
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    82   3e-15
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    82   3e-15
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    82   3e-15
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    82   4e-15
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     79   4e-15
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    82   4e-15
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    82   4e-15
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    82   4e-15
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    81   4e-15
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    81   5e-15
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    82   5e-15
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    79   5e-15
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    80   6e-15
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    81   6e-15
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    81   6e-15
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    81   6e-15
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    80   7e-15
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    81   7e-15
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    81   7e-15
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    80   8e-15
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    80   1e-14
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        79   1e-14
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    80   1e-14
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    80   1e-14
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    78   1e-14
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    80   1e-14
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    80   1e-14
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    80   1e-14
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    80   1e-14
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    78   2e-14
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    79   2e-14
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    80   2e-14
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    80   2e-14
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    79   2e-14
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    79   2e-14
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    79   3e-14
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    79   3e-14
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    79   3e-14
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    79   3e-14
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    79   3e-14
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    79   3e-14
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    79   3e-14
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    79   3e-14
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    79   3e-14
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    79   4e-14
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    79   4e-14
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    78   4e-14
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    78   5e-14
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    78   6e-14
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    78   6e-14
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    78   6e-14
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    78   6e-14
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    78   6e-14
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    76   6e-14
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    78   6e-14
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    78   6e-14
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    78   7e-14
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    78   7e-14
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    77   7e-14
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    77   7e-14
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    77   8e-14
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    77   8e-14
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    77   8e-14
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    77   8e-14
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    77   9e-14
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    77   9e-14
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    77   1e-13
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    75   1e-13
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    77   1e-13
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    75   1e-13
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    77   1e-13
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    77   1e-13
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    77   1e-13
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    77   1e-13
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    76   1e-13
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    77   1e-13
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    77   2e-13
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    76   2e-13
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    76   2e-13
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    76   2e-13
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    76   2e-13
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    76   2e-13
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    76   2e-13
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    76   2e-13
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    76   2e-13
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    76   2e-13
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               75   2e-13
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    75   2e-13
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    76   3e-13
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     76   3e-13
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    76   3e-13
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    76   3e-13
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    75   3e-13
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    75   3e-13
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    76   3e-13
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    74   3e-13
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    75   3e-13
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    74   3e-13
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    75   3e-13
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    75   3e-13
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    74   4e-13
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    75   4e-13
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    75   4e-13
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    75   4e-13
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    75   4e-13
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    75   4e-13
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    74   4e-13
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    75   4e-13
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    75   4e-13
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     75   4e-13
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    75   4e-13
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    75   5e-13
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    75   5e-13
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    75   5e-13
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    73   5e-13
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    74   6e-13
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    75   6e-13
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    74   6e-13
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    74   6e-13
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    74   7e-13
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    74   7e-13
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    75   7e-13
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    73   7e-13
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    74   8e-13
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    74   8e-13
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    74   9e-13
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    74   9e-13
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    74   9e-13
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    74   9e-13
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    73   9e-13
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    74   1e-12
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    74   1e-12
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    74   1e-12
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    74   1e-12
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    72   1e-12
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    74   1e-12
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    74   1e-12
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    74   1e-12
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    74   1e-12
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    72   1e-12
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    73   1e-12
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    73   1e-12
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    73   2e-12
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    73   2e-12
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    73   2e-12
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    73   2e-12
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    73   2e-12
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    72   2e-12
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    73   2e-12
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    73   2e-12
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    73   2e-12
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    73   2e-12
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    73   2e-12
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    72   3e-12
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    72   3e-12
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    72   3e-12
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    72   3e-12
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     72   3e-12
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    73   3e-12
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    73   3e-12
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    72   3e-12
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    72   3e-12
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    72   3e-12
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    72   3e-12
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    72   3e-12
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    72   3e-12
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     72   3e-12
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    72   3e-12
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    72   3e-12
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    70   3e-12
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    72   3e-12
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    72   3e-12
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    72   3e-12
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    72   4e-12
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    72   4e-12
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    72   4e-12
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    72   4e-12
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    72   4e-12
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    72   4e-12
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    72   4e-12
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    72   4e-12
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    72   4e-12
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    72   4e-12
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    72   4e-12
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    72   5e-12
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    72   5e-12
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    72   5e-12
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    71   5e-12
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    71   5e-12
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    72   5e-12
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    72   6e-12
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    70   6e-12
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    72   6e-12
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    72   6e-12
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    72   6e-12
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    70   6e-12
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    71   6e-12
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    72   6e-12
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               71   6e-12
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    71   7e-12
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    71   7e-12
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    70   8e-12
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    71   8e-12
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    71   8e-12
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    70   8e-12
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    71   9e-12
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    69   9e-12
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    70   9e-12
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    71   9e-12
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    70   9e-12
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    70   9e-12
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    70   9e-12
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    71   1e-11
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    71   1e-11
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    70   1e-11
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    70   1e-11
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    70   1e-11
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    70   1e-11
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    70   1e-11
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    70   1e-11
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    69   1e-11
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    70   1e-11
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    69   1e-11
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     70   1e-11
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    70   1e-11
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    70   1e-11
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    70   1e-11
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    70   1e-11
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    70   1e-11
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    70   1e-11
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    70   1e-11
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    70   1e-11
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    70   1e-11
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    70   1e-11
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    70   1e-11
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    70   2e-11
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    70   2e-11
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    70   2e-11
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    70   2e-11
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    70   2e-11
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    69   2e-11
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    70   2e-11
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    69   2e-11
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    70   2e-11
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    69   2e-11
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    70   2e-11
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    70   2e-11
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    70   2e-11
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    70   2e-11
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    70   2e-11
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    70   2e-11
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    70   2e-11
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    69   2e-11
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    69   2e-11
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    69   2e-11
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    69   2e-11
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    69   2e-11
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    69   2e-11
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    69   3e-11
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    69   3e-11
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    69   3e-11
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    69   3e-11
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    69   3e-11
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    69   3e-11
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    69   3e-11
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    69   3e-11
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    68   3e-11
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    69   3e-11
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    69   3e-11
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    69   3e-11
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    68   3e-11
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    68   4e-11
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       69   4e-11
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    69   4e-11
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    69   4e-11
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     69   4e-11
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    69   4e-11
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    69   5e-11
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    68   5e-11
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    68   5e-11
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    69   5e-11
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    69   5e-11
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    67   5e-11
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    68   5e-11
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    68   5e-11
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    67   6e-11
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    68   6e-11
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    68   6e-11
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    68   6e-11
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    67   6e-11
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    68   7e-11
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    67   7e-11
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    67   7e-11
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     67   7e-11
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    67   7e-11
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    67   8e-11
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     67   8e-11
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    66   8e-11
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    68   9e-11
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    67   9e-11
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    67   9e-11
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    67   9e-11
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    67   1e-10
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    67   1e-10
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    67   1e-10
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    67   1e-10
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    67   1e-10
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    67   1e-10
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    66   1e-10
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    66   1e-10
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    67   1e-10
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    67   1e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    67   1e-10
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    67   1e-10
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    67   1e-10
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    67   1e-10
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    67   1e-10
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    66   1e-10
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    67   1e-10
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    66   1e-10
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    65   1e-10
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    66   1e-10
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    66   1e-10
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    66   2e-10
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    67   2e-10
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    67   2e-10
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    66   2e-10
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    66   2e-10
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    66   2e-10
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    67   2e-10
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    67   2e-10
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    66   2e-10
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    66   2e-10
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    66   2e-10
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       65   2e-10
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    66   2e-10
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    65   2e-10
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    65   2e-10
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    67   2e-10
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    66   2e-10
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    65   2e-10
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    66   2e-10
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    65   2e-10
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    66   2e-10
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    66   2e-10
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    66   2e-10
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    66   2e-10
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    66   2e-10
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    66   3e-10
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    65   3e-10
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    66   3e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    66   3e-10
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    66   3e-10
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    65   3e-10
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    66   3e-10
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    66   3e-10
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    66   3e-10
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    65   3e-10
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    65   3e-10
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    65   3e-10
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    66   3e-10
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    66   4e-10
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    65   4e-10
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    65   4e-10
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    65   4e-10
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    65   4e-10
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    65   4e-10
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    65   4e-10
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    64   4e-10
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    64   4e-10
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    65   4e-10
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    65   4e-10
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    65   4e-10
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    64   4e-10
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    64   5e-10
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    65   5e-10
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    65   5e-10
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    64   5e-10
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    64   5e-10
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    64   5e-10
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    65   5e-10
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    65   5e-10
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     64   5e-10
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    65   6e-10
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    65   6e-10
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    64   6e-10
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    64   6e-10
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    65   6e-10
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               64   6e-10
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    65   7e-10
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    65   7e-10
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    64   7e-10
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    64   7e-10
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    65   7e-10
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    65   7e-10
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    65   7e-10
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    64   7e-10
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    65   7e-10
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    64   7e-10
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    64   8e-10
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    65   8e-10
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    64   8e-10
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    64   8e-10
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    64   8e-10
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    64   8e-10
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    64   8e-10
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    64   9e-10
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    64   9e-10
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    64   1e-09
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    64   1e-09
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    64   1e-09
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    64   1e-09
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    64   1e-09
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    63   1e-09
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    64   1e-09
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    64   1e-09
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    64   1e-09
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    64   1e-09
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    64   1e-09
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    63   1e-09
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    64   1e-09
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    64   1e-09
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    64   1e-09
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    64   1e-09
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    63   1e-09
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    63   1e-09
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    63   1e-09
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    63   1e-09
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    64   1e-09
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    64   1e-09
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    63   2e-09
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    63   2e-09
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    62   2e-09
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    63   2e-09
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    63   2e-09
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    63   2e-09
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    62   2e-09
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    63   2e-09
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    62   2e-09
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    63   2e-09
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    62   2e-09
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    63   2e-09
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    62   2e-09
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    62   2e-09
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    62   3e-09
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    62   3e-09
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    63   3e-09
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    62   3e-09
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    63   3e-09
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    63   3e-09
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    62   3e-09
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    62   3e-09
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    62   3e-09
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    62   3e-09
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    63   3e-09
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    62   3e-09
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    62   3e-09
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    62   3e-09
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    62   3e-09
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    62   3e-09
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    62   3e-09
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    62   3e-09
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    62   3e-09
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    62   3e-09
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    62   3e-09
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    62   3e-09
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    62   3e-09
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    62   4e-09
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    61   4e-09
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    62   4e-09
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    61   4e-09
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    61   4e-09
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    61   4e-09
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    62   4e-09
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    62   4e-09
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    62   4e-09
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    62   4e-09
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    61   4e-09
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    61   4e-09
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    62   4e-09
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    60   4e-09
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    62   4e-09
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    62   4e-09
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              62   5e-09
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    62   5e-09
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    61   5e-09
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    61   5e-09
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    62   5e-09
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    61   5e-09
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    61   5e-09
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    61   5e-09
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    62   5e-09
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    62   5e-09
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    61   5e-09
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    61   5e-09
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    61   5e-09
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    61   5e-09
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    61   5e-09
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    61   5e-09
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    60   6e-09
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    62   6e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    62   6e-09
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    61   6e-09
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    62   6e-09
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    61   6e-09
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    61   6e-09
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    61   6e-09
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    62   6e-09
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    62   7e-09
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    61   7e-09
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    61   7e-09
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    61   7e-09
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    61   7e-09
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    61   7e-09
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    61   7e-09
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    61   8e-09
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    61   8e-09
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    60   8e-09
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    61   8e-09
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    60   8e-09
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    61   8e-09
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    60   8e-09
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    61   8e-09
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    60   8e-09
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    61   9e-09
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    61   9e-09
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    61   9e-09
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    61   9e-09
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    61   1e-08
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    61   1e-08
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    60   1e-08
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    61   1e-08
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    61   1e-08
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    60   1e-08
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    60   1e-08
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    60   1e-08
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    61   1e-08
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    61   1e-08
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    61   1e-08
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    61   1e-08
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    60   1e-08
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    60   1e-08
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    60   1e-08
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    60   1e-08
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    61   1e-08
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    60   1e-08
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    60   1e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    60   1e-08
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    60   1e-08
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    59   1e-08
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    60   1e-08
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    60   1e-08
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    60   1e-08
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    59   1e-08
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    60   1e-08
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    60   1e-08
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    60   1e-08
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    59   1e-08
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    60   1e-08
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    60   1e-08
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    60   1e-08
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    59   2e-08
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    60   2e-08
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    60   2e-08
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    60   2e-08
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    60   2e-08
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    59   2e-08
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    60   2e-08
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              60   2e-08
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    60   2e-08
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    60   2e-08
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    59   2e-08
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    60   2e-08
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    60   2e-08
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    60   2e-08
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    60   2e-08
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    60   2e-08
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    60   2e-08
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    59   2e-08
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    60   2e-08
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    59   2e-08
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    60   2e-08
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    59   2e-08
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    60   2e-08
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    60   2e-08
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    60   2e-08
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    60   2e-08
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    60   2e-08
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    59   2e-08
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    60   2e-08
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    60   2e-08
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    60   2e-08
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    59   2e-08
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    59   2e-08
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    59   2e-08
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    59   2e-08
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    59   3e-08
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    60   3e-08
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    59   3e-08
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    60   3e-08
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    59   3e-08
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    59   3e-08
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    59   3e-08
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    59   3e-08
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    59   3e-08
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    59   3e-08
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    59   3e-08
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     59   3e-08
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    59   3e-08
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    59   3e-08
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    58   3e-08
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     58   3e-08
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    59   3e-08
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    59   3e-08
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    59   3e-08
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    59   3e-08
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    59   3e-08
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    59   3e-08
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    59   4e-08
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    59   4e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    59   4e-08
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    59   4e-08
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    59   4e-08
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    59   4e-08
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    59   4e-08
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    58   4e-08
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    59   5e-08
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    58   5e-08
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    57   5e-08
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    59   5e-08
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    59   5e-08
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    58   6e-08
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    57   6e-08
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    57   6e-08
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    58   6e-08
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    58   6e-08
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    59   6e-08
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              58   6e-08
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    58   7e-08
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    59   7e-08
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    58   7e-08
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    58   7e-08
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    58   7e-08
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    58   7e-08
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    57   7e-08
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     57   7e-08
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    58   7e-08
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             58   7e-08
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    58   7e-08
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    58   7e-08
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    58   7e-08
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    58   7e-08
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    58   8e-08
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    58   8e-08
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    57   8e-08
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    57   8e-08
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    58   8e-08
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    58   8e-08
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    57   8e-08
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    58   8e-08
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               57   8e-08
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    58   8e-08
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    58   8e-08
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    58   9e-08
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    57   9e-08
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               57   9e-08
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    57   9e-08
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    57   9e-08
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    57   9e-08
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    58   9e-08
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    57   1e-07
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    57   1e-07
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    58   1e-07
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    57   1e-07
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    57   1e-07
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    57   1e-07
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    57   1e-07
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    58   1e-07
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    57   1e-07
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    58   1e-07
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               57   1e-07
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    57   1e-07
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    57   1e-07
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    57   1e-07
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    57   1e-07
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    57   1e-07
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    57   1e-07
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    57   1e-07
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    57   1e-07
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    57   1e-07
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    57   1e-07
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    57   1e-07
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    57   1e-07
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    57   1e-07
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    57   1e-07
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    57   1e-07
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    57   1e-07
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    57   1e-07
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    57   1e-07
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    57   1e-07
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    57   1e-07
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    56   1e-07
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    57   1e-07
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    57   1e-07
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    57   2e-07
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    57   2e-07
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    57   2e-07
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    57   2e-07
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    57   2e-07
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    57   2e-07
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    57   2e-07
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      57   2e-07
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    57   2e-07
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    57   2e-07
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    57   2e-07
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    57   2e-07
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    56   2e-07
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    57   2e-07
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    57   2e-07
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    57   2e-07
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    56   2e-07
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              56   2e-07
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    57   2e-07
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    56   2e-07
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    56   2e-07
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    57   2e-07
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    57   2e-07
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    57   2e-07
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    57   2e-07
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    56   2e-07
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    56   2e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    56   2e-07
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    57   2e-07
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    56   2e-07
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    56   2e-07
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    56   2e-07
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    56   2e-07
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    56   2e-07
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    56   2e-07
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    56   2e-07
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    55   2e-07
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    56   2e-07
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    56   3e-07
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    56   3e-07
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    55   3e-07
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    56   3e-07
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    56   3e-07
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    56   3e-07
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    56   3e-07
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    56   3e-07
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    55   3e-07
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    55   3e-07
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    55   3e-07
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    55   3e-07
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    56   3e-07
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    56   3e-07
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    56   3e-07
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    56   3e-07
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    55   3e-07
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     56   3e-07
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    55   3e-07
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    56   3e-07
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    56   3e-07
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    55   3e-07
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    56   3e-07
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    56   3e-07
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    55   4e-07
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    55   4e-07
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    56   4e-07
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    55   4e-07
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    55   4e-07
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    56   4e-07
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    55   4e-07
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    55   4e-07
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    56   4e-07
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    55   4e-07
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    55   4e-07
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     55   4e-07
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    55   4e-07
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    55   4e-07
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    55   4e-07
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     55   5e-07
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    55   5e-07
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    55   5e-07
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    55   5e-07
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    55   5e-07
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    55   5e-07
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    55   5e-07
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    55   5e-07
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    55   5e-07
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    55   5e-07
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    55   5e-07
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    55   5e-07
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    55   5e-07
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    55   5e-07
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    55   5e-07
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    55   5e-07
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    55   5e-07
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    55   5e-07
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    55   5e-07
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    55   6e-07
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    55   6e-07
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    55   6e-07
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    55   6e-07
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    55   6e-07
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    54   6e-07
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    55   7e-07
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    55   7e-07
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    55   7e-07
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    54   7e-07
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    54   7e-07
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    55   7e-07
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    54   7e-07
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    55   7e-07
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    54   7e-07
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    54   7e-07
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    55   7e-07
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    55   7e-07
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    55   7e-07
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    54   8e-07
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    55   8e-07
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    55   8e-07
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    55   8e-07
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    54   8e-07
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    54   8e-07
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    54   9e-07
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               54   9e-07
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    55   9e-07
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    54   9e-07
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    54   9e-07
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    54   9e-07
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    54   9e-07
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    54   9e-07
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    54   9e-07
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    54   9e-07
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    54   9e-07
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    54   9e-07
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     54   1e-06
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    54   1e-06
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    54   1e-06
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    55   1e-06
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    54   1e-06
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    54   1e-06
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    54   1e-06
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    54   1e-06
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    54   1e-06
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    54   1e-06
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    54   1e-06
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               54   1e-06
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    54   1e-06
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    54   1e-06
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              54   1e-06
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    54   1e-06
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    54   1e-06
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    54   1e-06
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    54   1e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    54   1e-06
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    54   1e-06
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    54   1e-06
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    54   1e-06
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    54   1e-06
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    54   1e-06
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    54   2e-06
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    54   2e-06
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    54   2e-06
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    54   2e-06
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    54   2e-06
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    54   2e-06
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    54   2e-06
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              54   2e-06
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    53   2e-06
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    54   2e-06
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    53   2e-06
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    53   2e-06
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    53   2e-06
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    54   2e-06
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    54   2e-06
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    54   2e-06
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    53   2e-06
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    53   2e-06
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               54   2e-06
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    53   2e-06
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    53   2e-06
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    53   2e-06
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    53   2e-06
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    53   2e-06
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    54   2e-06
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    53   2e-06
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    53   2e-06
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    53   2e-06
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    53   2e-06
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    53   2e-06
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    53   2e-06
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     53   2e-06
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    53   2e-06
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    53   2e-06
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    53   2e-06
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    53   2e-06
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    53   2e-06
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    53   2e-06
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    53   2e-06
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    53   2e-06
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    53   2e-06
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    53   3e-06
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    53   3e-06
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    53   3e-06
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    53   3e-06
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    53   3e-06
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    52   3e-06
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    53   3e-06
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    52   3e-06
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     53   3e-06
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              53   3e-06
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    52   3e-06
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    52   3e-06
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    53   3e-06
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    53   3e-06
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    52   3e-06
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    52   3e-06
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    52   3e-06
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    52   3e-06
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    52   3e-06
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    52   3e-06
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    52   3e-06
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    52   3e-06
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    53   3e-06
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    53   4e-06
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    52   4e-06
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    52   4e-06
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    52   4e-06
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    52   4e-06
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    51   4e-06
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    52   4e-06
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    52   4e-06
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    52   4e-06
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    52   4e-06
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    52   4e-06
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    52   4e-06
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    52   4e-06
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    52   5e-06
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    52   5e-06
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               52   5e-06
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    52   5e-06
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    52   5e-06
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    52   5e-06
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    52   5e-06
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    52   5e-06
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    52   5e-06
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    52   5e-06
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     52   5e-06
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    52   5e-06
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    52   5e-06
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    51   5e-06
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    52   6e-06
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    51   6e-06
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    52   6e-06
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    52   6e-06
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    51   7e-06
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    51   7e-06
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    50   7e-06
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    52   7e-06
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    52   7e-06
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    51   7e-06
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    51   7e-06
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    51   7e-06
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    52   7e-06
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    52   7e-06
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    52   7e-06
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    52   8e-06
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    51   8e-06
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    51   8e-06
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    51   8e-06
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    51   8e-06
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    51   8e-06
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    50   8e-06
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    51   8e-06
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    51   9e-06
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    51   9e-06
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    51   9e-06
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    51   9e-06
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    51   9e-06
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    51   9e-06
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    51   1e-05
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    51   1e-05
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    51   1e-05
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    51   1e-05
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    50   1e-05
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    50   1e-05
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    51   1e-05
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    51   1e-05
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    51   1e-05
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    51   1e-05
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    50   1e-05
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    50   1e-05
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              51   1e-05
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    51   1e-05
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    51   1e-05
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    50   1e-05
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    51   1e-05
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    50   1e-05
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    50   1e-05
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    50   1e-05
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    50   1e-05
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    50   1e-05
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    50   1e-05
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    51   1e-05
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    50   1e-05
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    50   1e-05
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    51   1e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    51   1e-05
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    47   1e-05
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    50   1e-05
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    50   1e-05
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    50   1e-05
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    50   1e-05
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    50   1e-05
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    50   1e-05
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    50   1e-05
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    50   1e-05
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    50   1e-05
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    50   1e-05
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    50   2e-05
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    50   2e-05
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    50   2e-05
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    50   2e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    50   2e-05
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    50   2e-05
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    50   2e-05
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    50   2e-05
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    50   2e-05
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    50   2e-05
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    50   2e-05
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    50   2e-05
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    50   2e-05
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    50   2e-05
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    49   2e-05
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    50   2e-05
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    50   2e-05
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    50   2e-05
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              49   2e-05
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    50   2e-05
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    50   2e-05
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    50   2e-05
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    50   2e-05
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    50   2e-05
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    50   2e-05
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    49   2e-05
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    50   2e-05
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    50   2e-05
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    50   2e-05
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    50   2e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    50   2e-05
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    50   2e-05
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    50   2e-05
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    49   2e-05
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    49   2e-05
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    49   2e-05
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    50   2e-05
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    50   3e-05
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    49   3e-05
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     49   3e-05
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    50   3e-05
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    49   3e-05
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    49   3e-05
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    49   3e-05
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    50   3e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    50   3e-05
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    49   3e-05
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    49   3e-05
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    50   3e-05
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    49   3e-05
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    49   3e-05
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    49   3e-05
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    49   3e-05
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    50   3e-05
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    49   3e-05
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    49   3e-05
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    49   3e-05
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    49   4e-05
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    49   4e-05
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    49   4e-05
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    49   4e-05
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    49   4e-05
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    49   4e-05
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    49   4e-05
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    49   4e-05
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    49   4e-05
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    49   4e-05
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    49   4e-05
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    49   4e-05
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    49   4e-05
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    49   4e-05
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    49   4e-05
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    49   4e-05
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    49   4e-05
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    49   4e-05
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    49   4e-05
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    49   5e-05
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    49   5e-05
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    48   5e-05
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    49   5e-05
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    49   5e-05
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    49   5e-05
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    49   5e-05
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    48   5e-05
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    49   5e-05
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    49   5e-05
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    49   5e-05
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    49   5e-05
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    49   5e-05
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    49   5e-05
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    49   5e-05
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    49   5e-05
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    49   6e-05
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    49   6e-05
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    48   6e-05
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    49   6e-05
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    48   6e-05
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    49   6e-05
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    49   6e-05
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    49   6e-05
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    49   6e-05
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    47   6e-05
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    47   6e-05
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    49   6e-05
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    48   6e-05
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    49   6e-05
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    49   6e-05
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     48   6e-05
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    47   6e-05
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    49   6e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    48   6e-05
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    48   7e-05
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      48   7e-05
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    48   7e-05
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    48   7e-05
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    48   7e-05
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    48   7e-05
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    48   8e-05
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    47   8e-05
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    48   8e-05
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    48   8e-05
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    47   8e-05
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    48   8e-05
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    48   8e-05
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    47   8e-05
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    48   8e-05
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    47   9e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    48   9e-05
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    47   9e-05
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    47   9e-05
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    48   9e-05
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    48   1e-04
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    48   1e-04
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    48   1e-04
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    48   1e-04
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    48   1e-04
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    47   1e-04
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    48   1e-04
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    48   1e-04
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    48   1e-04
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    46   1e-04
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    48   1e-04
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    47   1e-04
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    47   1e-04
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    47   1e-04
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    47   1e-04
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    47   1e-04
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    47   1e-04
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    47   1e-04
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    47   1e-04
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    47   1e-04
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    47   1e-04
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    47   1e-04
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    47   1e-04
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    47   1e-04
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    47   1e-04
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    47   1e-04
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    47   1e-04
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    47   2e-04
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    47   2e-04
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    47   2e-04
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    47   2e-04
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    47   2e-04
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    46   2e-04
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    47   2e-04
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    47   2e-04
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 47   2e-04
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    47   2e-04
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    47   2e-04
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    47   2e-04
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    47   2e-04
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    47   2e-04
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    47   2e-04
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    47   2e-04
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     47   2e-04
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    47   2e-04
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    46   2e-04
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     47   2e-04
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    47   2e-04
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    47   2e-04
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    47   2e-04
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    47   2e-04
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    46   2e-04
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    47   2e-04
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    46   2e-04
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    47   2e-04
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    46   2e-04
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    47   2e-04
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    47   2e-04
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    47   2e-04
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    46   2e-04
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       47   2e-04
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    47   2e-04
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    47   2e-04
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    46   2e-04
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    46   3e-04
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    45   3e-04
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    47   3e-04
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    47   3e-04
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    47   3e-04
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    46   3e-04
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    46   3e-04
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    45   3e-04
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    45   3e-04
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    46   3e-04
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    46   3e-04
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    46   3e-04
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    46   3e-04
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    46   3e-04
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    46   3e-04
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    46   3e-04
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    46   3e-04
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    46   3e-04
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    46   3e-04
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    45   3e-04
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    46   3e-04
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    46   3e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    46   3e-04
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    46   4e-04
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    46   4e-04
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    45   4e-04
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    46   4e-04
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    45   4e-04
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    46   4e-04
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    45   4e-04
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    46   4e-04
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    46   4e-04
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    46   4e-04
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               45   4e-04
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    46   4e-04
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    45   4e-04
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    46   4e-04
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    46   4e-04
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    45   5e-04
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    45   5e-04
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    45   5e-04
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    46   5e-04
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    45   5e-04
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    45   5e-04
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    45   5e-04
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    45   5e-04
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    45   5e-04
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    46   5e-04
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    45   5e-04
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    45   5e-04
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    45   5e-04
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    45   5e-04
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    45   5e-04
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    45   5e-04
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    45   6e-04
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    45   6e-04
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    45   6e-04
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    45   6e-04
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    45   6e-04
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    44   6e-04
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    45   6e-04
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    45   6e-04
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    45   6e-04
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    45   6e-04
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    45   7e-04
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    45   7e-04
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    45   7e-04
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    45   7e-04
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    45   7e-04
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    45   7e-04
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    45   7e-04
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    44   7e-04
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    44   7e-04
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    45   7e-04
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               45   7e-04
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    45   7e-04
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    45   7e-04
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    45   7e-04
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    45   8e-04
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    44   8e-04
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    44   8e-04
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    45   8e-04
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    45   8e-04
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    45   8e-04
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     45   8e-04
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    45   8e-04
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    44   8e-04
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    45   8e-04
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    45   8e-04
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    44   8e-04
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    45   8e-04
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    45   8e-04
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    45   9e-04
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    44   9e-04
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    45   9e-04
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    45   9e-04
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    44   0.001
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    45   0.001
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    44   0.001
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    45   0.001
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    45   0.001
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    44   0.001
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    45   0.001
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    45   0.001
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    44   0.001
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    44   0.001
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    44   0.001
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    44   0.001
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    44   0.001
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    44   0.001
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    44   0.001
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    44   0.001
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      44   0.001
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    44   0.001
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               44   0.001
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    44   0.001
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    45   0.001
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    44   0.001
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    44   0.001
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    44   0.001
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    44   0.001
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    44   0.001
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    44   0.001
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    44   0.001
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    44   0.001
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    44   0.001
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    44   0.001
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    44   0.002
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    44   0.002
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    44   0.002
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    44   0.002
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    44   0.002
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    44   0.002
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    44   0.002
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    44   0.002
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    44   0.002
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    44   0.002
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    44   0.002
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    44   0.002
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    43   0.002
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    44   0.002
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    44   0.002
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    44   0.002
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    44   0.002
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    43   0.002
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    44   0.002
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    43   0.002
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    44   0.002
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    44   0.002
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       44   0.002
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    44   0.002
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    43   0.002
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    43   0.002
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    43   0.002
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    43   0.002
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    43   0.002
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    44   0.002
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    44   0.002
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    43   0.002
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    43   0.002
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    43   0.002
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    44   0.002
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    44   0.002
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    43   0.002
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    42   0.003
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    43   0.003
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    42   0.003
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    42   0.003
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    43   0.003
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    43   0.003
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    43   0.003
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     43   0.003
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    43   0.003
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    42   0.003
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    43   0.003
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    42   0.003
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    42   0.003
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    43   0.003
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    42   0.003
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    42   0.003
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    43   0.003
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    43   0.003
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    43   0.003
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    43   0.003
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    43   0.003
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    42   0.004
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    42   0.004
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    42   0.004
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    42   0.004
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               42   0.004
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    42   0.004
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    42   0.004
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    43   0.004
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    42   0.004
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    42   0.004
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    42   0.004
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    42   0.004
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               42   0.004
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    42   0.004
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    42   0.004
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    42   0.004
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    42   0.005
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    42   0.005
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    42   0.005
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    42   0.005
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    42   0.005
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    42   0.005
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    42   0.005
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    42   0.005
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    42   0.005
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    42   0.005
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    42   0.005
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    41   0.005
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    42   0.005
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    42   0.006
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    42   0.006
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    42   0.006
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    42   0.006
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    42   0.006
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    42   0.006
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    42   0.007
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    42   0.007
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    42   0.007
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    42   0.007
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    41   0.007
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    41   0.007
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    42   0.007
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      42   0.007
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    42   0.007
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    42   0.007
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    41   0.008
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    41   0.008
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    42   0.008
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    41   0.008
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    41   0.008
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     41   0.008
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    42   0.008
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    42   0.009
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    41   0.009
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    41   0.009
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    41   0.009
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    41   0.009
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    41   0.009
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    41   0.010
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    41   0.010
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    41   0.010
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    41   0.010
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    41   0.010
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    40   0.011
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    41   0.011
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    41   0.011
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      41   0.011
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    41   0.012
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    41   0.012
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    41   0.012
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    40   0.012
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    41   0.012
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    41   0.013
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    41   0.013
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    41   0.013
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    40   0.014
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    40   0.014
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    41   0.014
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               41   0.015
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    40   0.015
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    40   0.015
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    41   0.015
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    41   0.015
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    40   0.015
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    40   0.016
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    40   0.016
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    40   0.017
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    40   0.017
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    40   0.017
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    40   0.018
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     40   0.019
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    40   0.019
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    40   0.020
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    40   0.020
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    40   0.020
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    40   0.020
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    40   0.021
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    40   0.021
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    40   0.021
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    40   0.021
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    40   0.021
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    40   0.022
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    40   0.022
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    40   0.022
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    40   0.023
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    40   0.023
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    40   0.023
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    39   0.023
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    40   0.023
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    40   0.023
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    40   0.024
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    40   0.024
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    40   0.024
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    40   0.027
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    40   0.028
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    40   0.028
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    39   0.028
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    40   0.029
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    40   0.030
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    40   0.031
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    40   0.031
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    39   0.032
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    39   0.033
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    40   0.036
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      39   0.036
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    39   0.037
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    39   0.038
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    40   0.039
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    39   0.039
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    39   0.040
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    39   0.041
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    39   0.042
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    39   0.043
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    39   0.045
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    39   0.046
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    39   0.046
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    39   0.046
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    39   0.052
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    39   0.056
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    39   0.057
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    39   0.063
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    38   0.071
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    39   0.072
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    38   0.082
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    38   0.082
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    38   0.083
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    39   0.083
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    38   0.084
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    38   0.086
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    38   0.094
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    38   0.095
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    38   0.098
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             38   0.11 
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    38   0.11 
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    38   0.11 
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    38   0.12 
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    38   0.12 
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    38   0.12 
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    38   0.12 
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    38   0.12 
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    38   0.12 
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    38   0.12 
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    37   0.13 
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    37   0.13 
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    38   0.13 
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    38   0.13 
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    38   0.13 
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    37   0.14 
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    37   0.15 
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    37   0.16 
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    37   0.17 
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    37   0.18 
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    37   0.18 
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    37   0.20 
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    37   0.21 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    37   0.23 
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    37   0.25 
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    37   0.26 
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    37   0.27 
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    37   0.28 
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    37   0.29 
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    37   0.29 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    37   0.30 
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    36   0.30 
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    37   0.31 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.35 
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    36   0.35 
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    36   0.40 
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    36   0.40 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    36   0.40 
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    36   0.41 
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    36   0.42 
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    35   0.53 
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    36   0.55 
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    36   0.60 
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    35   0.61 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    35   0.62 
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    35   0.64 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    35   0.64 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    35   0.68 
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    35   0.69 
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    35   0.73 
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    35   0.77 
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    35   0.78 
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    35   0.86 
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    35   0.98 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    35   1.2  
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    35   1.2  
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    34   1.4  
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    34   1.5  
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    34   1.5  
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    34   1.5  
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    34   1.7  
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    34   1.7  
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    34   1.8  
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    33   2.0  
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    34   2.1  
TBLA0B02440 Chr2 complement(564793..565713) [921 bp, 306 aa] {ON...    33   2.2  
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    33   2.3  
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    33   2.9  
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    33   3.0  
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    33   3.2  
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    33   3.4  
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    33   3.6  
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    33   3.6  
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    33   4.4  
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    32   4.6  
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    32   4.6  
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    33   4.9  
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    32   5.7  
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    32   6.1  
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    32   6.1  
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    32   6.6  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    32   9.2  
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    32   9.4  

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score = 1375 bits (3558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/777 (87%), Positives = 680/777 (87%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMXXXXXXXXXXXXQHLPPQVVSNVQTPSK 360
           GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQM            QHLPPQVVSNVQTPSK
Sbjct: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMTVPATVPTSVSTQHLPPQVVSNVQTPSK 360

Query: 361 TASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTSSDPFSKIDRSALLSTS 420
           TASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTSSDPFSKIDRSALLSTS
Sbjct: 361 TASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTSSDPFSKIDRSALLSTS 420

Query: 421 ATMESLPRAMRIPQLEYQQPHLLTXXXXXXXXXXXXXXXNGRGAISSILASNRTSLDRPK 480
           ATMESLPRAMRIPQLEYQQPHLLT               NGRGAISSILASNRTSLDRPK
Sbjct: 421 ATMESLPRAMRIPQLEYQQPHLLTRSQSVVPRASVSPVRNGRGAISSILASNRTSLDRPK 480

Query: 481 YVDSETQTSDHPSELGXXXXXXXXXXXXXXXXXXXXXXXXXGGSLTRKIGSKMKKVITGE 540
           YVDSETQTSDHPSELG                         GGSLTRKIGSKMKKVITGE
Sbjct: 481 YVDSETQTSDHPSELGLSRSLSRKSVASSLSSAESLEATSTGGSLTRKIGSKMKKVITGE 540

Query: 541 KRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRKSSLEARKYRSTSGKSIPEN 600
           KRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRKSSLEARKYRSTSGKSIPEN
Sbjct: 541 KRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRKSSLEARKYRSTSGKSIPEN 600

Query: 601 TSSNTKSHRRSTSSFSFVPENNDYELIEDIQKEKPXXXXXXXXXXXXXXXIQKRVKDLIN 660
           TSSNTKSHRRSTSSFSFVPENNDYELIEDIQKEKP               IQKRVKDLIN
Sbjct: 601 TSSNTKSHRRSTSSFSFVPENNDYELIEDIQKEKPKSSLRRSSSLKTSSSIQKRVKDLIN 660

Query: 661 ADDIPNRSSATGYGKYTDIGRKTDISDHHKSNANRKSSTVITPVHEXXXXXXXXXXXXXX 720
           ADDIPNRSSATGYGKYTDIGRKTDISDHHKSNANRKSSTVITPVHE              
Sbjct: 661 ADDIPNRSSATGYGKYTDIGRKTDISDHHKSNANRKSSTVITPVHEAPKSKPAPPPKPAH 720

Query: 721 XXXXXXXXXXXXXXXXFRTSPAKSEVKEQDSDQDSVGSPFQSRKEMKEFERRFPSAL 777
                           FRTSPAKSEVKEQDSDQDSVGSPFQSRKEMKEFERRFPSAL
Sbjct: 721 LKPNLPPKPKHLKAKSFRTSPAKSEVKEQDSDQDSVGSPFQSRKEMKEFERRFPSAL 777

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/701 (50%), Positives = 439/701 (62%), Gaps = 52/701 (7%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           M+QP +E Y SGT+L VGSH+ +++KYL SGGFAH+YS EISPPDP    ++ACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLN+LRAEVD+MK L+ +KF+VSYIDSHA KS +N G YEV+LLMEYC+ GGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRL+EFE+L IMSQVSQGVAAMHALQPPLIHRDIKIENVL+S++  FK+CDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V GVIR P+N +E NYVQ+DI+KNTTAQYR PEMIDLYRGLP+DEKSDIWALGVFLYK C
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK GE AIL SKF+FPAYP+YSD++KNLIS +LR +P++RPNICQ++ EVSRIQ
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 GIPCPIKNFYLLRMM----DKQEQPRVSPPPHVPQMXXXXXXXXXXXXQHLPPQVVSNVQ 356
           G+PCP+KNFYL R M     +Q+Q ++ P  H                Q  P +V+++ Q
Sbjct: 300 GVPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAITLPITLQPHPQKVLASAQ 359

Query: 357 TPSKTASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTSSDPFSKIDRSAL 416
                  +          + P   Q+ L S+ QP    +P        +DPF  +D+S L
Sbjct: 360 VSYANTGLT---------ASPTAQQKLLYSRSQP----LP------ARNDPFLNLDKSNL 400

Query: 417 LSTSATMESLPRAMRIPQLEYQQPHLL---TXXXXXXXXXXXXXXXNGRGAISSILASNR 473
           L     +E        P+L+Y +  L                    NGRG IS IL SN 
Sbjct: 401 LPPKTKLE-------FPELKYNKEQLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNP 453

Query: 474 TSLDR-PKYVDSETQTSDHPSEL-GXXXXXXXXXXXXXXXXXXXXXXXXXGGSLTRKIGS 531
           TS+DR   YVDSETQT +    L                           GGS TR+IG 
Sbjct: 454 TSVDRLSSYVDSETQTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGD 513

Query: 532 KMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRKS--------S 583
           K+K++I+ E R  S IRS QNTG S +SAF+ LR+G SS  F+ D S R S         
Sbjct: 514 KLKRIISNEPRNTSPIRSRQNTGGSTRSAFSTLRRGTSS-NFSSDRSKRNSVDFSVRRLG 572

Query: 584 LEARKYRSTSGKSIPENTSSN---TKSHRRSTSSFSFVPENNDYE-LIEDIQK--EKPXX 637
               K R +S KSI E  ++N    K H RS S+ S   + N YE     + +   +   
Sbjct: 573 SGGNKVRVSSSKSIEEKGNTNKFENKGHNRSVSTSSITSDLNKYEGKAGSVSRGYNQAHS 632

Query: 638 XXXXXXXXXXXXXIQKRVKDLI-NADDIPNRSSATGYGKYT 677
                        IQKRV DL+ N+ D P R +A  +G+++
Sbjct: 633 PIKMSANRESRNSIQKRVHDLLKNSQDSPVRKTAPDFGEFS 673

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/696 (49%), Positives = 420/696 (60%), Gaps = 34/696 (4%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQP    Y  GT L VGSHQ +++KYL SGGFAH+YS EISP DP    NVACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLN LRAEVD+MK LRGNK +VSYIDSHA KS    G YEV+LLMEYCS GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRL E E+L IMS ++QG+AAMHAL PPLIHRDIKIENVL+S +  FK+CDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V GVIR P+N +EF+YVQ DI+KNTTAQYR PEMIDLYRG PI+EKSDIWALGVFLYK C
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK G++AIL S+F+FPAYP+YSDR+KNLISVML  +P +RPNICQV+EEVSRIQ
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMXXXXXXXXXXXXQHLPPQVVSNVQTPSK 360
            +PCP++NFYLLR M +Q+Q         P +                P     V TP K
Sbjct: 301 NVPCPLRNFYLLRSMQQQQQQHQQQQQTFPSVEVHHSLSQPRMDLKNGP-----VLTPFK 355

Query: 361 TASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGK-TVPQTVSNYTSSDPFSKIDRSALLST 419
            A       L  SK+         ++   P  K    Q V     SDPF+ IDR  +L  
Sbjct: 356 HAQSS---ALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQE 412

Query: 420 SATMESLPRAMRIPQLEYQQPHLLTXXXXXXXXXXXXXXXNGRGAISSILASNRTSLD-R 478
              ++  P +    +L   Q                     GRG IS I+++N T++D  
Sbjct: 413 KIPLQ--PASADFQRLSRAQ--TFVPVTKSPKRSSASPSFGGRGDISMIVSANPTNVDPT 468

Query: 479 PKYVDSETQTSDHPSELGXXXXXXXXXXXXXXXXXXXXXXXXXGGSLTRKIGSKMKKVIT 538
           P Y++S  QT D+P                             GGS +R  G ++KKV T
Sbjct: 469 PIYLNSSVQT-DNPGSDLYLSKQNTRLSESSTSSSESIETQSTGGSFSRTFGRRLKKVFT 527

Query: 539 GEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRKSSLE---------ARKY 589
           GEKR  S I+S QNTGESVKSAF  LR+G SS    G+  S+K++++           K+
Sbjct: 528 GEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTNGSSSNGYKF 587

Query: 590 RSTSGKSIPENTSSNTKSHRRSTSSFSFVPENNDYELIEDIQKE------KPXXXXXXXX 643
           R TS  SI E  S    SH R  SS S V   +D + ++D          +         
Sbjct: 588 RVTSSDSIEEENSGFIYSHSRKASSTSIV---SDLDSLQDDSGTNAKKYYRSHSPVKLSG 644

Query: 644 XXXXXXXIQKRVKDLI-NADDIPNRSSATGYGKYTD 678
                  IQKRV++L+ ++ D P + SA GYG+ ++
Sbjct: 645 SSDARSSIQKRVQNLLKSSQDSPVKKSAHGYGEVSE 680

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/786 (43%), Positives = 440/786 (55%), Gaps = 143/786 (18%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MN PQI  Y  GTIL VGSH  K++KYL SGGFA VY+ EISPPDP    N+ACLKRV+V
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           P K  LNTLRAEVD+MK LR NK +VSYIDSHA +S VN   YEV++LME+C  GGLIDF
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRLQE EIL IMSQ  QG+ AMHALQPPLIHRDIKIENVL+S +  +K+CDFGS
Sbjct: 120 MNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           VSGVIR PRNT+EFNYVQ+DI+ NTTAQYR PEMIDLYRGLPIDEKSDIWALGVFLYK C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK+GE+ IL +++++P++P+YSDR+KNLI +ML   P +RPNICQV+EEVSR+Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPP----HVPQMXXXXXXXXXXXXQHLPPQVVSNVQ 356
             PCPI+NFYLLR M++    +++  P    +VP              + +P Q + ++ 
Sbjct: 300 NKPCPIRNFYLLRAMNQNANTQLAGEPSSTTYVP------------TQKFIPVQSLQSIN 347

Query: 357 TPSKTASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTSSDPFSKI----- 411
            P        +P  HVS +              P   T P ++++   ++  +       
Sbjct: 348 QPPNM-----MPVTHVSTT--------------PNLGTFPISINDNNKTEVTAHAGLQVG 388

Query: 412 DRSALLSTSATMESLPRAMRIPQLEYQQPHLLTXXXXXXXXXXXXXXXNGRGAISSILAS 471
             S L S     +S+P +     L Y++ H                         S+   
Sbjct: 389 SHSNLTSPLMKTKSVPLSDEFASLYYKELHPFQKSQTFKSVESFQSPQRKSMPPLSLTPV 448

Query: 472 NR------TSLDRP-KYVDSETQTSDHPSELGXXXXXXXXXXXXXXXXXXXXXXXXXGGS 524
           N       ++++RP  YVDSETQT D+ +                            G  
Sbjct: 449 NNDIFDRVSAINRPNNYVDSETQTIDNMAVPNLKLSPTITSKSLSSTKEIAAPDNINGSK 508

Query: 525 LTRKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDS--SSRKS 582
           + R + SK+KKVITGE RG S I+S QNTG+S++SAF  LR G     FTG+S  +SR +
Sbjct: 509 IVRSLSSKLKKVITGESRGNSPIKSRQNTGDSIRSAFGKLRHG-----FTGNSVNNSRSA 563

Query: 583 SLE-----------ARKYRSTSGKSIPE-------------------------------- 599
           S +            R+  S+S  S P+                                
Sbjct: 564 SFDNNNVNGNGNNTNRRLVSSSTSSFPKFNSDTKRKEESDKNQRLEKRRSMPPSILSDFD 623

Query: 600 -----NTSSNTKSHRRS-------------TSSFSFVPENNDYELIEDIQKEKPXXXXXX 641
                N+ + ++ + RS             TS  + +P+N +     +I +EK       
Sbjct: 624 QHERNNSRTGSRDYYRSHSPVKKTQASAKTTSKPTLIPDNGNV----NINQEK------- 672

Query: 642 XXXXXXXXXIQKRVKDLINADDIP-NRSSATGYGKYTDIGRKTDISDHHKSNANRKSSTV 700
                    IQ+RV +L+ + D P    SA+GYGKYTDIG +T         +NR SS  
Sbjct: 673 ------KESIQRRVHNLLKSSDDPVTYKSASGYGKYTDIGTET---------SNRHSSVR 717

Query: 701 ITPVHE 706
           ITP+ E
Sbjct: 718 ITPITE 723

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/767 (43%), Positives = 433/767 (56%), Gaps = 107/767 (13%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MN PQI  Y  GTIL VGSH  K++KYL SGGFA VY+ EISPPDP    N+ACLKRV+V
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK  LNTLRAEVD+MK L+ NK +VSYIDSHA KS VN   YEV++LME+C  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRL+E EIL IMSQ  QG+AAMHALQPPLIHRDIKIENVL+S N  +K+CDFGS
Sbjct: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           VSGVIR PRNT+EFNYVQ+DI+ NTTAQYR PEMIDLYRGLPIDEKSDIWALG+FLYK C
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK+GE+ IL +++++P +P+YSDR+KNLI +ML   P KRPNICQV+EEVSR+Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299

Query: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPP--HVPQMXXXXXXXXXXXXQHLPPQVVSNVQTP 358
             PCPI+NFYLLR M +  Q    PP   +VP              + LP Q + +++  
Sbjct: 300 IKPCPIRNFYLLRAMSQTAQLASEPPSMKYVP------------TQKFLPAQGLQSMKPI 347

Query: 359 SKTASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTSSDPFSKIDRSALLS 418
           S    + H+                   +  P   T+P+++ +   +D   +I    +  
Sbjct: 348 SNMIPVSHV-------------------RTTPNLSTLPRSIDDNNMTDVTKQISLQFVGD 388

Query: 419 TSA-----TMESLPRAMRIPQLEYQQPHLLTXXXXXXXXXXXXXXXNGRGAISSILASNR 473
           ++        +S+P +     L Y++ H                        SS+  +N 
Sbjct: 389 SNVDTPLKKTKSVPLSDDFASLYYRELHPFQKSQTFKSVENFQSPQRRSMPPSSLPPANS 448

Query: 474 TSLD------RP-KYVDSETQTSDHPSELGXXXXXXXXXXXXXXXXXXXXXXXXXGGSLT 526
             LD      RP  YVDSETQT+D  +  G                         GG++ 
Sbjct: 449 IILDKTPTMNRPNNYVDSETQTTDIITMSGSKLSPALTNKPVNSQKEFIAPENVSGGNIV 508

Query: 527 RKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDS--SSRKSSL 584
           R + SK+KKVITGE RG S I+S QNTG+S +SA   LR G     FTG S  ++R +S 
Sbjct: 509 RSLSSKLKKVITGESRGSSPIKSRQNTGDSTRSALGMLRHG-----FTGSSMNNNRSASF 563

Query: 585 EA------------------------------------RKYRSTSGKSIPENTSSNTKSH 608
           ++                                    +K +  + +S+P +  S+   H
Sbjct: 564 DSNNGSSNNNSVNRRLGSSSTSSLSVFNPDTKRQEEIDKKQKLENRRSMPSSILSDFDQH 623

Query: 609 RR---STSSFSFVPENNDYELIEDIQKEKPXXXXX-----XXXXXXXXXXIQKRVKDLIN 660
            R    T S  +   ++  + I+   K  P                    IQ+RV +L+ 
Sbjct: 624 ERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPITKPVIGDININQEKKESIQRRVHNLLK 683

Query: 661 ADDIP-NRSSATGYGKYTDIGRKTDISDHHKSNANRKSSTVITPVHE 706
           + + P    SA+GYGKYTD   +T         +NR SS  ITP+ E
Sbjct: 684 SSEDPLTYKSASGYGKYTDTDTET---------SNRHSSVRITPITE 721

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/763 (43%), Positives = 424/763 (55%), Gaps = 98/763 (12%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MN PQI  Y  GT+L VGSH  K++KYL SGGFA VY+ EISPPDP    N ACLKRV+V
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK  LNTLRAEVD+MK L+ NK +VSYIDSHA KS VN   YEV++LME+C  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQ+RL+E EIL IMSQ  QG+AAMH LQPPLIHRDIKIENVL+S +  +K+CDFGS
Sbjct: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           VSGVIR PRN++EFNYVQ+DI+ NTTAQYR PEMIDLYR  PIDEKSDIWALGVFLYK C
Sbjct: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK+GE+AIL S++++P++P+YSDR+K LI +ML   P +RPNICQV+EEVSR+Q
Sbjct: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299

Query: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMXXXXXXXXXXXXQHLPPQVVSNVQTPSK 360
             PCPI+NFYLLR M +  Q   S PP V  +            Q LP Q +        
Sbjct: 300 NEPCPIRNFYLLRAMGQNAQ-LASEPPSVTYVSAQ---------QLLPAQTLQ------- 342

Query: 361 TASIQHL----PYLHVSKSQPMVTQQDLLSQKQPAGKTVP---QTVSNYTSSDPFSKIDR 413
              I+HL    P  HV  +  + T    ++        +P   Q  S+    +P  K   
Sbjct: 343 --GIKHLQSMVPVTHVRTTPNLGTLTKAITNNNQTESILPVRTQPESDLNLGNPLMKTKS 400

Query: 414 SALLSTSATM-----ESLPRAMRIPQLE-YQQPHLLTXXXXXXXXXXXXXXXNGRGAISS 467
             L    A++         ++     +E +Q P                   N R + S+
Sbjct: 401 VPLSDDFASLYYRELHPFQKSQTFKSVESFQSPQ--RKLSTPSSSSPVNSKNNDRASTST 458

Query: 468 ILASNRTSLDRPK-YVDSETQTSDHPSELGXXXXXXXXXXXXXXXXXXXXXXXXXGGSLT 526
           +        DRP  YVDS TQT D+ + L                          GGS+ 
Sbjct: 459 V--------DRPNNYVDSVTQTIDNMAALNLNQSSVAINKPSGPPKESIVPENVTGGSIV 510

Query: 527 RKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGD---------- 576
           R + SK+KKVITGE R  S I+S QNTG+S++SAF  LR G++    + +          
Sbjct: 511 RSLSSKLKKVITGESRSSSPIKSRQNTGDSIRSAFGMLRHGLTGSSVSNNRTISFDSNNG 570

Query: 577 -----------------------SSSRKSSLEARKYRSTSGKSIPENTSSNTKSHRRSTS 613
                                   + R+  L+ +K +  + +S+P +  S+   H R+ S
Sbjct: 571 NGNGNSVNRRLASSSSSSSNFNFDTKRQDDLD-KKQKLENRRSMPPSILSDFDKHERNNS 629

Query: 614 ---------SFSFVPENNDYELIEDIQKEKPXXXXXXXXXXXXXXXIQKRVKDLINADDI 664
                    S S V +N            K                IQ+RV +L+N  + 
Sbjct: 630 RTGSRDYYRSHSPVKKNQTTPKTASRTTLK-SDSSDIDVKQVNKESIQRRVHNLLNNSED 688

Query: 665 P-NRSSATGYGKYTDIGRKTDISDHHKSNANRKSSTVITPVHE 706
           P    SA+GYGKYTD+  +          +NR SS  ITP+ E
Sbjct: 689 PLAHKSASGYGKYTDVNAEA---------SNRHSSVRITPITE 722

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/709 (45%), Positives = 423/709 (59%), Gaps = 73/709 (10%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQ   + Y  GT L VGSH+ +++KYL SGGFAH+Y+ EI P D   P  +ACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLN LRAEVD+MK LRGN+ +VSYIDSHA KS V+ G YEV+LLMEYCSGGGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRLQE E+L I S ++QG+AAMHALQPPLIHRDIKIENVL+S +  FK+CDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V GVIR P+N +EFNYVQ+DI+KNTTAQYR PEMIDLYRG PI+EKSDIWALGVFLYK C
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK GE+AIL S+F+FP+YP+YSD +K+LIS ML  +P +RPNICQV+EEVSRIQ
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMXXXXXXXXXXXXQHLPPQVVSNVQTPSK 360
           G PCP++NFY+ R M +Q+Q +       P++                P++ S       
Sbjct: 301 GTPCPLRNFYVTRAMQQQQQHQ------QPKIKFDHSASQ--------PKLDS------- 339

Query: 361 TASIQHLPYLHVSKSQPMVTQQDLLSQK--------QPAGKTVP-QTVSNYTSSDPFSKI 411
             +I ++P+  +S +QP+ + Q               PA K +P Q VS+  ++ PF  I
Sbjct: 340 ANNIINVPF-KMSHNQPLRSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFI 398

Query: 412 D-RSALLSTSATMESLPRAMRIPQLEYQQPHLLTXXXXXXXXXXXXXXXNGRGAISSILA 470
           +   AL S        P +    +L   Q    T                GRG IS I++
Sbjct: 399 EGNKALQSKQTPHFQPPISHDFNRLGRSQ--TFTPTSTLASRSSVSPPLAGRGDISKIIS 456

Query: 471 SNRTSLD-RPKYVDSETQTSDHPSELGXXXXXXXXXXXXXXXXXXXXXXXXXGGSLTRKI 529
           +N T+++  P Y+ S TQT D  +                            GGS TR+ 
Sbjct: 457 ANPTNVEPSPIYLSSGTQTDDGFAS-SHALKLERTKSIASLSSSESVESQHTGGSATRRF 515

Query: 530 GSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRKSSLEARKY 589
           G K+ KV TGE+R  S I+S QNTG+SV+SAF  LR+G S   F  +  ++++SL+    
Sbjct: 516 GQKL-KVFTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPNKRNSLDI--- 571

Query: 590 RSTSGKSIPENTSSNTKSHRRSTSSFSFVPENNDYEL---------------IEDIQKE- 633
                     +TSS++   +   SS   + E N Y                 ++ +Q++ 
Sbjct: 572 ---------SSTSSHSNGFKFRVSSSESIEEENVYPRFSHSRSSSSASIVSDLDQLQQDD 622

Query: 634 -------KPXXXXXXXXXXXXXXXIQKRVKDLI-NADDIPNRSSATGYG 674
                  K                IQKRV+DL+ N+ D P + +A GYG
Sbjct: 623 TGAKNYYKSHSPVKVSATQGSRSSIQKRVQDLLKNSQDSPVKKTAHGYG 671

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/719 (44%), Positives = 417/719 (57%), Gaps = 62/719 (8%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MN PQIE + SG IL VGSH  KV+KYL SGG+A VY VEISP DP    N+ACLKRV+V
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLNTLRAEVD+MK L+ N+ +VSYIDSHA+KS +  G YEV++LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MN+RLQ+RL E EIL IMS  SQG+AAMH LQP L+HRDIKIENVL+S+N+E+K+CDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V G++R P+N +EFN+V +DIMKNTTAQYR PEM+DL +GLPI+EKSDIWALGVFLYK C
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKN-GESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRI 299
           YYTTPFEKN GE+AIL ++F++P+YP YSDR+KNLI VML  +P  RPN+CQV+EEVSR+
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QGIPCPIKNFYLLRMMDKQ----EQP--RVSPPPHVPQMXXXXXXXXXXXXQHLPPQVVS 353
           QGIPCPI+NFYLLR M+      EQP   V  P  + Q               LP   + 
Sbjct: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQ--PSTQMNLASLNDTLPTAALK 358

Query: 354 NVQTPSKTASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTSSDPFSK-ID 412
             QT +   + QH P+L  +++ P+ T    ++      K  P  +   +S    S    
Sbjct: 359 FNQT-TIPPTNQHSPHLLHTQTLPLPTNDHPVAISHVQDKISPHELLKKSSKSLGSTGTS 417

Query: 413 RSALLSTSA--TMESLPRAMRIPQLEYQQPHLLTXXXXXXXXXXXXXXXNGRGAISSILA 470
              ++ TSA      L  A +   L Y QP  +                + + +  SI  
Sbjct: 418 NKNVIDTSAPDHFTKLLHASKNTDLSY-QPVTVPTSSSLYNLPRANLSSSPQKSWKSIND 476

Query: 471 SNRTSLDRPKYVDSETQTSDHPSELGXXXXXXXXXXXXXXXXXXXXXXXXXGGSLTRKIG 530
           +   S     YVD ETQT    S                            G SL RK+ 
Sbjct: 477 NYDVSKRPTNYVDEETQTYTGQSTF-LRRTSSNRSNRSISSQYSGVQENTTGSSLVRKLS 535

Query: 531 SKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTG----------DSSSR 580
            K+K V+TGE     +I+S QNTG+S++SA N++R G     FTG          D+  R
Sbjct: 536 VKLKNVLTGE-----SIKSRQNTGDSIRSAMNSIRSG-----FTGNNNNTRSASYDNGKR 585

Query: 581 KSSL------------EARKYRSTSGKSIPENTSSNTKSHRRSTSSFSFVPENNDYELIE 628
            SS+            ++ ++      S+  NT  + + H R T + S           E
Sbjct: 586 LSSVNLHMHSAILEQDDSDEFEMPRYNSVSSNTLKDVEEHERRTVNTSSR---------E 636

Query: 629 DIQKEKPXXXXXXXXXXXXXXXIQKRVKDLI-NADDIPNRS--SATGYGKYTDIGRKTD 684
             + + P               IQKRV+DL+ NA++    +  +A+GYGKYTD  +  D
Sbjct: 637 YYRSQSP---VRMSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKD 692

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  519 bits (1336), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 278/509 (54%), Positives = 334/509 (65%), Gaps = 37/509 (7%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQP+I  Y  G ILPVGSHQ K+LKYL SGGFA VY VEISP D     N+ACLKRV+V
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKS----PVNVGMYEVYLLMEYCSGGG 116
           PDK SLN  RAEV++MK LR NK++VSYIDSHA KS     V  G YEV+LLMEYCSG G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLC 176
           LIDFMNTRLQNRL+EFEILNIMS VSQGVAAMHALQPPL+HRDIKIENVL+S  +EFKLC
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFL 236
           DFGSV GVIR P N  E ++VQ+DI+KNTTAQYR PEM+ L + +PI+EKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
           YK CYYTTPFEK GE+AIL S++++PAYP+YSD +KNLI VML VDP KRPNICQVVEEV
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SRIQGIPCPIKNFYLLRMMDK--------QEQPRVSPPPHV------PQMXXXXXXXXXX 342
           SR+QG+PCP+KNFYL R + +          Q    PP H+      P +          
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNIGLS 360

Query: 343 XXQHLPPQVVSNVQTPSKTASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNY 402
               L     S +QT + T+ I + PY   + S    T Q + + ++    T P+   N 
Sbjct: 361 NINFLQNVNNSAIQTANTTSRINNNPYSLHNSSTLQNTPQTIAADRRYPVSTAPKQQHNI 420

Query: 403 TSSDPFSKIDRSALL-STSATMESLP------------RAMRIPQLEYQQPHLLTXXXXX 449
            + +  ++I+   L  S SATM   P            R + + +L+      +T     
Sbjct: 421 PAYN--NQINDITLQKSLSATMADAPVSTINISDNAFDRGLHLSELQKS----VTALNND 474

Query: 450 XXXXXXXXXXNGRGAISSILASNRTSLDR 478
                      GRG ISSIL SN  SLD+
Sbjct: 475 MNHIYSQKQEGGRGKISSILNSNPNSLDQ 503

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  501 bits (1289), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 226/328 (68%), Positives = 278/328 (84%), Gaps = 1/328 (0%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQP+I+ Y  GTILPVGSHQV+++KY+ SGGFA +Y+VEISPPD  C  N+ACLKRV+V
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLNTLRAEVD+MK LR NK +VSYIDSHA+KS  N G YEV+LLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRL E E+L+I SQV+QG+AAMHALQPPL+HRDIKIENVL+SK++++K+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           VSG+IR P N +E  YVQ+D++KNTTAQYR PEMID YRGLPIDEKSDIWA+GVFLYK C
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEKN-GESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRI 299
           YYTTPFEKN GE+AIL++++E+P +P YS+R+K+LI  ML  +P +RPNI QV+EE+S++
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QGIPCPIKNFYLLRMMDKQEQPRVSPPP 327
           Q +PCPI NFYL+    K +  ++ P P
Sbjct: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIP 328

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  510 bits (1314), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 234/316 (74%), Positives = 265/316 (83%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQP+I  Y  GT+L VGSH  KV+ YL SGGFA VYS EI P D     NVACLKRV+V
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLNTLRAEVD+MK LR NK +VSYIDSHA KS    G YEV+LLMEYC+GGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRLQEFEILNIMSQV+QG+AAMHALQPPLIHRDIKIENVL+S   ++K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V GVIR P+N +EF YVQ+D++KNTTAQYR PEMIDLYRG PIDEKSDIWALGVFLYK C
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK GE AIL S+F+FPA P YSDR+K LI  ML  +P +RPN+CQV+E+VSR+Q
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 GIPCPIKNFYLLRMMD 316
           GI CP++NFYLLR M+
Sbjct: 301 GIQCPVRNFYLLRAME 316

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (83%)

Query: 460 NGRGAISSILASNRTSLDRPKYVDSETQTSD 490
           +GRG IS I+ SNRTS DRP+YVDS TQTSD
Sbjct: 424 HGRGNISQIVESNRTSFDRPRYVDSVTQTSD 454

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  510 bits (1313), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 232/320 (72%), Positives = 268/320 (83%), Gaps = 1/320 (0%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MN PQI  Y  GTIL VGSH  K++KYL SGGFA VYS EISPPDP    N+ACLKRV+V
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK  LNTLRAEVD+MK L+ NK +VSYIDSHA KS VN   YEV++LMEYC  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEYCERGGLIDF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRL+NRLQE EIL+IM Q  QG+AAMHALQPPLIHRDIKIENVL+S    +K+CDFGS
Sbjct: 120 MNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGS 179

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           VSGVIR P+N +EFNYVQ+DI+ NTTAQYR PEMIDLYRGLPIDEKSDIWALGVFLYK C
Sbjct: 180 VSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK GE+AIL +++++P++P+YSDR+KNLI +ML   P +RPNICQV+EEVSR+Q
Sbjct: 240 YYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 GIPCPIKNFYLLRMMDKQEQ 320
             PCPI+NFYLLR M++  Q
Sbjct: 300 NRPCPIRNFYLLRAMNQNAQ 319

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 61/115 (53%), Gaps = 8/115 (6%)

Query: 474 TSLDRPK-YVDSETQTSDHPSELGXXXXXXXXXXXXXXXXXXXXXXXXXGGSLTRKIGSK 532
           ++++RP  YVDSETQT D  + L                          GG + R + SK
Sbjct: 455 STINRPNNYVDSETQTLDSIATLKLKPSPTISNKTTGFSKESTVPENVTGGKIVRSLSSK 514

Query: 533 MKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDS--SSRKSSLE 585
           +K+VITGE R  S I+S QNTG+S++SAF  LR G     FTG S  +SR +S +
Sbjct: 515 LKRVITGESRNGSPIKSRQNTGDSIRSAFGMLRHG-----FTGSSINNSRSTSFD 564

 Score = 39.7 bits (91), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 10/57 (17%)

Query: 651 IQKRVKDLIN-ADDIPNRSSATGYGKYTDIGRKTDISDHHKSNANRKSSTVITPVHE 706
           IQ+RV +L+N ++D  +  SA+GYGKYTD   ++          NR+SS  ITP+ E
Sbjct: 671 IQRRVHNLLNNSEDSLSYKSASGYGKYTDTEAES---------TNRQSSVRITPITE 718

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  504 bits (1298), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 264/496 (53%), Positives = 330/496 (66%), Gaps = 37/496 (7%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQ   + +  GT+L VGSH+VKV+KYL SGGFA +Y  E+  PD    D VACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKD-VACLKRVHV 59

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLNTLRAEVD+MK LRGNK IVSYIDSHA+KS +N G YEV LLMEYCS GGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQ+RL+EFE+L IM+QV QG+ AMHALQPPLIHRDIKIENVL+++N + K+CDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V GVIR P+NT E +YVQ+DI+KNTTAQYR PEMIDLYRG  +DEKSDIWALGVFLYK C
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK GE AIL + F+FP+YP+YS+R+KNLI+VML  +P+ RPN CQV+EEV RIQ
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMXXXXXXXXXXXXQHLPPQVVSNVQTPSK 360
           G PCP+KNFYL R + +Q                            +P Q+  +V  P  
Sbjct: 300 GQPCPVKNFYLERSLKQQ----------------------------IPSQLRHSVSQPMI 331

Query: 361 TASIQH--LPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTSSDPFSKIDRSALLS 418
             + Q   +P + + + Q  V   + ++     G   P +  N    D   ++ ++ LLS
Sbjct: 332 AMNPQQAKIPIV-IPQVQNSVLPSNTMNMGYVTGAFQPASQPNEVRGDTALRVSKAKLLS 390

Query: 419 TSA----TMESLPRAMRIPQLEYQQPHLLTXXXXXXXXXXXXXXXNGRGAISSILASNRT 474
           T+     T   +P +    +   +  HL T               +GRG I+ I+A+N  
Sbjct: 391 TACDWDKTQNFVPGSNYNSKASVESGHLPT-SSLPTPRSSVSPVRSGRGNINKIIAANPI 449

Query: 475 SLDRPKYVDSETQTSD 490
           ++ RP YVDSE QT+D
Sbjct: 450 NIKRPVYVDSEMQTTD 465

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  501 bits (1290), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 230/317 (72%), Positives = 264/317 (83%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQP++++   GT L VG+H VK+LKYL SGGFA +Y+VEI         NVACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLN LRAEVD+MK L  NK +VSYIDSHAT+SP N G YEV+LLMEYC GGGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRL E EIL+IMSQ +QG+A MHAL PPL+HRDIKIENVLLSK   +K+CDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           VSGVIR PRN +E  YVQ+DIMKNTTAQYRCPEM+DLYRGLPIDEK+DIWALGVFLYK C
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK GE AIL ++F+FP++P YSDR+KNLI  MLR  P  RPN+CQV+EEVSR+Q
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 GIPCPIKNFYLLRMMDK 317
            +PCPI+NFYLLR M+K
Sbjct: 301 NVPCPIRNFYLLRAMEK 317

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  499 bits (1285), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 229/332 (68%), Positives = 270/332 (81%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQP I  Y +GT+L VG+H+  + KYL SGGFA +Y+VEI+P D     NVACLKRV+V
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           P K+ LNTLRAEVD+MK L+ N+ +VSYIDS+A KS  N G YEV LLMEYC GGGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MN+RLQNRL E EILNI+SQ +QGVA MHALQP L+HRDIKIENVL S N EFKLCDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V G IR PRN +E +YVQ+DI+KNTTAQYRCPEM+DLYRGLPIDEKSDIWALGVFLYK C
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK GE+AIL SKF++PA+P YSDR+KNLI VML  +P KRPNIC+++EE+S IQ
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQM 332
           G+PCPI+NFYL+R      Q ++     VP++
Sbjct: 301 GVPCPIQNFYLIRAQQLANQIQLQRQTTVPKI 332

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (62%), Gaps = 7/64 (10%)

Query: 522 GGSLTRKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRK 581
           G S  +K  +K+K+V+TGE R  S IRS Q+TG SV+SAF A+R       FTG  S R 
Sbjct: 482 GDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSAFGAIRGA-----FTG--SMRA 534

Query: 582 SSLE 585
            SL+
Sbjct: 535 PSLD 538

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  499 bits (1284), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 262/494 (53%), Positives = 326/494 (65%), Gaps = 28/494 (5%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQ   +    G IL VGSH+VK+++YL SGGFA +YS E+  P P+   ++ACLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPI-QGSLACLKRVHV 59

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLNTLRAEVD+MK L+G++ +VSYIDSHA KSP + G YEVYLLMEYC  GGLIDF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MN+RLQ RL EFE+L IMS V+QG+ AMHAL PPLIHRDIKIENVL+S + +FK+CDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           VSGVIR P+N  EFNYVQ+DI+KNTTAQYR PEMIDLYR LP+DEKSDIWALGVFLYK C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           Y+TTPFEK GE+AIL +KF+FP+YP+Y+DR+KNLISVML   P++RPNICQV+EEVSRIQ
Sbjct: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299

Query: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMXXXXXXXXXXXXQHLPPQVVSNVQTPSK 360
           G+PCP+ NFYL RM      P V      P +                PQ  +N  +P  
Sbjct: 300 GVPCPLPNFYLERMKHGACTP-VHHSASQPALPLATHQFSTSTPMVTHPQPPANQMSP-- 356

Query: 361 TASIQHLPYLHVSKSQPMVTQQD-LLSQKQPAGKTVPQTVSNYTSSDPFSKIDRSALLST 419
                 LP+      QP+ +    ++    P  K +P+        +P + I ++AL S 
Sbjct: 357 ------LPH----GIQPITSNMVYMMHNTTPNIKDIPR-------ENPAATIQKNALYSM 399

Query: 420 SAT--MESLPRAMRIPQLEYQQPHLLTXXXXXXXXXXXXXXXNGRGAISSILASN-RTSL 476
           S +  + +L   M   + + +  H  +                 R  I   L+    TS 
Sbjct: 400 SGSEHLSALSSDMHFNRPQLENSHTFSGVGPRSSSNPIKIP---RNEIQKFLSGTPPTSA 456

Query: 477 DRPKYVDSETQTSD 490
            +P YVDSETQT D
Sbjct: 457 KKPTYVDSETQTGD 470

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  494 bits (1271), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 230/328 (70%), Positives = 264/328 (80%), Gaps = 6/328 (1%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQPQI  Y  GT+L VGSH+V+V+KYL SGGFA +Y+V+ISPPD     NVACLKRV+V
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLNTLRAEVD+MK LR N  +VSYIDSHA K   N G YEV+LLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQ RL+E EILNIMSQV+QG+AAMHAL PPL+HRDIKIENVLL+   E+K+CDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V G+IR P N +E +YVQ+DIMKNTTAQYR PEMIDLYRGLPIDEKSDIWALGVFLYK C
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEKNGE+AIL + F+FP YP+YSDR+K LI+ ML   P +RPN  QV+EEVS +Q
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 GIPCPIKNFYLLR------MMDKQEQPR 322
            + CPI NFYL+        M  Q QP+
Sbjct: 301 NVQCPIPNFYLMNNNVTQGQMAMQTQPQ 328

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  493 bits (1269), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 223/318 (70%), Positives = 260/318 (81%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQP I  Y  GT+L VGSH  K++KYL SGGFA +Y+ EISP +P      ACLKRV+V
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDKA LNTLRAEVD+MK L+ N+ +VSYIDSHA +S V  G YEV+LLMEYC GGGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRL E EILNI+SQ  QGV+AMHALQP LIHRDIKIENVL+S   EFK+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V   IR PRN +E  YVQ+D++KNTTAQYR PEM+DLYRGLPI+EKSDIWALGVFLYK C
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK GE+AIL S++++PA+P Y+D++KNLI   L  DP KRPNICQ++EE+SRIQ
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 GIPCPIKNFYLLRMMDKQ 318
           GIPCPI NFYL R ++ Q
Sbjct: 301 GIPCPINNFYLSRTINVQ 318

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 88/172 (51%), Gaps = 26/172 (15%)

Query: 522 GGSLTRKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRK 581
           GGS+T+   S +K+V+TGE R  S IRS QNTG S++SAF+ALR GI     TG+++SR 
Sbjct: 467 GGSITQFFTSTLKRVVTGESRNTSPIRSRQNTGGSIRSAFDALRSGI-----TGNTNSRV 521

Query: 582 SSLEARKYRSTSGKSIPENTSSN----------TKSHRRSTSSFSFVPEN--NDYELIED 629
           SSL +     +S     +++ ++           K+HRRS      VP N  +D+   ED
Sbjct: 522 SSLASSVRNVSSSSKHSKHSDADDEPNKIKIRMKKAHRRS------VPPNLYSDFYANED 575

Query: 630 IQK-EKPXXXXXXXXXXXXXXXIQKRVKDLINA--DDIPNRSSATGYGKYTD 678
             K                   IQ RVK L+    ++     +A+GYGKYTD
Sbjct: 576 TPKLYSSNSPVKLKSLSTQRESIQNRVKALLETFEEEPSTIKTASGYGKYTD 627

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  487 bits (1254), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 259/315 (82%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQPQ+  Y  GT+L VGSHQ +++KYL SGGFA VY+ EISP DP    ++ CLKRV+V
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLNTLRAEVD+MK LR N  +VSYIDSHA K   N+G YEV+LLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRL E EIL+IMSQVSQGVAAMHALQPPL+HRDIKIENVLL+    +KLCDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V G+IR P N +EF YVQ+DIMKNTTAQYR PEMI+L +GLPI+EKSDIWALGVFLYK C
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK GE+AIL + F+FP +P YSDR+K+LI + L V P +RPNI Q++EEVS+IQ
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 GIPCPIKNFYLLRMM 315
            +PCPI +FYL R +
Sbjct: 301 NVPCPIPDFYLQRKL 315

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  489 bits (1260), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/318 (67%), Positives = 263/318 (82%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQP I+ Y  GT L VG HQV ++KYL SGGFA +Y V+++PP+P+   N+ACLKRV+V
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           P+K+ LNTLRAEV++M+ L+G   +V YIDS+A +S  N G YEV  LME+C GGGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRL+EFE+LNIM+QV+QG+ AMH+L PPLIHRDIKIENVL+S N E+K+CDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           VSG+IR P+NTEEFN+VQ DIMKNTTAQYRCPEM+DLYRG PI+EKSDIWALGVFLYK C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFE  GE AIL +++++P YP YS R+KNLI +ML   P +RPN+CQV+EEVS +Q
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 GIPCPIKNFYLLRMMDKQ 318
           GIPCP+ NFYL R    Q
Sbjct: 301 GIPCPLPNFYLQRQQATQ 318

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  484 bits (1247), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 223/317 (70%), Positives = 260/317 (82%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQP I  Y  G  L VG H   +LKYL SGG+A VY  +ISPPD     ++ CLKR++V
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDKASLNT RAEVD+MK LR    +VSYIDS+A KS ++ G YEV LLME+C+ GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRLQEFEILNIMSQV+QGVAAMH+L+PPL+HRDIKIENVL+S + E+KLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V GVIR P + +EFN+VQ+DI+KNTTAQYR PEMIDL R LPIDEKSDIWALGVFLYK C
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK GE+AIL S++E+ AYP YSD +KNLI +ML   P +RPNICQV+EEVSR+Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 GIPCPIKNFYLLRMMDK 317
           GIPCPIKNFYL R + +
Sbjct: 301 GIPCPIKNFYLERAIHR 317

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 21/28 (75%), Gaps = 1/28 (3%)

Query: 651 IQKRVKDLI-NADDIPNRSSATGYGKYT 677
           IQ R+K+LI NAD+IP    A+ YGKYT
Sbjct: 588 IQDRMKNLIDNADNIPINKIASDYGKYT 615

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  481 bits (1239), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 217/309 (70%), Positives = 260/309 (84%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQPQI  Y  GT L VGSHQV+++KYL SGGFA VYSV ISPPDP    NVACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLNTLRAEVD+M+ L+ N+++VSYIDSHA K+ +  G YEV++LMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRL EFEIL I+SQV+QGVAAMHALQPPLIHRDIKIENVL+S N+E+KLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V G+IR PRN++E +YVQ DI+KNTTAQYR PEMID++RGLPIDEKSDIWALG+FLYK C
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK GE AIL+ KFEFP YP YS+++K+LI  +L  +P  RP++ Q+++ +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 GIPCPIKNF 309
            +PCPI + 
Sbjct: 301 NVPCPINDI 309

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  481 bits (1239), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 236/419 (56%), Positives = 296/419 (70%), Gaps = 25/419 (5%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQPQI  Y  GT L VGSHQV+++KYL SGGFA VYS  ISPPDP    N+ACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLNTLRAEVD+M+ LR N+++VSYIDSHA K+ ++ G YEV++LMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRL EFEIL IMSQV+QGVAAMHALQPPLIHRDIKIENVL+S N+E+KLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V GVIR PRN +E +YVQ DI KNTTAQYR PEM+D++RGLPIDEKSDIWALG+FLYK C
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK GE AIL+  FEFP YP YS+++++LI  +L  +P +RPN+ Q+++ +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMXXXXXXXXXXXXQHLPPQVVSNVQTPSK 360
            +PCPI +                    VPQ                      N+++ + 
Sbjct: 301 NVPCPISDI------------------QVPQAPDSHLNLTELHQL----SATQNIRSLNS 338

Query: 361 TASIQH-LPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTSSDPFSKIDRSALLS 418
            ++I+  +P      S P    Q L S+K+   +T   T  NY++ +P + +D+S  +S
Sbjct: 339 HSTIERPIPNAAFQSSMPDAATQTLFSRKK--SQTSDNTTLNYSAENPQTSLDKSESVS 395

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  484 bits (1245), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 217/315 (68%), Positives = 262/315 (83%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MN P+I  Y  GT+L VG+H  K+LKY+ASGGFA VYS E+ P D     N  CLKRV++
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           P+KA LN LRAEV++MK L+G+K +V YIDSHA +S +  G YEV+LLME+C+ GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRL+E+EILNIMSQV+QG+AAMHALQPPLIHRDIKIENVL+S + E+K+CDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           VSG IR PRN +EF +VQ+DI+KNTTAQYR PEMIDLYR   IDEKSDIWALG+FLYK C
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK G+ AIL S+++F A+P YSDR+KNLIS ML   P++RPNICQV+EEVSR+Q
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 GIPCPIKNFYLLRMM 315
           G+  P++NFYLLR M
Sbjct: 301 GVSSPMRNFYLLRAM 315

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  479 bits (1234), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 216/313 (69%), Positives = 261/313 (83%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQPQI  Y  GT L VGSHQV+++KYL SGGFA VYS  I+PPDP    +VACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLNTLRAEVD+M+ L+ N+++VSYIDSHA K+ ++ G YEV++LMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRL EFEIL IMSQV+QGVAAMHALQPPLIHRDIKIENVL+S N+E+KLCDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V G+IR PRN++E +YVQ DI+KNTTAQYR PEMID +RGLPIDEKSDIWALG+FLYK C
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK G+ AIL+ KFEFP YP YS+++K LI  +L  DP  RPN+ Q+++ +S +Q
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 GIPCPIKNFYLLR 313
            +PCPI +  +++
Sbjct: 301 NVPCPINDIQVVQ 313

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  471 bits (1211), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 217/311 (69%), Positives = 252/311 (81%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQP I  Y  GT L VGSHQV+++KYL +GGFA +Y   ISP DP    N+ACLKRV+V
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLN LRAEVD+MK LR N+ +VSYIDSHA KS    G YEV+LLMEYC  GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           +N+RLQNRL+E E++NIM  VSQGVAAMHALQPPL+HRDIKIENVLLSKN+EFKLCDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           VSG IR P N +E   VQ DIM+NTTAQYR PEMID+ RG PIDEKSDIWALGVFLYK C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK+GE+ IL S++EFPA+P YSDR+++LIS +L V P  RPNI  VV+E+S ++
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 GIPCPIKNFYL 311
            I CPI NFYL
Sbjct: 301 NISCPIINFYL 311

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  466 bits (1200), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 211/308 (68%), Positives = 255/308 (82%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQPQI  Y  GT L VGSHQV+++KYL SGGFA VYS  ISPPDP    NVACLKRV+V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLNTLRAEVD+MK LR N+++VSYIDSHA K+ ++ G YEV++LMEYC  GGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRL E EIL IM QV+QGVAAMHALQPPLIHRDIKIENVL+S  +E+KLCDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V GVIR PRN +E +YV+ D++KNTTAQYR PEM+D++RGLPIDEKSDIWALG+FLYK C
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK GE AIL  +FEF  YP YS++++NLI  +L  +P +RPN+ Q++++++ +Q
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 GIPCPIKN 308
             P PI++
Sbjct: 301 NAPYPIRD 308

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  466 bits (1199), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 211/316 (66%), Positives = 259/316 (81%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQ Q+  Y   T++ VGSH  K++KYLASGG+A VYS  ++P D     N+ACLKRVVV
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK SLN LRAEVD++K LR  K++VSYIDSHA+K   + G YEV++LMEYCSGG LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           +NTRL+NRL+E EIL+IM+QV+ GVA MH LQP LIHRDIKIEN+L+S+N E+K+CDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           V GVIR PR+ EE  Y+Q+DIMKNTTAQYR PEM+DL +G  I+EKSDIWALGVFL+K C
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFEK GE AIL S+F++PAYP YSD +KN+I V+L VDP KRPNICQ++EE+SR+Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 GIPCPIKNFYLLRMMD 316
           GI  P+KNFYL R ++
Sbjct: 301 GIVPPMKNFYLSRALE 316

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 82/159 (51%), Gaps = 17/159 (10%)

Query: 522 GGSLTRKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRK 581
           G SL R +  K+K VITGEKR  S +RS QNTG S +S F  L +G     FTG  +SR 
Sbjct: 501 GISLVRTLSKKLKNVITGEKRSVSPVRSRQNTGGSSRSVFTVLHEG-----FTG-GNSRI 554

Query: 582 SSLEARKYRSTSGKSIPENTSSNTKSHRRSTSSFSFVPENNDYELIEDIQKEKPXXXXXX 641
           SS E    R  S  S     SS+TK+         F+ ++ D  ++E  +  +P      
Sbjct: 555 SSSE-HTIRGPSSSSHKSRVSSSTKNFEE-----GFIRKHVD--IVE--ESAEPKVGIKL 604

Query: 642 XXXXXXXXXIQKRVKD-LINADDIPNRSSATGYGKYTDI 679
                    I++RV++ L+ ++D     +A+GYGKYTD+
Sbjct: 605 KTTREAKDSIKRRVRELLLVSEDEQYHRTASGYGKYTDV 643

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  477 bits (1227), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 214/318 (67%), Positives = 260/318 (81%), Gaps = 6/318 (1%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDN----VACLK 56
           MNQP+I KY  G +LP+G+HQV + KYLA GGFA VYSV +   D     N    +ACLK
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVI--DSSNARNELGTMACLK 58

Query: 57  RVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGG 116
           RV+VPDK+ LNTLRAEVD+MK L+GNK+IVSYIDSHA +S +  G YEV+LLMEYCS GG
Sbjct: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118

Query: 117 LIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLC 176
           +IDF+NTRL +RLQEFEIL IMS V QGVAAMH LQPPLIHRDIKIENVL+S+N ++K+C
Sbjct: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178

Query: 177 DFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFL 236
           DFGS   V+R P+  +E  ++ +DIM NTTAQYR PEMID Y G PIDEKSDIWALGVFL
Sbjct: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238

Query: 237 YKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
           YK CYYTTPFEK GE+AIL  KF+FP+YP+YSD ++N+I++ML  DP+KRPNICQV+E+V
Sbjct: 239 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298

Query: 297 SRIQGIPCPIKNFYLLRM 314
           S++QG+PCPI+NF L R+
Sbjct: 299 SKLQGVPCPIENFMLTRI 316

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  435 bits (1118), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 239/311 (76%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MN P I KY  GT + VGSH V +LKYL SGG+A +YS +I P D     N+A LKRV+V
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           PDK+ LNTLRAEVD+MK L+ +K+IVSYIDSHA KS    G YEV+L+MEYCS GGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNTRLQNRL E EIL I   +SQGVAAMH LQPPLIHRDIKIENVL+S +H++KLCDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           VSG IR P+  EE  YV++DIM +TTAQYR PEM+DL +G  +++KSDIWALGVFLYK C
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFE+ GE+ IL    EFP YP YSD VK LI  ML  +PL RPNI Q+++ VS++ 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 GIPCPIKNFYL 311
            + CPI N ++
Sbjct: 301 NVNCPIPNIHV 311

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  414 bits (1065), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 193/325 (59%), Positives = 241/325 (74%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           M+Q   +KY  GT L V SH+V +  YL SGGFA VY+  I+         + CLKRV+V
Sbjct: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           P+K SLN LRAEVD+MK L+ NK+IVSYIDSHA +   +   Y V LLMEYCSG GL+DF
Sbjct: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MN RL+ RL+E EIL IM+ VSQGV  MH LQPPL+HRDIKIENVLLS +  FKLCDFGS
Sbjct: 121 MNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
           VSGV+R+P ++EEF Y+Q DI+KNTTAQYR PEM++L  G PI+EKSDIWALG+ LYK C
Sbjct: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240

Query: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           YYTTPFE++G  AI+  KF +PAYP+Y+D +KN+I V+L  +P++RPNICQ++EE+ RIQ
Sbjct: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300

Query: 301 GIPCPIKNFYLLRMMDKQEQPRVSP 325
               P+ NFY+ R M   +     P
Sbjct: 301 HKSSPLPNFYVQRAMSSLQMDTTQP 325

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 84/177 (47%), Gaps = 15/177 (8%)

Query: 522 GGSLTRKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRK 581
           GGSL + +G+K+K   TG KR  S I+S QNTG+S++SAFN +R+GI+        SSR 
Sbjct: 504 GGSLIKSLGTKIKLTTTGGKRSQSPIKSRQNTGDSIRSAFNKVRQGINL------RSSRI 557

Query: 582 SSLEARKYRSTSGKSIPENTSSN-----TKSHRRSTSSFSFVPENNDYELIEDIQKEKPX 636
           SS ++    S     IPE ++ N     T S  R   +      +   +    +      
Sbjct: 558 SSNDSVVRNSEQFGGIPELSNDNKYQFDTTSKNRHEYNSLSRKLSLSSQKQNSLNDSTSN 617

Query: 637 XXXXXXXXXXXXXXIQKRVKDLI-NADDIPNRSSATGYGKYTDIGRKTDISDHHKSN 692
                         I+ RV+ L+ ++ D     SA GYGKYTD   K+ I  H KSN
Sbjct: 618 DPIILITNLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYTD--NKSSIK-HFKSN 671

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  412 bits (1060), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 241/318 (75%), Gaps = 10/318 (3%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60
           MNQP I  Y  G ++ VGSHQ K+LKYL SGGFA +YSVEISP D     N+ACLKRV+V
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120
           P+K+ LN LR EVD+MK L+ N+ +VSYIDS+A KS    G YEV+LLMEYC  G L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180
           MNT+L+ RLQE E+LNIM+QV QG+AAMH L PPLIHRDIKIENVL+S +  FK+CDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEK-----SDIWALGVF 235
           V G+IR PRN +E  YVQ+D+MKNTTAQYR PEMIDL +G PI+ K     S   AL + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 236 LYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEE 295
           L    +YT  F ++ E AIL  ++++PAYP YSDR+KN++ V+L   P+KRPNICQ++EE
Sbjct: 241 L---LHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEE 295

Query: 296 VSRIQGIPCPIKNFYLLR 313
           +S+IQ IPCPI NFYL R
Sbjct: 296 ISKIQNIPCPIDNFYLER 313

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 97/236 (41%), Gaps = 38/236 (16%)

Query: 467 SILASNRTSLDRPKYVDSETQTSDHPSELGXXXXXXXXXXXXXXXXXXXXXXXXXGGSLT 526
           +I A N T      YVDSETQT + PS                            G S+ 
Sbjct: 443 NIPAQNSTGSKNKTYVDSETQTLEEPS----------LQHTRILPHISTDRTDNTGNSIV 492

Query: 527 RKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRKSSLEA 586
            ++G +++ VIT +    S+I + Q TG S+KSA  +L+  +S M    ++    S   A
Sbjct: 493 SRLGVQLRNVITNDSSASSSIDTVQETGNSIKSAIESLKNSVSGM---ANNVKALSVENA 549

Query: 587 RKY--RSTSGKSIPEN----------------TSSNTKSHRRSTSSFSFVPENNDYELIE 628
           R +  R  S  SI  N                T+  + S + + SS +    +++ EL +
Sbjct: 550 RNHLERLGSSYSIGSNNNIAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSELSDENELYD 609

Query: 629 DIQKEKPXXXXXX------XXXXXXXXXIQKRVKDLI-NADDIPNRSSATGYGKYT 677
            +    P                     I+KRV +L+ NA+D P + +A GYGKYT
Sbjct: 610 TLHLPDPKTSFQSPSPLKYAVDRKMKASIEKRVLNLLKNAEDSPVKKTAAGYGKYT 665

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  311 bits (798), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 206/325 (63%), Gaps = 22/325 (6%)

Query: 7   EKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI--------SPPD------------- 45
           EK+  G ++ VG H+V+++KYLA GGFA +YSV          + PD             
Sbjct: 17  EKFNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQF 76

Query: 46  PVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEV 105
            + P N+ACLKRV+VPD+  LN LR EV+ M+ L+G   IV Y DS+A++       +EV
Sbjct: 77  KLEPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEV 136

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
            LLME C    L+D+MN RL  +L E EIL IM  V+ G++ MH LQ PLIHRDIKIENV
Sbjct: 137 LLLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENV 196

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDE 225
           L+  ++ FKLCDFGS S       + +E   +  +I  +TT QYR PEMIDLYR LPIDE
Sbjct: 197 LVDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDE 256

Query: 226 KSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLK 285
           KSDIWALGVFLYK  +YTTPFE  G+ AIL SK+E P    YS R+ NLI +ML  +P  
Sbjct: 257 KSDIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPNL 315

Query: 286 RPNICQVVEEVSRIQGIPCPIKNFY 310
           RPNI QV+ +V    GI  PIK+ Y
Sbjct: 316 RPNIYQVMHQVCITIGIEPPIKDKY 340

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  309 bits (791), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 157/315 (49%), Positives = 205/315 (65%), Gaps = 9/315 (2%)

Query: 4   PQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI--------SPPDPVCPDNVACL 55
           P +EK A GT++ VGSH+V+++KYLA GGFAH+Y V+         +P   +   ++ACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 56  KRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGG 115
           KRV+V D+  LN LR EV+ MK L+ +  IV Y DS+A++       YEV LLME C   
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 116 GLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKL 175
            L+D+MN RL  +L E E+L IM  V++ VA MH L  PLIHRDIKIENVL+   + FKL
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 176 CDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVF 235
           CDFGS S         ++   +  +I  +TT QYR PEMIDLYR LPIDEKSDIWALG+F
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 236 LYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEE 295
           LYK  +YTTPFE  G+ AIL SK++ PA   YS ++ NLI +ML  +P  RPNI QV+ +
Sbjct: 267 LYKLLFYTTPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325

Query: 296 VSRIQGIPCPIKNFY 310
           V  I  +  P ++ Y
Sbjct: 326 VCAIMKVDVPFEDKY 340

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  306 bits (785), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 163/326 (50%), Positives = 209/326 (64%), Gaps = 20/326 (6%)

Query: 6   IEKYASGTILPVGSHQVKVLKYLASGGFAHVYSV-----------EISP--PDPVCPDNV 52
           +EKY  G ++ VGSH+V++L+Y+A GGFA +YSV           E SP   D +   ++
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  ACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHA------TKSPVNVGMYEVY 106
           ACLKRV+V D+  LN LR EV+ MK L G   IV Y DS+A      T S      +EV 
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVL 134

Query: 107 LLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVL 166
           LLME C    L+D+MN RL  +L E EIL +M  VS  +A MH L+ PLIHRDIKIENVL
Sbjct: 135 LLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVL 194

Query: 167 LSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEK 226
           + + + FKLCDFGS S          +  Y+  +I  +TT QYR PEMIDLYR LPIDEK
Sbjct: 195 VDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 254

Query: 227 SDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKR 286
           SDIWALG+FLYK  ++TTPFE+ G+ AIL SKFEFP    YS ++ NLI VML  +P  R
Sbjct: 255 SDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPNLR 313

Query: 287 PNICQVVEEVSRIQGIPCPIKNFYLL 312
           PNI QV+ ++ +++ +P PI + Y L
Sbjct: 314 PNIYQVLHQICQLKQVPIPIADKYGL 339

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  308 bits (788), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 208/322 (64%), Gaps = 11/322 (3%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVE----------ISPPDPVCPD 50
           +N P  EKY +G ++ VG+H+V+++ YLA GGFA +Y V+          +     +   
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLME 110
           ++ACLKRV+V D+  LN +R EV+ MK L+ +  IV Y DS+A++       +EV LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKN 170
            C    L+D+MN RL+ +L E EIL IM  VS G++ MH L  PLIHRDIKIENVL+  N
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 HEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIW 230
           + FKLCD GS S       + ++   +  +I  +TT QYR PEMIDLYR LPI+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNIC 290
           ALG+FLYK  +YTTPFE  G+ AIL SK++FP   +YS ++ NLI +ML  +P  RPNI 
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIF 310

Query: 291 QVVEEVSRIQGIPCPIKNFYLL 312
           QVV  +  I  +P PI++ Y L
Sbjct: 311 QVVYHICSIMNLPVPIEDRYGL 332

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  305 bits (781), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 205/316 (64%), Gaps = 10/316 (3%)

Query: 4   PQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSV---------EISPPDPVCPDNVAC 54
           P +E+  +G+ + VG+H+V+++KYLA GGFAH+Y V         E +P   +     AC
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 55  LKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSG 114
           LKRV+V D+  LN +R EV  MK L G   IV Y DSHA++S   V  +EV LLME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 115 GGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFK 174
             L+D+MN RL  +L E EIL IM  V++ +A MH L  PLIHRD+KIENVL+  ++ FK
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 175 LCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGV 234
           LCDFGS S  +      +E   +  +I  +TT QYR PEMIDLYR LPIDEKSDIWALG+
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 235 FLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVE 294
           FLYK  +YTTPFE  G+ AIL SK+EFP    YS ++ NLI +ML  +P  RPNI Q+++
Sbjct: 264 FLYKLLFYTTPFELTGQFAILHSKYEFPI-NNYSSKLINLIIIMLAENPNLRPNIYQIMD 322

Query: 295 EVSRIQGIPCPIKNFY 310
            +  I  +  PI++ Y
Sbjct: 323 NLCSIMKVENPIEDKY 338

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  308 bits (789), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 207/321 (64%), Gaps = 10/321 (3%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI---------SPPDPVCPDN 51
           + +P ++ YA GT++ VG+ QV+++ ++A GGFA +YSV+              P+ P +
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 52  VACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEY 111
           +ACLKRV+VPD+  L+ +R EV+ MK LRG K I+ Y DS+A++       YEV LLME 
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMEL 133

Query: 112 CSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNH 171
           C    L+D+MN RL  RL E EIL +M   +  ++ MH L  PLIHRDIKIENVL+   +
Sbjct: 134 CPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQN 193

Query: 172 EFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWA 231
            FKLCDFGS S         ++   +  +I  NTT QYR PEMIDLYR LPI+EKSDIWA
Sbjct: 194 NFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQ 291
           LG+FLYK  ++ TPFE  G+ +IL SK+EFPA  +YS ++ NLI +ML  +P  RPNI Q
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQ 312

Query: 292 VVEEVSRIQGIPCPIKNFYLL 312
           V+  +  + G   PI++ Y L
Sbjct: 313 VMHHICSVIGCEVPIEDKYGL 333

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  305 bits (780), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 205/318 (64%), Gaps = 10/318 (3%)

Query: 4   PQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSV---------EISPPDPVCPDNVAC 54
           P +E+  +G+ + VG+H+V+++KYLA GGFAH+Y V         E  P   +   ++AC
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 55  LKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSG 114
           LKRV+V D+  LN +R EV  MK L G   IV Y DSHA+++      +EV LLME C  
Sbjct: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 115 GGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFK 174
             L+D+MN RL  +L E EIL IM  V++ +A MH L  PLIHRD+KIENVL+  NH FK
Sbjct: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 175 LCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGV 234
           LCDFGS S         +E   +  +I  +TT QYR PEMIDLYR LPI+EKSDIWALG+
Sbjct: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 235 FLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVE 294
           FLYK  +YTTPFE  G+ AIL SK+EFP    YS ++ NLI +ML  +P  RPNI QV++
Sbjct: 306 FLYKLLFYTTPFELTGQFAILHSKYEFPVN-NYSSKLINLIIIMLAENPNLRPNIYQVMD 364

Query: 295 EVSRIQGIPCPIKNFYLL 312
            +  I  +  P+++ Y L
Sbjct: 365 NLCSILKVKNPLEDKYQL 382

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  307 bits (786), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 155/320 (48%), Positives = 210/320 (65%), Gaps = 16/320 (5%)

Query: 6   IEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPP----DPVCPDN---------- 51
           IEK+++G  + VGSH V+++KYL  GGFA +Y V+++      D +   N          
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 52  -VACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLME 110
            + CLKRV+V D+A L+ ++ EV+ MK LRG   +V Y DS+AT++    G +EV+LLME
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLME 145

Query: 111 YCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKN 170
           YC    L+D+MN RL  +L E EILNIM  ++ GV+ +H L  PLIHRDIKIENVL+  N
Sbjct: 146 YCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHN 205

Query: 171 HEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIW 230
           + FKLCDFGS +         ++ + + +DI  +TT QYR PEMIDL+R LP++EK+DIW
Sbjct: 206 NRFKLCDFGSTNICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKADIW 265

Query: 231 ALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNIC 290
           ALGVFLYK  +YTTPFE  G+ AIL SK+E P    YS+R+ NLI VML  +P  RPNI 
Sbjct: 266 ALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQS-HYSERLLNLIVVMLAENPNLRPNIY 324

Query: 291 QVVEEVSRIQGIPCPIKNFY 310
           QV+ E+  I  +  PI + Y
Sbjct: 325 QVLSEICSILNVEVPIPDIY 344

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  302 bits (773), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 205/316 (64%), Gaps = 10/316 (3%)

Query: 6   IEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVE----ISPPDPVCPD-----NVACLK 56
           ++ Y  GTI+ VG H+V+V+KYLA GGFA +Y V+    +S  DP   +     +  CLK
Sbjct: 26  LDSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLK 85

Query: 57  RVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGG 116
           RV+V D   LN +R EV+ M+ L+G   +V Y DS+A++       YEV LLME CS   
Sbjct: 86  RVLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNS 145

Query: 117 LIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLC 176
           L+D+MN RL  +L E EIL IM  V+  VA MH L  PLIHRDIKIENVL+   + FKLC
Sbjct: 146 LLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLC 205

Query: 177 DFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFL 236
           DFGS S  +    + ++   +  +I  +TT QYR PEMIDLYR LP++EKSDIWALGVFL
Sbjct: 206 DFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFL 265

Query: 237 YKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
           YK  +YTTPFE+ G+ AIL SK+EFP    YS ++ NLI VML  +P  RPNI QV+ ++
Sbjct: 266 YKLMFYTTPFERTGQFAILHSKYEFPLN-NYSSKLINLIIVMLAENPNLRPNIYQVLNQI 324

Query: 297 SRIQGIPCPIKNFYLL 312
             I GI  P+ + Y L
Sbjct: 325 CYISGIKNPMDDAYGL 340

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  305 bits (782), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 204/318 (64%), Gaps = 15/318 (4%)

Query: 9   YASGTILPVGSHQVKVLKYLASGGFAHVYSVEI--------SPPD------PVCPDNVAC 54
           Y +GT + VGSH+V+V+KY+A GGFA +Y+V+         S P       P+ P ++AC
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 55  LKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSG 114
           LKRV+V D   LN +R EV+ M+ L+G   +V Y DS+A+    +   YEV LLME+C  
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 115 GGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFK 174
             L+D+MN RL  RL E EI+ IM   + G+A +H L+ PLIHRDIKIENVL+ + + FK
Sbjct: 219 NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 175 LCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGV 234
           LCDFGS S       N  +      +I  NTT QYR PEMIDLYR  PIDEKSDIWALGV
Sbjct: 279 LCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGV 338

Query: 235 FLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVE 294
           FLYK  ++TTPFE+ G+ AIL SK+EFP    YS ++ NLI +ML  +P  RPNI QV++
Sbjct: 339 FLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVLQ 397

Query: 295 EVSRIQGIPCPIKNFYLL 312
            +  I G   P+ + Y L
Sbjct: 398 YLCSINGWKVPLNDKYGL 415

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  303 bits (777), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 156/320 (48%), Positives = 203/320 (63%), Gaps = 12/320 (3%)

Query: 2   NQPQ-IEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI----------SPPDPVCPD 50
           N+P  +EK+A+G+ + VG+ +V+++KYL  GGFA +Y V+           +   P+   
Sbjct: 17  NKPSAVEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIG 76

Query: 51  NVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLME 110
           ++ACLKRV+V D+  LN +R EV+ MK L+G   IV Y DS+A++       +EV LLME
Sbjct: 77  DLACLKRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLME 136

Query: 111 YCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKN 170
            C    L+DFMN RL  +L E EIL IM  V+  VA MH L PPLIHRDIKIENVL+   
Sbjct: 137 LCPNKSLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQ 196

Query: 171 HEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIW 230
           + FKL DFGS S    A    ++   +  DI  +TT QYR PEMIDLY+ LPIDEKSDIW
Sbjct: 197 NGFKLADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIW 256

Query: 231 ALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNIC 290
           ALG+FLYK  +Y TPFE  G+ AIL SK++FP    YS R+ NLI +ML  +P  RPNI 
Sbjct: 257 ALGIFLYKLLFYITPFEMTGQFAILHSKYDFPQT-NYSSRLINLIIIMLSENPNLRPNIY 315

Query: 291 QVVEEVSRIQGIPCPIKNFY 310
           QV+ E+  I G    I + Y
Sbjct: 316 QVLHEICSISGTRLEITDKY 335

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  298 bits (764), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 152/313 (48%), Positives = 204/313 (65%), Gaps = 9/313 (2%)

Query: 6   IEKYASGTILPVGSHQVKVLKYLASGGFAHVYSV-------EISPPDPVCP-DNVACLKR 57
           +EK  +G+IL VG H+V++++YLA GGFAH+Y V       E+     V    ++ACLKR
Sbjct: 25  LEKLTAGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKR 84

Query: 58  VVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGL 117
           V V D+  LN LR EV+ MK L+G   +V Y DS+A++       +EV LLME CS G L
Sbjct: 85  VQVNDENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSL 144

Query: 118 IDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCD 177
           +D+MN RL  +L E E+L IM  +++G++ MH L+ PLIHRDIKIENVL+   + FKLCD
Sbjct: 145 LDYMNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCD 204

Query: 178 FGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLY 237
           FGS S  + A    +E   +  +I  +TT QYR PEMIDLYR L I+EKSDIWALG+FLY
Sbjct: 205 FGSTSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLY 264

Query: 238 KTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVS 297
           K  +YTTPFE  G+ AIL SK++ P    +S ++ NLI VML  +P  RPNI Q++  + 
Sbjct: 265 KLLFYTTPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHIC 323

Query: 298 RIQGIPCPIKNFY 310
            I     PI++ Y
Sbjct: 324 SIMECDVPIEDHY 336

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  300 bits (767), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 201/316 (63%), Gaps = 10/316 (3%)

Query: 4   PQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSV---------EISPPDPVCPDNVAC 54
           P +E++  G ++ VG+H+V+V+ YLA GGFA +Y V         E     P+   +VAC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSG 114
           LKRV+V D+  L+ +R EV+ MK L G + IV Y DS+A +       +EV LLME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFK 174
             L+D+MN RL  +L E EIL IM  VS  V+ MH L+ PLIHRDIKIENVL+   + FK
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 LCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGV 234
           LCDFGS S         +E   +  +I  +TT QYRCPEMIDLYR LPI+EKSDIWALG+
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVE 294
           FLYK  ++ TPFE  G+ AIL SK+EFP    YS ++ NLI +ML  +P  RPNI QV+ 
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVLN 315

Query: 295 EVSRIQGIPCPIKNFY 310
            +  + G+  PI++ Y
Sbjct: 316 HICTMIGVEVPIEDKY 331

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  298 bits (764), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 152/319 (47%), Positives = 203/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI---------SPPDPVCPDN 51
           M  P +E++  G I+ VG+H+V+V+ YLA GGFA +Y V+          +   P+   +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEY 111
           VACLKRV+V D+  LN +R EV+ MK L+G   +V Y DS+A++    V  +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNH 171
           C    L+D+MN RL  +L E EI+ IM  V   ++ MH L  PLIHRDIKIENVL+  N+
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 EFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWA 231
            FKL DFGS S         ++   +  +I  +TT QYR PEMIDLYR LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQ 291
           LG+FLYK  ++TTPFE  G+ AIL SK+EFP   +YS ++ NLI +ML  +P  RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VVEEVSRIQGIPCPIKNFY 310
           V+  +  I  I  PI++ Y
Sbjct: 313 VLYHLCEILNIEVPIEDKY 331

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  298 bits (763), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 202/319 (63%), Gaps = 13/319 (4%)

Query: 3   QPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI-----------SPPDPVCPDN 51
           +P  E+Y  GT + VG+H+V+++KY+A GGFA +Y+V+              P     D 
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGD- 74

Query: 52  VACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEY 111
           VACLKRV+V D+  LN +R EV+ MK L+G   IV Y DS+A++       +EV LLME 
Sbjct: 75  VACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMEL 134

Query: 112 CSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNH 171
           C    L+D+MN RL  +L E EIL IM  V+  V+ MH L  PL+HRDIKIENVL+   +
Sbjct: 135 CPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQN 194

Query: 172 EFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWA 231
            FKLCDFGS S         ++   +  +I  +TT QYR PEMIDLYR LPIDEKSDIWA
Sbjct: 195 NFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWA 254

Query: 232 LGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQ 291
           LG+FLYK  ++TTPFE  G+ AIL SK+EFP    YS ++ NLI +ML  +P  RPNI Q
Sbjct: 255 LGIFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQ 313

Query: 292 VVEEVSRIQGIPCPIKNFY 310
           V+  +  I G+  PI++ Y
Sbjct: 314 VLHNICSISGMKVPIEDQY 332

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  295 bits (756), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 202/322 (62%), Gaps = 18/322 (5%)

Query: 6   IEKYASGTILPVGSHQVKVLKYLASGGFAHVYSV-------EISPPD----------PVC 48
           IEK+  G  L VG+H+V+++ YL  GGFA +Y V       E    D           + 
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 49  PDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLL 108
             +VACLKRV+V D+  LN +R EV+ MK LRG   IV Y DS+AT+S      YEV LL
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 109 MEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLS 168
           ME CS   L+++MN RL  +L E E+L IM  V+ GVA MH L+ PLIHRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 169 KNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSD 228
            N+ FKLCDFGS +         ++   +  ++  +TT QYR PEMIDLYR LPI+EKSD
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 229 IWALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPN 288
           IWALGVFLYK  +YTTPFE  G+ A+L SKF+ PA  +YS ++ NL+ +ML  +   RPN
Sbjct: 268 IWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSENLNLRPN 326

Query: 289 ICQVVEEVSRIQGIPCPIKNFY 310
           I QV+  + ++  +  PI + Y
Sbjct: 327 IYQVMHYICQLIQVDTPILDIY 348

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  297 bits (760), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 203/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI---------SPPDPVCPDN 51
           M  P +E+Y  G I+ VG+H+V+++ YLA GGFA +Y+V+          +   P+   +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  VACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEY 111
           VACLKRV+V D+  LN +R EV+ MK L+G   +V Y DS+A++    V  +EV LLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNH 171
           C    L+D+MN RL  +L E EI+ IM  V+  ++ MH L  PLIHRDIKIENVL+   +
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 EFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWA 231
            FKL DFGS S         ++   +  +I  +TT QYR PEMIDLYR LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQ 291
           LG+FLYK  ++TTPFE  G+ AIL SK+EFP   +YS ++ NLI +ML  +P  RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VVEEVSRIQGIPCPIKNFY 310
           V+  +  I     PI++ Y
Sbjct: 313 VLYHICDILNAEVPIEDKY 331

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  296 bits (759), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 152/319 (47%), Positives = 202/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI---------SPPDPVCPDN 51
           M  P +E+Y  G I+ VG+H+V+V+ YLA GGFA +Y V+          +   P+   +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  VACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEY 111
           VACLKRV+V D+  LN +R EV+ MK L+G   IV Y DS+A++    V  +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNH 171
           C    L+D+MN RL  +L E EI+ IM  V+  ++ MH L   LIHRDIKIENVL+   +
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 EFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWA 231
            FKL DFGS S         ++   +  +I  +TT QYR PEMIDLYR LPI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQ 291
           LGVFLYK  ++TTPFE  G+ AIL SK+EFP   +YS ++ NLI +ML  +P  RPNI Q
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VVEEVSRIQGIPCPIKNFY 310
           V+  +  I  +  PI++ Y
Sbjct: 313 VLYHLCEILNVEVPIEDKY 331

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  295 bits (754), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 156/321 (48%), Positives = 205/321 (63%), Gaps = 19/321 (5%)

Query: 3   QPQIE-KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI-------------SPPDPVC 48
           QPQIE K+ +G ++ VGSH+V+V+ YLA GGFA +Y V+              S   P+ 
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 49  PDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGM----YE 104
           P + ACLKRV+V D+  LN +R+EV+ MK L+G   IV Y DS+A++     G     +E
Sbjct: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           V LLME C    L+D+MN RL  +L E EI  IM  ++  VA MH L  PLIHRDIKIEN
Sbjct: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPID 224
           VL+  N+ FKLCDFGS S    A  + ++   +  D+  +TT QYR PEMIDL++ +PI+
Sbjct: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPL 284
           EKSDIWALGVFLYK  ++TTPFE+ G+ A+L SKFEFP    YS ++ NLI VML  +P 
Sbjct: 329 EKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPS 387

Query: 285 KRPNICQVVEEVSRIQGIPCP 305
            RPNI QV+  +S +     P
Sbjct: 388 LRPNIYQVLYYLSEVTNREVP 408

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  290 bits (743), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 152/311 (48%), Positives = 198/311 (63%), Gaps = 11/311 (3%)

Query: 12  GTILPVGSHQVKVLKYLASGGFAHVYSV---EISPPDPVCPD-------NVACLKRVVVP 61
            T + VG+H+ ++L++LA GGFA++Y V   E++       D       ++ACLKRV+VP
Sbjct: 32  NTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP 91

Query: 62  DKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFM 121
           D+  LN LR EV++MK LRG+  IV Y DS+A++ P     +E+ LLME C    L+D+M
Sbjct: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151

Query: 122 NTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSV 181
           N +L  +L E EIL IM  VS  +A MH L  PLIHRDIKIENVL+ K+  FKLCDFGS 
Sbjct: 152 NNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGST 211

Query: 182 SGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCY 241
           S         ++   +  +I  +TT QYR PEMIDLYR LPI+EKSDIWALG+FLYK  +
Sbjct: 212 SMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 271

Query: 242 YTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQG 301
           YTTPFE  G+ AIL SK+E P    YS ++ NLI +ML  +P  RPNI QV+  V  I  
Sbjct: 272 YTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILK 330

Query: 302 IPCPIKNFYLL 312
              P  + Y L
Sbjct: 331 CDVPFTDKYEL 341

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  295 bits (755), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 149/319 (46%), Positives = 202/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI---------SPPDPVCPDN 51
           M  P +E+Y  G I+ VG+H+V+++ YLA GGFA +Y V+          +   P+   +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  VACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEY 111
           +ACLKRV+V D+  LN +R EV+ MK L+G   +V Y DS+A++    V  +EV LLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNH 171
           C    L+D+MN RL  +L E EI+ IM  V+  ++ MH L  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 EFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWA 231
            FKL DFGS S         ++   +  +I  +TT QYR PEMIDLYR LPI+EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQ 291
           LG+FLYK  ++TTPFE  G+ AIL SK+EFP   +YS ++ NLI +ML  +P  RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VVEEVSRIQGIPCPIKNFY 310
           V+  +  I  +  PI++ Y
Sbjct: 313 VLCHLCDILNVEVPIEDKY 331

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  289 bits (739), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 152/323 (47%), Positives = 201/323 (62%), Gaps = 10/323 (3%)

Query: 6   IEKYASGTILPVGSHQVKVLKYLASGGFAHVY---------SVEISPPDPVCPDNVACLK 56
           I+ Y  G I+ VG H+V+++KYLA GGFA +Y          ++I+    + P ++ CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGG 116
           RV+V D   LN +R EV  MK L G   IV   DS+A++    +  YEV LLME CS   
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLC 176
           L+D+MN RL  +L E EIL IM  V+  VA MH L  PLIHRDIKIENVL+   + FKLC
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFL 236
           DFGS S  +       +   +  ++  +TT QYR PEMID+YR + I+EKSDIWALG+FL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 237 YKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
           YK  +Y TPFE+ G+ AIL SK+EFP +  YS ++ NLI +ML  +P  RPNI QV+  +
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 297 SRIQGIPCPIKNFYLLRMMDKQE 319
            +I  I  PI + Y L   D Q+
Sbjct: 395 CKIINIKTPIDDIYGLGPYDFQK 417

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  295 bits (754), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 148/328 (45%), Positives = 205/328 (62%), Gaps = 25/328 (7%)

Query: 7   EKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI----------------------SPP 44
           EK+ +GT + VGSH+V+++KY+A GGFA +Y+V+                         P
Sbjct: 22  EKFPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAP 81

Query: 45  DPVCPD--NVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGM 102
           +P+     ++ACLKRV+V D+  LN +R EV+ MK L+G   +V Y DS+A++       
Sbjct: 82  NPMILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASG 141

Query: 103 YEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKI 162
           +EV LLME C    L+D+MN RL  +L E EIL IM  ++  V+ MH L+ PL+HRDIKI
Sbjct: 142 FEVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKI 201

Query: 163 ENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLP 222
           ENVL+   + FKLCDFGS S  +      ++   +  +I  +TT QYR PEMIDLYR LP
Sbjct: 202 ENVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP 261

Query: 223 IDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVD 282
           IDEKSDIWALG+FLYK  ++ TPFE  G+ AIL SK+EFP    YS ++ NLI +ML  +
Sbjct: 262 IDEKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAEN 320

Query: 283 PLKRPNICQVVEEVSRIQGIPCPIKNFY 310
           P  RPNI QV++ +  +  +  PI++ Y
Sbjct: 321 PNLRPNIYQVLDNICSMMNVEVPIEDIY 348

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  289 bits (739), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 149/313 (47%), Positives = 199/313 (63%), Gaps = 9/313 (2%)

Query: 6   IEKYASGTILPVGSHQVKVLKYLASGGFAHVYSV-------EISPPDPVC-PDNVACLKR 57
           +E   +G+ + VG HQV+V++YLA GGFAH+Y V       E+   D +  P +  CLKR
Sbjct: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKR 85

Query: 58  VVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGL 117
           V V D+  LN LR EV+ MK LR    IV Y DS+A++       YEV LLME C  G L
Sbjct: 86  VRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSL 145

Query: 118 IDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCD 177
           +D+MN RL  +L E E+L IM  ++ G++ MH  + PLIHRDIKIENVL+  ++ FKLCD
Sbjct: 146 LDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCD 205

Query: 178 FGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLY 237
           FGS S  + A  + +E   +  +I  +TT QYR PEMIDLYR LPI+EKSDIWALG+FLY
Sbjct: 206 FGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 265

Query: 238 KTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVS 297
           K  +YTTPFE  G+ AIL SK+E P    +S ++ NL+ +ML  +P  RPN+ QV+  + 
Sbjct: 266 KLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324

Query: 298 RIQGIPCPIKNFY 310
            +      I + Y
Sbjct: 325 SMMECEVKIDDLY 337

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  285 bits (730), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 153/318 (48%), Positives = 191/318 (60%), Gaps = 31/318 (9%)

Query: 6   IEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI---------------SPPDPVCPD 50
           IEKY  GTIL VG  ++++LKYL  GGFA +Y+V                 +    +   
Sbjct: 37  IEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIG 96

Query: 51  NVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGM-------- 102
           +VACLKRV+VPD+  L+ +R EVD MK L     IV Y DS+A+K   N  +        
Sbjct: 97  DVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNNNDN 156

Query: 103 -------YEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPL 155
                  +E+ LLMEYC    L+DFMN RL  +L E EIL  M+ ++  V  MH L  PL
Sbjct: 157 NKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQPL 216

Query: 156 IHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI 215
           IHRDIKIENVL+  N+ FKL DFGS + +       ++   +  DI  NTT QYR PEMI
Sbjct: 217 IHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSPEMI 276

Query: 216 DLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLI 275
           DLY+ LPIDEKSDIWALGV LYK  +YTTPFE  G+ AIL SK+EFPA   YS +  NLI
Sbjct: 277 DLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSKFINLI 335

Query: 276 SVMLRVDPLKRPNICQVV 293
            +ML  +P  RPNI QV+
Sbjct: 336 IIMLAENPNLRPNIFQVL 353

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  287 bits (735), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 144/316 (45%), Positives = 196/316 (62%), Gaps = 12/316 (3%)

Query: 6   IEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEI-----------SPPDPVCPDNVAC 54
           IEKY  G ++ VG+HQVK+  YLA GGFA +Y V+               + +   ++AC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSG 114
           LKRV+V D+  LN +R EV+ MK L+G   IV Y DS+A +    +  YE+ LLME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 115 GGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFK 174
             L+D+MN RL+ +L E EI+ IM   +  V+ MH L  PLIH+DIK+EN+L+  N+ FK
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 175 LCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGV 234
           LCDFGS S       +  +   +  +I  +TT QYR PEMIDLYR LPI+E SDIWALGV
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 235 FLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVE 294
           FLYK  ++ TPFE+ G+ +IL +KF+ P    Y  ++ NLI +ML  +   RPNI QV+ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDIPVN-NYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 295 EVSRIQGIPCPIKNFY 310
           E+  I   P PI++ Y
Sbjct: 331 EICSITNTPLPIEDKY 346

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score =  107 bits (266), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 82/291 (28%), Positives = 141/291 (48%), Gaps = 47/291 (16%)

Query: 23  KVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPD-KASLN---TLRAEVDSMKA 78
           K L  +  G  + VY V  + P     D    LK++ + D K   N   T+  E++  K 
Sbjct: 51  KQLNKIGKGSHSIVYKV--THP---TSDATLALKKLPINDYKLKTNRRSTILKEIEIHKL 105

Query: 79  LRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIM 138
           + G+K I+S ID     + +       Y+++E C  G L D +  R +  L+E+E   +M
Sbjct: 106 VNGHKNIISMIDHFEIDATM-------YMVLELCGAGSLYDII-CRSKRSLREWEAKRLM 157

Query: 139 SQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQ 198
            Q+   V  +H  +  ++H D+K+ N+L+  ++  +LCDFG               ++V 
Sbjct: 158 IQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH--------------SFVS 201

Query: 199 YDIMKNT-----TAQYRCPEMIDLY-----RGLPIDEKSDIWALGVFLYKTCYYTTPFE- 247
            DI  N+     T  Y  PE+I  +     + L   ++SDIW++G+ LY   +  TPFE 
Sbjct: 202 TDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKESDIWSIGIVLYAMIFDKTPFEA 261

Query: 248 ---KNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEE 295
              ++    I+  K+ F    R S++VK LI  +L++ PL+R  I ++V +
Sbjct: 262 TTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIVSD 312

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 94.0 bits (232), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 83/341 (24%), Positives = 148/341 (43%), Gaps = 61/341 (17%)

Query: 11  SGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVAC-----LKRVVVPDKAS 65
           S T + V   + K+ + L  GG + VY V++     +  + VA      LK+++ P+  S
Sbjct: 19  SDTTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVES 78

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRL 125
           ++    E+++ K  + + +++  IDS   +     G   +Y+++ + + G L D +N RL
Sbjct: 79  ISNGMREIENYKRFQ-SPYVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRL 135

Query: 126 --QNRLQEFEILNIMSQVSQGVAAMHA--------------------------------- 150
                + E E + IM  V +G+  +H                                  
Sbjct: 136 LEGTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTP 195

Query: 151 LQPPLI-----------HRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQY 199
           L+  ++           HRDI   N+L S +    + D GS S       N  +   +Q 
Sbjct: 196 LEMDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQE 255

Query: 200 DIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEK----NGES--- 252
            +  N T  Y  PE++ L     +D K DIW+LG   Y   +  +PFE+    +G S   
Sbjct: 256 WVNDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITY 315

Query: 253 AILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVV 293
           AI   K+ FP   R+S+ + ++I   ++VDP++RP   Q++
Sbjct: 316 AINTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 96.7 bits (239), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 130/274 (47%), Gaps = 29/274 (10%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++           VA   ++ +  + +   L +E+   K+++ ++ +V
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVA---KLSIKSEKTRKKLLSEIQIHKSMK-HQNVV 142

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            +ID     +        VY+L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+   +N+  K+ DFG ++ V+   R        +Y +    T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVLANDRER------KYTVC--GT 242

Query: 207 AQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFP 262
             Y  PE++ + +      + DIW++GV LY       PF+    + I        F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFSFP 301

Query: 263 AYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
                S+  K LI  +L +DPL+RP+I ++++ V
Sbjct: 302 KEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 94.0 bits (232), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 81/335 (24%), Positives = 146/335 (43%), Gaps = 61/335 (18%)

Query: 11  SGTILPVGSHQVKVLKYLASGGFAHVYSVEI-----SPPDPVCPDNVACLKRVVVPDKAS 65
           S T + V   + K+ + L  GG + VY V++     S  +      +  LK+++ P   +
Sbjct: 19  SDTTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVEN 78

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRL 125
           ++    E+++ K  + + +++  IDS   +     G   +Y+++ Y S G L D +N RL
Sbjct: 79  ISNGMREIENYKRFQ-SPYVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRL 135

Query: 126 --QNRLQEFEILNIMSQVSQGVAAMHA--------------------------------- 150
                + E E + IM  V++G+  +H                                  
Sbjct: 136 LEGTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTP 195

Query: 151 LQPPLI-----------HRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQY 199
           L+  ++           HRDI   N+L S +    + D GS S       N  + + +Q 
Sbjct: 196 LEMDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQE 255

Query: 200 DIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEK----NGES--- 252
            +  N T  Y  PE+++L     +  K DIW++G   Y   +  +PFE+    +G S   
Sbjct: 256 WVNDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTY 315

Query: 253 AILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRP 287
           AI   K+ FP   R+S+R+ ++I   ++VDP++RP
Sbjct: 316 AINTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 119/270 (44%), Gaps = 33/270 (12%)

Query: 28  LASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVS 87
           L  G F  VY V   P   +C   +  + ++ + +       + E+D    L        
Sbjct: 124 LGKGKFGKVYCVRHKPSGLICA--LKVMNKMEIVNFNVQKQFKREIDIQYHLNHKNLTKL 181

Query: 88  YIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAA 147
           Y   H +K+        VYL+MEY  GG L   +  +    + +    N + Q++  +  
Sbjct: 182 YAFFHDSKN--------VYLVMEYLIGGELYKLL--KKNGPMNDITASNYVYQMTDALNY 231

Query: 148 MHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA 207
           MH  +  +IHRD+K EN+L+  N++ KL DFG     I  P N +             T 
Sbjct: 232 MHKRK--IIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNNQKRKTLC-------GTI 279

Query: 208 QYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPA 263
            Y  PE+I        DE  D+WALG+  Y+      PFE++ +      I  S  +FP 
Sbjct: 280 DYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIAKSDLKFP- 335

Query: 264 YPRYSDRVKNLISVMLRVDPLKRPNICQVV 293
            P  S   ++LI+ +L+V P +R N+ QV+
Sbjct: 336 -PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 130/274 (47%), Gaps = 29/274 (10%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++           VA   ++ +  + +   L +E+   K++R +  IV
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVA---KLSIKTEKTRKKLLSEIQIHKSMR-HANIV 161

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            +ID    ++        VY+L+E C  G L++ +  R    L E E+    +Q+  G+ 
Sbjct: 162 QFIDCFEDET-------NVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIK 212

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+   KN+  K+ DFG ++ V+   R        +Y +    T
Sbjct: 213 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVLANDRER------KYTVC--GT 261

Query: 207 AQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFP 262
             Y  PE++ + +      + DIW++GV +Y       PF+    + I        F FP
Sbjct: 262 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFVFP 320

Query: 263 AYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
                S   + L+  +L +DPL+RP+I +V++ V
Sbjct: 321 KEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 88/295 (29%), Positives = 134/295 (45%), Gaps = 50/295 (16%)

Query: 8   KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLN 67
           ++ S  +  VG++  K+LK +  G F  VY     P          CLK     DK   N
Sbjct: 29  QFTSDELTEVGNY--KILKQVGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPN 78

Query: 68  TLRAEVDSMKALRGNKFIVSYIDSHATK-SPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQ 126
            +R      +     +F   YI    TK   V V   +V++ +EYC G  L D + +   
Sbjct: 79  IVR------EVFYHRQFDFPYI----TKLYEVIVTETKVWMALEYCPGKELYDHLLS--L 126

Query: 127 NRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIR 186
           +R+   E   + +Q+S  V   H++    +HRD+K+EN+LL KN   KL DFG       
Sbjct: 127 HRISLLECAELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGFTR---- 180

Query: 187 APRNTEEFNYVQYDIMKNTTAQYRCPEMID--LYRGLPIDEKSDIWALGVFLYKTCYYTT 244
                E       + +  TT  Y  PE+I+   Y G  I    DIW+LGV LY     + 
Sbjct: 181 -----ECMTKTTLETVCGTTV-YMAPELIERRTYDGFKI----DIWSLGVILYTLITGSL 230

Query: 245 PFEKNGESAILASKFEF-PAYPRYS-----DRVKNLISVMLRVDPLKRPNICQVV 293
           PF+ + E   + +K++     P Y      D  K+LIS +L  +P +RP++ QV+
Sbjct: 231 PFDDDDE---VKTKWKIVNEEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVL 282

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 81/335 (24%), Positives = 143/335 (42%), Gaps = 61/335 (18%)

Query: 11  SGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVA-----CLKRVVVPDKAS 65
           S   + V   + ++ + L  GG + VY V++S    +  + +A      LK+++ P   S
Sbjct: 19  SDATIRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVES 78

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRL 125
           ++    E+++ K  + + +++  IDS   +     G   +Y+++ Y S G L D +N RL
Sbjct: 79  ISNGMREIENYKRFQ-SPYVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRL 135

Query: 126 --QNRLQEFEILNIMSQVSQGVAAMH---------------------------------- 149
                + E E + IM  V++G+  +H                                  
Sbjct: 136 LEGTFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTP 195

Query: 150 ----------ALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQY 199
                     A      HRDI   N+L S +    + D GS S       N  + + +Q 
Sbjct: 196 LEMDMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQE 255

Query: 200 DIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEK----NGES--- 252
            +  N T  Y  PE+++L     +  K DIW+LG   Y   +  +PFE+    +G S   
Sbjct: 256 WVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTY 315

Query: 253 AILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRP 287
           AI   K+ FP   R+S+ + ++I   ++VDP++RP
Sbjct: 316 AINTGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 128/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++           VA   ++ +  + +   L +E+   K++R    +V
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHFN-VV 151

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            +ID     +        VY+L+E C  G L++ +  R    + E E+   M+Q+   + 
Sbjct: 152 QFIDCFEDDT-------NVYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIK 202

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+   KN+  K+ DFG ++ V+   R        +Y +    T
Sbjct: 203 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVLANDRER------KYTVC--GT 251

Query: 207 AQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILA----SKFEFP 262
             Y  PE++ + +      + DIW++GV +Y       PF+    + I        F FP
Sbjct: 252 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNMIYERIKNRDFAFP 310

Query: 263 AYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
                S+  K LI  +L  DPL+RP+I ++++ V
Sbjct: 311 KDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 100/205 (48%), Gaps = 24/205 (11%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         V+  +  +HA    ++HRD+KIEN+
Sbjct: 201 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLKIENI 256

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLP-ID 224
           ++S + E K+ DFG +S V    +    F    Y         +  PE++   +  P I 
Sbjct: 257 MISTSGEIKIIDFG-LSNVFDTRKQLHTFCGSLY---------FAAPELL---KANPYIG 303

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVMLR 280
            + DIW+ GV LY       PF+    S     I   K E+P +   S  V +L+S ML 
Sbjct: 304 PEVDIWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPNH--LSIEVISLLSKMLV 361

Query: 281 VDPLKRPNICQVVEEVSRIQGIPCP 305
           VDPLKR N+ +V+E    I+G   P
Sbjct: 362 VDPLKRANLTKVIEHPWMIRGYDFP 386

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 133/274 (48%), Gaps = 29/274 (10%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++           VA   ++ +  + +   L +E+   K+++ +  IV
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMK-HPNIV 152

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            ++D     +        VY+L+E CS G L+D M  R    L E E+    +Q+   V 
Sbjct: 153 HFVDCFEDDT-------NVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVK 203

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+   K++  K+ DFG ++ V+   R        +Y +    T
Sbjct: 204 YMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFG-LAAVLANNRER------KYTVC--GT 252

Query: 207 AQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFP 262
             Y  PE++ + +      + DIW++GV +Y       PF+    + I     A ++ +P
Sbjct: 253 PNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYP 311

Query: 263 AYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
                S   K LI+ +L VDP++RP+I +++++V
Sbjct: 312 KDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 85/296 (28%), Positives = 132/296 (44%), Gaps = 52/296 (17%)

Query: 8   KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVP--DKAS 65
           +++S  +  VG++  K+ K +  G F  VY     P            ++VV+   DK+ 
Sbjct: 30  QFSSSELTEVGNY--KIQKQIGEGSFGKVYLATHRP----------TKQKVVLKTGDKSD 77

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATK-SPVNVGMYEVYLLMEYCSGGGLIDFMNTR 124
            N +R      +     +F   YI    TK   V V   +V++ +EYC G  L D + ++
Sbjct: 78  PNVVR------EVFYHRQFDYPYI----TKLYEVIVTETKVWMALEYCPGKELYDHLLSK 127

Query: 125 LQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGV 184
             +RL   E   + +Q++  V   H L    +HRD+K+ENVLL KN   KL DFG     
Sbjct: 128 --SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLENVLLDKNGNAKLTDFGFTR-- 181

Query: 185 IRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPIDEKSDIWALGVFLYKTCYY 242
                  E       + +  TT  Y  PEMI    Y G  +    DIW+LGV LY     
Sbjct: 182 -------ESMTKAVLETVCGTTV-YMAPEMIQHKPYDGFKV----DIWSLGVILYTLLCG 229

Query: 243 TTPFEKNGESAILASKFEFPAYPRYSDRV-----KNLISVMLRVDPLKRPNICQVV 293
             PF+++ +  +L  +      P   +R+     +NLI  +L  DP +RPN   ++
Sbjct: 230 CLPFDEDDD--LLTKQKIINDTPVIDERITIPEAQNLIEQLLSKDPTERPNTSAIL 283

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 93.2 bits (230), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 142/298 (47%), Gaps = 56/298 (18%)

Query: 8   KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVP--DKAS 65
           +++S  ++ +G++  K++K +  G F  VY            ++    ++VV+   +K  
Sbjct: 25  QFSSNELVDIGNY--KIVKLIGEGSFGKVY----------LANHRLTHQKVVLKTGNKND 72

Query: 66  LNTLRAEVDSMKALRGNKFIVSYID-SHATK-SPVNVGMYEVYLLMEYCSGGGLIDFMNT 123
            N +R EV          F     D  H TK   V V   +V++ +EYC G  L +++  
Sbjct: 73  PNVVR-EV----------FYHRQFDFPHITKLYEVIVTESKVWMALEYCPGKELYEYL-- 119

Query: 124 RLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSG 183
            +Q+R+   E   + +Q+   V   H+LQ   +HRD+K+EN+LL K    K+ DFG    
Sbjct: 120 LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLENILLDKKGRAKITDFGFTR- 176

Query: 184 VIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPIDEKSDIWALGVFLYKTCY 241
                   E       + +  TT  Y  PE+I+   Y G  I    DIW+LGV LY   +
Sbjct: 177 --------ECATKTMLETVCGTTV-YMAPELIERKSYDGFKI----DIWSLGVILYTMIH 223

Query: 242 YTTPFEKNGESAILASKFE-FPAYPRYSDRV-----KNLISVMLRVDPLKRPNICQVV 293
            T PF++  E+    +K++     P Y+D V     K+LIS +L  DP +RP + QV+
Sbjct: 224 GTMPFDEEDET---KTKWKIINEEPFYNDDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/335 (24%), Positives = 145/335 (43%), Gaps = 61/335 (18%)

Query: 11  SGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVA-----CLKRVVVPDKAS 65
           S T + V   + K+ + L  GG + VY V++     +  + +       LK+++ P   S
Sbjct: 19  SDTTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVES 78

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRL 125
           ++    E+++ K  + + +++  IDS  T+     G   +Y+++ Y S G L D +N RL
Sbjct: 79  ISNGMREIENYKRFQ-SPYVIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQDSINRRL 135

Query: 126 --QNRLQEFEILNIMSQVSQGVAAMH-------ALQP----------------------P 154
                + E E + IM  V++G+  +H        + P                      P
Sbjct: 136 LEGTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTP 195

Query: 155 L---------------IHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQY 199
           L                HRDI   N+L S      + D GS S       +  + + +Q 
Sbjct: 196 LEMDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQE 255

Query: 200 DIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEK----NGES--- 252
            +  N T  Y  PE+++L     +  K DIW++G   Y   +  +PFE+    +G S   
Sbjct: 256 WVNDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITY 315

Query: 253 AILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRP 287
           AI   K+ FP   R+S+ + N+I   ++VDP++RP
Sbjct: 316 AINTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 126/275 (45%), Gaps = 31/275 (11%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++    D      VA   +  +  + +   L +E+   K++  +  IV
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-AHPNIV 142

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            +ID     S        VY+L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+    N+  K+ DFG ++ V+    N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----CGT 242

Query: 207 AQYRCPE-MIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEF 261
             Y  PE ++  + G   +   DIW+LGV LY       PF+    + I        F F
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 262 PAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
           P     SD  K LI  +L +DP++RP++ ++++ V
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 126/274 (45%), Gaps = 29/274 (10%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  +              VA   ++ +  + +   L +E+   K+++ N  IV
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVA---KLSIKSEKTRRKLLSEIQIHKSMK-NVNIV 143

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            +ID     +        VY+L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 144 QFIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+   K++  K+ DFG ++ V+   R        +Y +    T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFG-LAAVLANDRER------KYTVC--GT 243

Query: 207 AQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFP 262
             Y  PE++ + +      + DIW++GV LY       PF+    + I        F FP
Sbjct: 244 PNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFTFP 302

Query: 263 AYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
                S   K LI  +L +DPL+RP++ ++++ V
Sbjct: 303 KDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 131/277 (47%), Gaps = 28/277 (10%)

Query: 21  QVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALR 80
           Q ++L+ +  G F  VY       + +    V  L+    P    ++ L  E+  +  LR
Sbjct: 19  QYEILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDTDEP----IDLLAQEIFFLSELR 74

Query: 81  GNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQ 140
                  YI ++ T   V+V M+   ++MEYC GG   + +    +++L E +   I+S+
Sbjct: 75  S-----PYITNYKTAFLVDVSMW---IVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSE 126

Query: 141 VSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYD 200
           V  G+  +H+ +   IHRDIK  N+LL+ N   KL DFG VSG +   R  + F      
Sbjct: 127 VLVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTF------ 177

Query: 201 IMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEK-NGESAILASKF 259
                T  +  PE+ID  +    +E +DIW+LG+ + +      P +K +   A++A   
Sbjct: 178 ---VGTPFWMAPEVIDRNKK-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPK 233

Query: 260 EFPAY--PRYSDRVKNLISVMLRVDPLKRPNICQVVE 294
             P     R+S   K+ ++  L  DP +RP   ++++
Sbjct: 234 RDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 127/271 (46%), Gaps = 28/271 (10%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++           VA   ++ +  + + N L +E+   K +R ++ IV
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMR-HQNIV 158

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            +ID    +  +NV     Y+L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 159 HFID--CFEDDINV-----YILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+    +IHRD+K+ N+   K+   K+ DFG     + A  N E  N  +Y I    T
Sbjct: 210 HMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-----LAAIINNE--NERKYTIC--GT 258

Query: 207 AQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFP 262
             Y  PE+I   + +    + DIW+LGV ++       PF+    S I        + FP
Sbjct: 259 PNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYSFP 318

Query: 263 AYPRYSDRVKNLISVMLRVDPLKRPNICQVV 293
                S  VK LI  +L ++P++RP I +++
Sbjct: 319 TDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 93/356 (26%), Positives = 151/356 (42%), Gaps = 79/356 (22%)

Query: 13  TILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVP--DKASLNTLR 70
           ++L  G H   + + L  GGF+ VY V+    +     ++  LK++  P  +  S++   
Sbjct: 20  SVLINGQHYA-IQRLLGEGGFSFVYLVQSRENN-----DLFALKKIHCPFGNIESVSEAM 73

Query: 71  AEVDSMKALRGNKFIVSYIDSHATKSPV---NVGMYEVYLLMEYCSGGGLIDFMNTRLQN 127
            EV+S K     KF   YI +H   S V     G   V++L+ Y   G L+D +NT L +
Sbjct: 74  REVNSYK-----KFRSPYI-THCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLD 127

Query: 128 --RLQEFEILNIMSQVSQGVAAMH-------------ALQPPLIHRD------------- 159
              + E EI+ I+  V++G+  MH             ++   L +RD             
Sbjct: 128 GTTISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLL 187

Query: 160 ---------------------------IKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTE 192
                                      IK  N++ S +    +CD GS S       +  
Sbjct: 188 NDSLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRS 247

Query: 193 EFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEK---- 248
           +    Q    ++ T  +R PE++++     IDEK DIW+LG  LY  C+  +PFE+    
Sbjct: 248 QLVEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQL 307

Query: 249 NGES---AILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQG 301
           +G S   AI   KF  P    YS  +  +I   + VD  KRP+I +++  +  +QG
Sbjct: 308 SGASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 87/295 (29%), Positives = 133/295 (45%), Gaps = 50/295 (16%)

Query: 8   KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLN 67
           ++ S  +  VG++  K+LK +  G F  VY     P          CLK     DK   N
Sbjct: 29  QFTSDELTEVGNY--KILKQIGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPN 78

Query: 68  TLRAEVDSMKALRGNKFIVSYIDSHATK-SPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQ 126
            +R      +     +F   YI    TK   V V   +V++ +EYC G  L D + +   
Sbjct: 79  IVR------EVFYHRQFDFPYI----TKLYEVIVTESKVWMALEYCPGKELYDHLLS--L 126

Query: 127 NRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIR 186
           +R+   E   + +Q+S  V   H++    +HRD+K+EN+LL KN   KL DFG       
Sbjct: 127 HRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGFTR---- 180

Query: 187 APRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLPIDEKSDIWALGVFLYKTCYYTT 244
                E       + +  TT  Y  PE+I    Y G  I    D W+LGV LY     + 
Sbjct: 181 -----ECMTKTTLETVCGTTV-YMAPELIGRKTYDGFKI----DTWSLGVILYTLITGSL 230

Query: 245 PFEKNGESAILASKFEF-PAYPRYS-----DRVKNLISVMLRVDPLKRPNICQVV 293
           PF+ + E+    +K++     P+Y      D  K+LIS +L  +P +RP++ QV+
Sbjct: 231 PFDDDDEA---KTKWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 108/210 (51%), Gaps = 17/210 (8%)

Query: 103 YEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKI 162
           Y ++++MEYC GG   D + T  +  L E ++  ++  V  G+  +HA     IHRDIK 
Sbjct: 85  YLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVLLGLQYLHAQHK--IHRDIKA 142

Query: 163 ENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLP 222
            N+LL+ +   K+ DFG VS  +R+    + F    Y         +  PE++ +  G+ 
Sbjct: 143 ANILLTDSGLVKVADFG-VSAEMRSTMKAKTFVGTPY---------WMAPEVV-MNEGMG 191

Query: 223 IDEKSDIWALGVFLYKTCYYTTPFEKNGESAILAS--KFEFPA-YPRYSDRVKNLISVML 279
            +EKSDIW+LG+  Y+      P  K     ++ +  K + P  +  Y++ VK+ I+  L
Sbjct: 192 YNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKRKPPKLHGAYTNLVKHFIATCL 251

Query: 280 RVDPLKRPNICQVVEEVSRIQGIPCPIKNF 309
             DP KRP+  +++E    ++G P  ++N 
Sbjct: 252 IKDPEKRPSASELLEHDFMVKG-PGNVENL 280

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 127/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++           VA   ++ +  + +   L +E+   K++R +  IV
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMR-HPNIV 133

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            + D     +        VY+L+E C  G L+D +  R Q  L E E+    +Q+   + 
Sbjct: 134 QFTDCFEDDT-------NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+   K+   K+ DFG ++ V+   R        +Y I    T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVLANDRER------KYTIC--GT 233

Query: 207 AQYRCPEMI-DLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEF 261
             Y  PE++   + G   +   D+W++GV +Y       PF+    + I        F F
Sbjct: 234 PNYIAPEVLTGKHTGHSFE--VDVWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFNF 291

Query: 262 PAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
           P     S   K LI  +L +DPL+RP++ +++E V
Sbjct: 292 PRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 130/287 (45%), Gaps = 38/287 (13%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++           VA   ++ +  + +   L +E+   K+++    IV
Sbjct: 78  FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHPN-IV 133

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            + D     +        VY+L+E C  G L+D +  R Q  L E E+    +Q+   + 
Sbjct: 134 QFTDCFEDDT-------NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+   K+   K+ DFG ++ V+   R        +Y I    T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVLANDRER------KYTIC--GT 233

Query: 207 AQYRCPEMI-DLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEF 261
             Y  PE++   + G   +   DIW++GV +Y       PF+    + I        F F
Sbjct: 234 PNYIAPEVLTGKHTGHSFE--VDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSF 291

Query: 262 PAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV-------SRIQG 301
           P     S   K LI  +L +DPL+RP++ +++E V       +RI G
Sbjct: 292 PKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYVWFRNVFPARING 338

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 87/294 (29%), Positives = 136/294 (46%), Gaps = 54/294 (18%)

Query: 11  SGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV--PDKASLNT 68
           S  +  VG++  K+LK +  G F  VY     P            K+VV+   DK   N 
Sbjct: 30  SNELNEVGNY--KILKQIGEGSFGKVYLALHKP----------THKKVVLKSSDKTDPNV 77

Query: 69  LRAEVDSMKALRGNKFIVSYIDSHATK-SPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQN 127
           +R      +     +F   YI    TK   V +   +V++++EYC    L D++ ++   
Sbjct: 78  VR------EIFYHRQFDFPYI----TKLYEVIITETKVWMVIEYCPNKELYDYLLSK--K 125

Query: 128 RLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRA 187
           R+   E   I +Q+   V   H+L    +HRD+K+EN+LL K++  KL DFG        
Sbjct: 126 RISLDESARIFAQIVGAVYYAHSLS--CVHRDLKLENILLDKDNNAKLTDFGFTRDF--- 180

Query: 188 PRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLPIDEKSDIWALGVFLYKTCYYTTP 245
            +NT      Q + +  TT  Y  PE++  + Y G  I    DIWALG+ LY     T P
Sbjct: 181 SKNT------QLETICGTTV-YMAPELLRREKYDGYKI----DIWALGILLYTIINGTMP 229

Query: 246 FE----KNGESAILASKFEFPAYPR--YSDRVKNLISVMLRVDPLKRPNICQVV 293
           F+    K  E  I+++    P Y    ++D   +L++ +L  DP  RP I Q++
Sbjct: 230 FDEDDPKKTELKIISAS---PDYDNKYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 78/330 (23%), Positives = 139/330 (42%), Gaps = 55/330 (16%)

Query: 17  VGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVP--DKASLNTLRAEVD 74
           V  H+  + + L  GGF+ VY VE         + +  LK++  P     S++    EVD
Sbjct: 21  VNGHRYHIKRLLGEGGFSFVYLVESRE------NGLMALKKIRCPFGSIGSISPAMKEVD 74

Query: 75  SMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQ--EF 132
           + +  + + +I   IDS   +     G   VY+L+ Y S G L D +N  L +  Q  E 
Sbjct: 75  NYQKFK-SPYIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLDCTQVPEL 131

Query: 133 EILNIMSQVSQGVAAMHALQPP-----------------------------------LIH 157
           E++ +   V++G+  +H   P                                      H
Sbjct: 132 EVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAYAH 191

Query: 158 RDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL 217
            DIK  N+++S      + D GS S       + +     Q    ++ T  +  PE++D+
Sbjct: 192 HDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEILDV 251

Query: 218 YRGLPIDEKSDIWALGVFLYKTCYYTTPFEK----NGES---AILASKFEFPAYPRYSDR 270
                I EK D+W+ G  +Y  C+  +PFE+    +G S   ++   K+  P+   YS  
Sbjct: 252 KLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYSSG 311

Query: 271 VKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300
           + +++   L VDP  RP++ +++  +  +Q
Sbjct: 312 LIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 126/275 (45%), Gaps = 31/275 (11%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++    +      VA   +  +  + +   L +E+   K++  +  IV
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-AHPNIV 142

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            ++D     S        VY+L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFVDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+    N+  K+ DFG ++ V+    N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----CGT 242

Query: 207 AQYRCPE-MIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEF 261
             Y  PE ++  + G   +   DIW+LGV LY       PF+    + I        F F
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 262 PAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
           P     SD  K LI  +L +DP++RP++ ++++ V
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 126/275 (45%), Gaps = 31/275 (11%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++    +      VA   +  +  + +   L +E+   K++  +  IV
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            +ID     S        VY+L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+    N+  K+ DFG ++ V+    N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----CGT 242

Query: 207 AQYRCPE-MIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEF 261
             Y  PE ++  + G   +   DIW+LGV LY       PF+    + I        F F
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 262 PAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
           P     SD  K LI  +L +DP++RP++ ++++ V
Sbjct: 301 PKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 126/275 (45%), Gaps = 31/275 (11%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++    +      VA   +  +  + +   L +E+   K++  +  IV
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            +ID     S        VY+L+E C  G L++ +  R    L E E+    +Q+   + 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+    N+  K+ DFG ++ V+    N  E  Y         T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI-----CGT 242

Query: 207 AQYRCPE-MIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEF 261
             Y  PE ++  + G   +   DIW+LGV LY       PF+    + I        F F
Sbjct: 243 PNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSF 300

Query: 262 PAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
           P     SD  K LI  +L +DP++RP++ ++++ V
Sbjct: 301 PRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 90.1 bits (222), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 125/277 (45%), Gaps = 41/277 (14%)

Query: 28  LASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNT------LRAEVDSMKALRG 81
           L  GGFA  + ++         D+V       +  K S+ T      L +E+   + LR 
Sbjct: 99  LGEGGFARCFHIK---------DDVGISFACKIVSKKSIKTERTKFKLLSEIQIHQNLRY 149

Query: 82  NKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQV 141
           +  IV ++D    +         VY+L+E C  G L+D +  R    L E E+  + +QV
Sbjct: 150 SH-IVKFMDCFEDE-------LNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQV 199

Query: 142 SQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDI 201
              +  MH+    +IHRD+K+ NV   KN   K+ DFG  + +     N  E  Y     
Sbjct: 200 CGAINYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG- 252

Query: 202 MKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----AS 257
               T  Y  PE+I L + +    ++DIW+LG+ +Y       PF+    + I       
Sbjct: 253 ----TPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLC 307

Query: 258 KFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVE 294
           ++EFP     ++ VK LI  +L +DP +RP I  +++
Sbjct: 308 QYEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 128/274 (46%), Gaps = 29/274 (10%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + +            VA   ++ +  + +   L +E+   K+++ ++ IV
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVA---KLSIKTEKTRKKLLSEIQIHKSMK-HQNIV 205

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            +ID     +        VY+L+E C  G L++ +  R Q  L E E+    +Q+   + 
Sbjct: 206 QFIDCFEDDT-------NVYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIK 256

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+   +N+  K+ DFG ++ V+   R   +F           T
Sbjct: 257 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVLANDRE-RKFTVC-------GT 305

Query: 207 AQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFP 262
             Y  PE++ + +      + D+W++GV +Y       PF+    + I        F FP
Sbjct: 306 PNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDFIFP 364

Query: 263 AYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
                S   K L+  +L +DPL+RP+I ++++ V
Sbjct: 365 KEKPISHEAKVLVQDLLSLDPLERPSISEIMDYV 398

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 87/295 (29%), Positives = 132/295 (44%), Gaps = 50/295 (16%)

Query: 8   KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLN 67
           ++ S  +  VG++  K+LK +  G F  VY     P          CLK     DK   N
Sbjct: 29  QFTSDELTEVGNY--KILKQIGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPN 78

Query: 68  TLRAEVDSMKALRGNKFIVSYIDSHATK-SPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQ 126
            +R      +     +F   YI    TK   V V   +V++ +EYC G  L D  +    
Sbjct: 79  IVR------EVFYHRQFDFPYI----TKLYEVIVTESKVWMALEYCPGKELYD--HLLSL 126

Query: 127 NRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIR 186
            R+   E   + +Q+S  V   H++    +HRD+K+EN+LL KN   KL DFG       
Sbjct: 127 RRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGFTR---- 180

Query: 187 APRNTEEFNYVQYDIMKNTTAQYRCPEMID--LYRGLPIDEKSDIWALGVFLYKTCYYTT 244
                E       + +  TT  Y  PE+I+   Y G  I    DIW+LGV LY       
Sbjct: 181 -----ECMTKTTLETVCGTTV-YMAPELIERRTYDGFKI----DIWSLGVILYTLITGYL 230

Query: 245 PFEKNGESAILASKFEF-PAYPRYS-----DRVKNLISVMLRVDPLKRPNICQVV 293
           PF+ + E+    +K++     P+Y      D  ++LIS +L  +P +RP++ QV+
Sbjct: 231 PFDDDDEA---KTKWKIVNEEPKYDAKVIPDDARDLISRLLAKNPGERPSLSQVL 282

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 128/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++           VA   ++ +  + +   L +E+   K+++ +  IV
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLLSEIQIHKSMKHSN-IV 155

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            +ID     +        VY+L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 156 QFIDCFEDDA-------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            +H+ +  +IHRD+K+ N+   K++  K+ DFG ++ V+   R        +Y +    T
Sbjct: 207 YLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFG-LAAVLANDRER------KYTVC--GT 255

Query: 207 AQYRCPE-MIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILA----SKFEF 261
             Y  PE ++  + G   +   DIW++GV +Y       PF+    + I       K+ +
Sbjct: 256 PNYIAPEVLMGKHSGHSFE--VDIWSIGVMIYALLVGKPPFQAKDVNVIYERIKLCKYGY 313

Query: 262 PAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
           P     S   + LI  +L ++PL+RP I  ++++V
Sbjct: 314 PKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 133/278 (47%), Gaps = 30/278 (10%)

Query: 21  QVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKAS-LNTLRAEVDSMKAL 79
           Q ++L+ +  G F  VY         +  + +  +K V + D    ++ L  E+  +  L
Sbjct: 19  QYEILQCIGRGNFGDVYKAR-----DLTSNEIVAIKVVNLEDTDEPIDLLAQEIFFLSEL 73

Query: 80  RGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMS 139
           R       YI ++ T   V+V M+   ++MEYC GG   + +    ++++ E +   I+S
Sbjct: 74  RS-----PYITNYKTAFLVDVSMW---IVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVS 125

Query: 140 QVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQY 199
           +V  G+  +H+ +   IHRDIK  N+LL+ N   KL DFG VSG +   R  + F     
Sbjct: 126 EVLIGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTF----- 177

Query: 200 DIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEK-NGESAILASK 258
                 T  +  PE+ID  +    +E +DIW+LG+ + +      P +K +   A++A  
Sbjct: 178 ----VGTPFWMAPEVIDRNKQ-GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIP 232

Query: 259 FEFPAY--PRYSDRVKNLISVMLRVDPLKRPNICQVVE 294
              P     R+S   ++ ++  L  DP +RP   ++++
Sbjct: 233 KRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/297 (27%), Positives = 135/297 (45%), Gaps = 54/297 (18%)

Query: 8   KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV--PDKAS 65
           ++ S  +  VG++  K+LK +  G F  VY     P            ++VV+   DK+ 
Sbjct: 25  QFTSDELSEVGNY--KILKQIGEGSFGKVYLASHKPTH----------RKVVLKTSDKSD 72

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATK-SPVNVGMYEVYLLMEYCSGGGLIDFMNTR 124
            N +R      +     +F   YI    TK   V V   +V++ +EYC G  L + +   
Sbjct: 73  PNLVR------EVFYHRQFDFPYI----TKLYEVIVTETKVWMALEYCPGRELYEHL--L 120

Query: 125 LQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGV 184
           + +R+   E   + +Q+   V   H+L    +HRD+K+EN+LL KN   KL DFG     
Sbjct: 121 MLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLENILLDKNGNAKLTDFGFTREC 178

Query: 185 IRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLPIDEKSDIWALGVFLYKTCYY 242
           +              + +  TT  Y  PE+I    Y G  I    DIW+LGV LY     
Sbjct: 179 VSKS---------SLETICGTTV-YMAPELIQRQAYDGFKI----DIWSLGVILYTMING 224

Query: 243 TTPFEKNGESAILASKFEF-PAYPRYSD-----RVKNLISVMLRVDPLKRPNICQVV 293
           T PF+++ E+    +K++    +P ++D       K+LI  +L   P +RP + Q++
Sbjct: 225 TMPFDEDDET---KTKWKIVNDFPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 115/236 (48%), Gaps = 32/236 (13%)

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRL 125
           ++ L  E+  +  LR + FI +YI    T    +V M+   ++MEYC GG   D +    
Sbjct: 55  IDLLAQEIFFLAELR-SPFITNYI----TTLTEDVSMW---IVMEYCGGGSCADLIKHIY 106

Query: 126 QNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVI 185
            N + E ++  I SQV +G+  +H  +   IHRDIK  N+LL+     KL DFG VSG I
Sbjct: 107 INGMPEKKVAFITSQVLRGLVYLHEQKK--IHRDIKAANILLTDEGTVKLGDFG-VSGQI 163

Query: 186 RAPRNTEEFNYVQYDIMKNTTAQYRCPEMI----DLYRGLPIDEKSDIWALGVFLYKTCY 241
           RA      F    Y         +  PE++    D Y     DEK+DIW+LG+ +Y+   
Sbjct: 164 RATLKRGTFVGTPY---------WMAPEVVSKENDGY-----DEKADIWSLGITVYELLK 209

Query: 242 YTTPFEKNGESAILAS--KFEFPA-YPRYSDRVKNLISVMLRVDPLKRPNICQVVE 294
              P  K     ++ +  K + PA +  YS   KN +S  L  +P+ R +  ++VE
Sbjct: 210 GAPPLSKCDPMKVMINLPKRKPPALHGHYSHSAKNFVSSCLVKNPVGRASAYEMVE 265

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 132/275 (48%), Gaps = 29/275 (10%)

Query: 26  KYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFI 85
           ++L  GGFA  + ++           VA   ++ +  + +   L +E+   K++     I
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMSHTN-I 140

Query: 86  VSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGV 145
           V +ID    +  VNV     Y+L+E C  G L++ +  R    + E E+   M+Q+  G+
Sbjct: 141 VQFID--CFEDNVNV-----YILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGI 191

Query: 146 AAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNT 205
             MH+ +  +IHRD+K+ N+   +++  K+ DFG ++ V+   R        ++ I    
Sbjct: 192 QYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFG-LAAVLANDRER------KFTIC--G 240

Query: 206 TAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILA----SKFEF 261
           T  Y  PE++ + +      + DIW++GV LY       PF+    + I        F +
Sbjct: 241 TPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAY 299

Query: 262 PAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
           P   + S   K LI  +L ++P++RP+I ++++ V
Sbjct: 300 PKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 107/218 (49%), Gaps = 29/218 (13%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           E+YL++EY  GG L D++ ++   +L E E ++  +Q+ QGV+  H+    + HRD+K E
Sbjct: 200 ELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPE 255

Query: 164 NVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRG 220
           N+LL  KN   K+ DFG     +  P    E +          +  Y  PE++    Y G
Sbjct: 256 NLLLDKKNKVIKIADFG--MAALELPNKLLETSC--------GSPHYASPEIVMGKPYHG 305

Query: 221 LPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFPAYPRYSDRVKNLIS 276
            P    SD+W+ G+ L+       PF  +    +L    A +F+ P Y   ++  K+LI+
Sbjct: 306 GP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPY--LTNDAKDLIT 359

Query: 277 VMLRVDPLKRPNICQVVEE--VSRIQGIPCPIKNFYLL 312
            +L  +P KR  I +++    + + +  P  I+   LL
Sbjct: 360 RILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKLNLL 397

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/335 (23%), Positives = 138/335 (41%), Gaps = 55/335 (16%)

Query: 13  TILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVP--DKASLNTLR 70
           + + +   + ++ K L  GG + VY VE    +      +  LK+   P     S++   
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVYLVESKEGE------LFALKKTRCPFGSIGSISPAM 70

Query: 71  AEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQN--R 128
            EV + +    + +I   +DS   +     G   VY+L+ Y + G L D +N  L +  +
Sbjct: 71  KEVANYQRF-SSPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLDCTQ 127

Query: 129 LQEFEILNIMSQVSQGVAAMHALQP----------------------------------- 153
           + E +IL +   +++G+  +H   P                                   
Sbjct: 128 MSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQQ 187

Query: 154 PLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPE 213
              HRD+K  N+++S      + D GS S       + +     Q     N T  Y  PE
Sbjct: 188 SYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCTLSYAAPE 247

Query: 214 MIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEK----NGES---AILASKFEFPAYPR 266
           ++D+     I EK DIW+ G  +Y  C+  +PFE+    +G S   AI   K+  P    
Sbjct: 248 ILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRGTS 307

Query: 267 YSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQG 301
           YS  +  LI   L V+P +RP++ +++  +  +QG
Sbjct: 308 YSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 103/218 (47%), Gaps = 34/218 (15%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           E+YL++EY  GG L D++  R   +L E E ++   Q+ QGV+  H     + HRD+K E
Sbjct: 138 ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPE 193

Query: 164 NVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRG 220
           N+LL  KN   K+ DFG     + A   T              +  Y  PE++    Y G
Sbjct: 194 NLLLDKKNKTVKIADFG-----MAALETTNRLLETSCG-----SPHYASPEIVMGQKYHG 243

Query: 221 LPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILA----SKFEFPAYPRYSDRVKNLIS 276
            P    SD+W+ G+ L+       PF  +    +L      +++ P+    S   K+LIS
Sbjct: 244 SP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPS--NVSKEAKDLIS 297

Query: 277 VMLRVDPLKRPNICQVVEEVSRIQ-------GIPCPIK 307
            +L VDP KR  + +++E    ++       G+ CP++
Sbjct: 298 KILVVDPEKRITVDKILEHPLLVKYDNPGKGGLACPLE 335

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 98/206 (47%), Gaps = 26/206 (12%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +HA    ++HRD+KIEN+
Sbjct: 178 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHANN--IVHRDLKIENI 233

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E K+ DFG +S +    +    F    Y         +  PE++    Y G  +
Sbjct: 234 MISTSGEIKIIDFG-LSNLFDKSKQLHTFCGSLY---------FAAPELLKASPYTGPEV 283

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               D+W+ GV LY       PF+    S     I   K E+P +   S  V +L+S ML
Sbjct: 284 ----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKML 337

Query: 280 RVDPLKRPNICQVVEEVSRIQGIPCP 305
            VDP +R ++ QVVE    ++G   P
Sbjct: 338 VVDPHRRASLKQVVEHHWMVRGYDGP 363

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 86/294 (29%), Positives = 130/294 (44%), Gaps = 48/294 (16%)

Query: 8   KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLN 67
           ++ S  +  VG++  K+LK +  G F  VY     P          CLK     DK   N
Sbjct: 29  QFTSDELTEVGNY--KILKQIGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPN 78

Query: 68  TLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQN 127
            +R      +     +F   YI        V V   +V++ +EYC G  L D  +     
Sbjct: 79  IVR------EVFYHRQFDFPYI---TKLYEVIVTESKVWMALEYCPGKELYD--HLLSLR 127

Query: 128 RLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRA 187
           RL   E   + +Q+S  V   H++    +HRD+K+EN+LL +N   KL DFG        
Sbjct: 128 RLSLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDFGFTR----- 180

Query: 188 PRNTEEFNYVQYDIMKNTTAQYRCPEMID--LYRGLPIDEKSDIWALGVFLYKTCYYTTP 245
               E       + +  TT  Y  PE+I+   Y G  I    DIW+LGV LY       P
Sbjct: 181 ----ECMTKTTLETVCGTTV-YMAPELIERKTYDGFKI----DIWSLGVILYTLITGYLP 231

Query: 246 FEKNGESAILASKFEF-PAYPRYS-----DRVKNLISVMLRVDPLKRPNICQVV 293
           F+ + E   + +K++     P+Y      D  K+LIS +L  +P +RP++ QV+
Sbjct: 232 FDDDDE---VKTKWKIVNEEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVL 282

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 98/206 (47%), Gaps = 26/206 (12%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +HA    ++HRD+KIEN+
Sbjct: 262 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALEYIHANN--IVHRDLKIENI 317

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E K+ DFG +S V    +    F    Y         +  PE++    Y G  +
Sbjct: 318 MISTSGEIKIIDFG-LSNVFDRKKQLHTFCGSLY---------FAAPELLKAHPYTGPEV 367

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               D+W+ GV LY       PF+    S     I   K ++P +   S  V +L+S ML
Sbjct: 368 ----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPNH--LSIEVISLLSKML 421

Query: 280 RVDPLKRPNICQVVEEVSRIQGIPCP 305
            VDPL+R ++ QVVE     +G   P
Sbjct: 422 VVDPLRRASLKQVVEHPWMTRGYDYP 447

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 99/206 (48%), Gaps = 26/206 (12%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       ++E +       ++  +  +HA    ++HRD+KIEN+
Sbjct: 218 YMLFEYVSGGQLLDYIIQ--HGSIREHQARKFARGIASALMYLHANN--IVHRDLKIENI 273

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E K+ DFG +S +  + +    F    Y         +  PE++    Y G  +
Sbjct: 274 MISDSSEIKIIDFG-LSNLYDSRKQLHTFCGSLY---------FAAPELLKAHPYTGPEV 323

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               D+W+ GV L+       PF+    S     I   K E+P +   S  V +L+S ML
Sbjct: 324 ----DVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKML 377

Query: 280 RVDPLKRPNICQVVEEVSRIQGIPCP 305
            VDP +R  + QVVE    ++G   P
Sbjct: 378 VVDPKRRATLKQVVEHHWMVRGFNAP 403

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 99/210 (47%), Gaps = 26/210 (12%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY +GG L+D++       L+E         V+  +  +HA    ++HRD+KIEN+
Sbjct: 208 YMLFEYVAGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLKIENI 263

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E K+ DFG +S V    +    F    Y         +  PE++    Y G  +
Sbjct: 264 MISNSGEIKIIDFG-LSNVYDTRKQLHTFCGSLY---------FAAPELLKAHPYTGPEV 313

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               D+W+ GV LY       PF+    S     I   K E+P +   S  V +L+S ML
Sbjct: 314 ----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKRGKVEYPQH--LSIEVMSLLSKML 367

Query: 280 RVDPLKRPNICQVVEEVSRIQGIPCPIKNF 309
            VDP +R ++ QVVE     +G   P  ++
Sbjct: 368 VVDPSRRASLKQVVEHPWMTKGYDTPAPSY 397

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 122/274 (44%), Gaps = 29/274 (10%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + +            VA   ++ +  + +   L +E+   K+++    IV
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHVN-IV 155

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            +ID     +        VY+L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 156 QFIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+   + +  K+ DFG  + +     N  E  Y         T
Sbjct: 207 YMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATLA----NDRERKYTVCG-----T 255

Query: 207 AQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFP 262
             Y  PE++ + +      + DIW++GV +Y       PF+    + I        F FP
Sbjct: 256 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDFSFP 314

Query: 263 AYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
                S   K LI  +L +DPL+RP++ ++++ +
Sbjct: 315 KDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 99/197 (50%), Gaps = 24/197 (12%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +    +  L E ++  I  ++ +G+  +H+ +   IHRDIK  N
Sbjct: 105 MWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHSQRK--IHRDIKAAN 162

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPID 224
           +LL+ + + KL DFG VSG + A R  + F    +         +  PE+I        +
Sbjct: 163 ILLTDDGKVKLGDFG-VSGQMMATRRRDTFVGTPF---------WMAPEVIARSE-QGYN 211

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESAILAS-------KFEFPAYPRYSDRVKNLISV 277
           EK+DIW+LG+ +++      P  ++    +L S       K E     RYS  ++  +S+
Sbjct: 212 EKADIWSLGITVFELLKGQPPLSQHDPMKVLMSIPSRRPPKLE----DRYSHAIREFVSL 267

Query: 278 MLRVDPLKRPNICQVVE 294
            L  DP KRP   ++++
Sbjct: 268 CLNKDPAKRPTASELLK 284

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 99/206 (48%), Gaps = 26/206 (12%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       ++E +       ++  +  +HA    ++HRD+KIEN+
Sbjct: 220 YMLFEYVSGGQLLDYIIQ--HGSIREHQARKFARGIASALIYLHANN--IVHRDLKIENI 275

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E K+ DFG +S +  + +    F    Y         +  PE++    Y G  +
Sbjct: 276 MISDSSEIKIIDFG-LSNIYDSRKQLHTFCGSLY---------FAAPELLKANPYTGPEV 325

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               D+W+ GV L+       PF+    S     I   K E+P +   S  V +L+S ML
Sbjct: 326 ----DVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKML 379

Query: 280 RVDPLKRPNICQVVEEVSRIQGIPCP 305
            VDP +R  + QVVE    ++G   P
Sbjct: 380 VVDPKRRATLKQVVEHHWMVRGFNGP 405

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 117/244 (47%), Gaps = 49/244 (20%)

Query: 91  SHATK-SPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMH 149
           SH TK   V V    V++ +EYC G  L +++  +    L+E   L   SQ+   V   H
Sbjct: 88  SHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSEL--FSQIVGAVYYAH 145

Query: 150 ALQPPLIHRDIKIENVLLSKNHEFKLCDFG-----SVSGVIRAPRNTEEFNYVQYDIMKN 204
           +++   +HRD+K+EN+LL K    KL DFG     +  G++              + +  
Sbjct: 146 SMK--CVHRDLKLENILLDKKGHAKLTDFGFTRECATKGIL--------------ETICG 189

Query: 205 TTAQYRCPEMIDL--YRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFP 262
           TT  Y  PE+I+   Y G  I    D W+LG+ LY   + T PF++  E   + +K++  
Sbjct: 190 TTV-YMAPELIERKPYEGYKI----DTWSLGIILYTMIHGTMPFDEVDE---VKTKYKIV 241

Query: 263 AY-PRYSDRV-----KNLISVMLRVDPLKRPNICQVVEEVSRIQGIPCPIKNFYLLRMMD 316
            Y P Y +       K LIS +L  DP +RP++ QV++          P    Y L++++
Sbjct: 242 HYNPTYDNDYIDSNGKELISQLLEKDPNQRPSLTQVLQH---------PFLQPYGLKILE 292

Query: 317 KQEQ 320
           + E+
Sbjct: 293 RTEK 296

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 100/206 (48%), Gaps = 26/206 (12%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       ++E +       ++  +  +HA    ++HRD+KIEN+
Sbjct: 231 YMLFEYVSGGQLLDYIIQ--HGSIREHQARKFARGIASALMYLHANN--IVHRDLKIENI 286

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLPI 223
           ++S + E K+ DFG +S +  + +    F    Y         +  PE++  + Y G  +
Sbjct: 287 MISDSSEIKIIDFG-LSNLYDSRKQLHTFCGSLY---------FAAPELLKANPYTGPEV 336

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               D+W+ GV L+       PF+    S     I   K E+P +   S  V +L+S ML
Sbjct: 337 ----DVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKML 390

Query: 280 RVDPLKRPNICQVVEEVSRIQGIPCP 305
            VDP +R  + QVVE    ++G   P
Sbjct: 391 VVDPKRRATLKQVVEHHWMVRGFDGP 416

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 98/198 (49%), Gaps = 27/198 (13%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           E+YL++EY  GG L D++ +R   +L E E ++   Q+ QGV+  H     + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPE 196

Query: 164 NVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRG 220
           N+LL  KN   K+ DFG     + A   T++            +  Y  PE++    Y G
Sbjct: 197 NLLLDKKNLSVKIADFG-----MAALETTDKLLETSCG-----SPHYASPEIVMGQKYHG 246

Query: 221 LPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFPAYPRYSDRVKNLIS 276
            P    SD+W+ G+ L+       PF  +    +L    + K++ P     S+  K+LI+
Sbjct: 247 SP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQ--NISNEAKDLIA 300

Query: 277 VMLRVDPLKRPNICQVVE 294
            +L VDP  R  I +V+E
Sbjct: 301 KILIVDPAMRITIDEVLE 318

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 100/209 (47%), Gaps = 24/209 (11%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +HA    ++HRD+KIEN+
Sbjct: 240 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHANN--IVHRDLKIENI 295

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLP-ID 224
           ++S + E K+ DFG +S +         F    Y         +  PE++   +  P + 
Sbjct: 296 MISTSGEIKIIDFG-LSNMFDPRTQLHTFCGSLY---------FAAPELL---KASPYVG 342

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVMLR 280
            + D+W+ GV LY       PF+    S     I   K ++P +   S  V +L+S ML 
Sbjct: 343 PEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPQH--LSIEVISLLSKMLV 400

Query: 281 VDPLKRPNICQVVEEVSRIQGIPCPIKNF 309
           VDP KR ++ QVVE    I+G   P  ++
Sbjct: 401 VDPRKRASLKQVVEHHWMIRGYDFPAPSY 429

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 97/203 (47%), Gaps = 38/203 (18%)

Query: 100 VGMYEV-------YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQ 152
           +G+YEV       YL++EY  GG L D++ +R   +L E E ++   Q+ QGV+  H+  
Sbjct: 205 LGLYEVWENKSELYLVLEYVDGGELFDYLVSR--GKLGEREAVHYFKQIVQGVSYCHSFN 262

Query: 153 PPLIHRDIKIENVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA--QY 209
             + HRD+K EN+LL  KN   K+ DFG  +              V   +++ +     Y
Sbjct: 263 --ICHRDLKPENLLLDKKNKSIKIADFGMAAL------------EVSNKLLQTSCGSPHY 308

Query: 210 RCPEMI--DLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFPA 263
             PE++    Y G P    SD+W+ G+ L+       PF  +    +L    + KF  P 
Sbjct: 309 ASPEIVMGRPYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKFHMPQ 364

Query: 264 YPRYSDRVKNLISVMLRVDPLKR 286
               S   K+L+S +L V+P KR
Sbjct: 365 --NLSAEAKDLMSKILVVNPFKR 385

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 99/200 (49%), Gaps = 31/200 (15%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           E+YL++EY  GG L D++ +R   +L E E ++   Q+ +GV+  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 164 NVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA--QYRCPEMI--DLY 218
           N+LL  KN + K+ DFG     +  P            ++K +     Y  PE++    Y
Sbjct: 244 NLLLDKKNKKIKIADFG--MAALELPN----------KLLKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFPAYPRYSDRVKNL 274
            G P    SD+W+ G+ L+       PF  +    +L    + K++ P     S   +NL
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPM--NLSLEARNL 345

Query: 275 ISVMLRVDPLKRPNICQVVE 294
           IS +L +DP KR    +++E
Sbjct: 346 ISKILVIDPEKRITTQEILE 365

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 107/225 (47%), Gaps = 38/225 (16%)

Query: 83  KFIVSYIDSHATKSPVNVGMYEVY-------LLMEYCSGGGLIDFMNTRLQNRLQEFEIL 135
           + I+  + SH    P  +G+YEV+       L++EY  GG L D++ +R   RL E E +
Sbjct: 107 EIIIMKLISH----PNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSR--GRLSEKEAI 160

Query: 136 NIMSQVSQGVAAMHALQPPLIHRDIKIENVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEF 194
           +   Q+ +G A  H+    + HRD+K EN+LL  KN   K+ DFG     + A + + + 
Sbjct: 161 HYFRQIIEGTAYCHSFN--ICHRDLKPENLLLDKKNKRIKIADFG-----MAALQTSNKL 213

Query: 195 NYVQYDIMKNTTAQYRCPEMI--DLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGES 252
                      +  Y  PE++    Y G P    SD+W+ G+ L+       PF  +   
Sbjct: 214 LETSCG-----SPHYASPEIVMGKTYNGGP----SDVWSCGIILFALLTGHLPFNDDNIK 264

Query: 253 AIL----ASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVV 293
            +L    A K++ P     S   ++LIS +L VDP KR  I  ++
Sbjct: 265 RLLLKVQAGKYQMPQA--ISLEAQDLISRILVVDPNKRITINDIL 307

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 124/274 (45%), Gaps = 29/274 (10%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++           VA   ++ +  + +   L +E+   K++R    IV
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHTN-IV 139

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            ++D     +        VY+L+E C  G L+D +  R    L E E+    +Q+   V 
Sbjct: 140 QFVDCFEDDT-------NVYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+   K++  K+ DFG ++ V+   R        +Y +    T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFG-LAAVLANDRER------KYTVC--GT 239

Query: 207 AQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFP 262
             Y  PE++   +      + DIW+ GV +Y       PF+    + I        F FP
Sbjct: 240 PNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDFVFP 298

Query: 263 AYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
                S     LI  +L +DPL+RP++ ++++ V
Sbjct: 299 KDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 129/274 (47%), Gaps = 29/274 (10%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++           VA   ++ +  + +   L +E+   K+++    IV
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVA---KLSIKSEKTRRKLLSEIQIHKSMKHPN-IV 150

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            + D     +        VY+L+E C  G +++ +  R +  L E E+   M Q+   + 
Sbjct: 151 QFTDCFEDDT-------NVYILLEICPNGSVMELL--RQRKHLTEPEVRFCMIQIIGAIR 201

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+   K +  K+ DFG ++ V+    N +E  Y         T
Sbjct: 202 YMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFG-LAAVLA---NDKERKYTICG-----T 250

Query: 207 AQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFE-KNGESA---ILASKFEFP 262
             Y  PE++   +      + DIW++GV LY   +   PF+ K  E+    I    F FP
Sbjct: 251 PNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFP 309

Query: 263 AYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
           A    S   KNLIS +L+++P  RP++ ++ + V
Sbjct: 310 ADKPVSSDAKNLISHLLQLNPAARPSLYEITDNV 343

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 124/274 (45%), Gaps = 29/274 (10%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++           VA   ++ +  + +   L +E+   K++R    IV
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHFN-IV 139

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            +ID     +        VY+L+E C  G L+D +  R    L E E+    +Q+   V 
Sbjct: 140 QFIDCFEDDT-------NVYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH+ +  +IHRD+K+ N+   K++  K+ DFG ++ V+   R        +Y +    T
Sbjct: 191 YMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFG-LAAVLANDRER------KYTVC--GT 239

Query: 207 AQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFP 262
             Y  PE++   +      + DIW+ GV +Y       PF+    + I        + FP
Sbjct: 240 PNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDYVFP 298

Query: 263 AYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
                S     LI  +L +DPL+RP++ ++++ V
Sbjct: 299 RDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 100/207 (48%), Gaps = 28/207 (13%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQN-RLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           Y+L EY SGG L+D++   +Q+  L+E         ++  +  +H+    ++HRD+KIEN
Sbjct: 283 YMLFEYVSGGQLLDYI---IQHGSLREHHARKFARGIASALQYLHSNN--IVHRDLKIEN 337

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLP 222
           +++S + E K+ DFG +S +    R    F    Y         +  PE++    Y G  
Sbjct: 338 IMISTSGEIKIIDFG-LSNLYDTTRQLHTFCGSLY---------FAAPELLKAHPYTGPE 387

Query: 223 IDEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVM 278
           +    D+W+ GV LY       PF+    S     I   K ++P +   S  V +L+S M
Sbjct: 388 V----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPQH--LSIEVISLLSKM 441

Query: 279 LRVDPLKRPNICQVVEEVSRIQGIPCP 305
           L VDP KR  + QVVE    ++G   P
Sbjct: 442 LVVDPKKRATLRQVVEHHWMVRGYDNP 468

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 87/331 (26%), Positives = 136/331 (41%), Gaps = 73/331 (22%)

Query: 13  TILPVGSHQVKVLKYLASGGFAHVYSVEISPP----------DPVCPDNVACLKRVVVP- 61
           T + VGS +  V K +  G FA V+   +  P          D    +N  C    +VP 
Sbjct: 29  TTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPR 88

Query: 62  ----DKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGL 117
               +K  L  L  E+  +K +  +  IV  ID   T         + YL+MEYCS G L
Sbjct: 89  SKLKNKKLLENLEIEIAILKKI-SHPHIVKLIDFERTSK-------DFYLIMEYCSLGDL 140

Query: 118 IDFMNTRLQ----------------------NRLQEFEILNIMSQVSQGVAAMHALQPPL 155
              +  R Q                      N L +  ILN + Q+S  +  + +    L
Sbjct: 141 TFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKN--L 198

Query: 156 IHRDIKIENVLLSK-----NHEFKLCDFGSVSGVIRAP-RNTEEFNYVQYDIMKNTTAQ- 208
           +HRDIK +N+LLS      N      D G V G+   P     +F + ++  + NT+   
Sbjct: 199 VHRDIKPQNLLLSAPLINYNDPKSFHDLGFV-GIYNLPILKIADFGFARF--LPNTSMAE 255

Query: 209 -------YRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILA----- 256
                  Y  PE+++  +    + K+D+W++G  LY+ CY   PF+ +    +       
Sbjct: 256 TLCGSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKA 312

Query: 257 -SKFEFPAYPRYSDRVKNLISVMLRVDPLKR 286
                FP Y    + +K+LIS +L  DP +R
Sbjct: 313 NDLIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/220 (29%), Positives = 105/220 (47%), Gaps = 42/220 (19%)

Query: 83  KFIVSYIDSHATKSPVNVGMYEV-------YLLMEYCSGGGLIDFMNTRLQNRLQEFEIL 135
           + ++  + SHA      +G+YEV       YL++EY  GG L D++ +R   RL E E +
Sbjct: 166 EIVIMKLISHANV----LGLYEVWENKSELYLVLEYVDGGELFDYLVSR--GRLCEREAV 219

Query: 136 NIMSQVSQGVAAMHALQPPLIHRDIKIENVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEF 194
           +   Q+ QGV+  HA    + HRD+K EN+LL  KN   K+ DFG  +            
Sbjct: 220 HYFKQIIQGVSYCHAFN--ICHRDLKPENLLLDKKNSTIKIADFGMAAL----------- 266

Query: 195 NYVQYDIMKNTTA--QYRCPEMI--DLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNG 250
             V   +++ +     Y  PE++    Y G P    SD+W+ G+ L+       PF  + 
Sbjct: 267 -EVSNKLLQTSCGSPHYASPEIVMGKQYHGGP----SDVWSCGIILFALLTGHLPFNDDS 321

Query: 251 ESAIL----ASKFEFPAYPRYSDRVKNLISVMLRVDPLKR 286
              +L    + K++ P     S   ++LI+ +L V+P KR
Sbjct: 322 IKKLLLKVQSGKYQMPQ--NLSKEAQDLIAKILTVNPAKR 359

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 129/301 (42%), Gaps = 58/301 (19%)

Query: 55  LKRVVVP--DKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYC 112
           LKR+  P  +  S++    EVD+ K  + + +I++ +DS   +     G   + +L+ Y 
Sbjct: 73  LKRIRCPFGNIESISAAMKEVDNYKRFQ-SPYIITLVDSQVVQE--KDGSKTLCILLPYF 129

Query: 113 SGGGLIDFMNTRL--QNRLQEFEILNIMSQVSQGVAAMH--------------------- 149
             G L D +N  L     + E E + IM  +++G+  +H                     
Sbjct: 130 PLGSLQDMVNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSY 189

Query: 150 -------ALQPPL----------------IHRDIKIENVLLSKNHEFKLCDFGSVSGVIR 186
                      PL                +HRDI++ N+L S      + D GS      
Sbjct: 190 SDEAAFLLDDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADI 249

Query: 187 APRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPF 246
                 + N +Q  +  N +  Y  PE++++     ID K+DIW++G   Y   +  +PF
Sbjct: 250 TVSTKHQLNELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPF 309

Query: 247 EK----NGES---AILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRI 299
           E+    +G S   AI   K+ FP   RYS+ +  +I   L+VDP  RP+I ++++ +  +
Sbjct: 310 ERELQVSGASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDL 369

Query: 300 Q 300
           Q
Sbjct: 370 Q 370

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 116/266 (43%), Gaps = 34/266 (12%)

Query: 28  LASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVS 87
           +  G F  VY         +    V  L+      +  ++ L  E+  +  LR       
Sbjct: 21  VGRGNFGDVYKAFDKTNGAIVAVKVVNLEHT----EEDIDLLAQEIFFLAELRS-----P 71

Query: 88  YIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAA 147
           YI ++ T    +V M+   ++MEYC GG   D + T   N L E ++  I  +V +G+  
Sbjct: 72  YITNYITTMIEDVSMW---IVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKY 128

Query: 148 MHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA 207
           +H  +   IHRDIK  N+LL+   + KL DFG VSG IRA      F    Y        
Sbjct: 129 LHDQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATMKRGTFVGTPY-------- 177

Query: 208 QYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFP----- 262
            +  PE+++       +EK+DIW+LG+ +Y+      P  K     ++ S    P     
Sbjct: 178 -WMAPEVVN-KESNGYNEKADIWSLGITVYELLKGLPPLSKCDPMKVMVS---LPRRKPP 232

Query: 263 -AYPRYSDRVKNLISVMLRVDPLKRP 287
             + +YSD  K  ++  L  DP  RP
Sbjct: 233 KLHGQYSDVAKGFVAACLVKDPNLRP 258

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 84/183 (45%), Gaps = 22/183 (12%)

Query: 116  GLIDFMN-TRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFK 174
            G ID  +   L+N + E E+  I  Q+  G+  +H     +IHRDIK ENV++      K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 175  LCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLPIDEKSDIWAL 232
            L DFGS + V   P          +D+   T   Y  PE++  D Y G P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 233  GVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQV 292
            G+ LY   +   PF    E  IL  +  F      S   K LIS++L  +  KRP I  +
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTIDDI 1432

Query: 293  VEE 295
              +
Sbjct: 1433 YND 1435

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 99/195 (50%), Gaps = 25/195 (12%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           V++++EYCSG  L + +    + RL   E   + SQ++  V   H L+   +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHL--LKEQRLSLEESKKLFSQIASAVYYAHELK--CVHRDLKLEN 158

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMID--LYRGLP 222
           VLL  N   KL DFG    +  A R+       Q + +  TT  Y  PE+I+   Y G  
Sbjct: 159 VLLDGNGHAKLTDFGFTREM--ATRS-------QLETICGTTV-YMAPELIERKCYDGFK 208

Query: 223 IDEKSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPAYPRYSDRVKNLISVM 278
           +    DIW+LG+ LY       PF+++ +      I+  + +F      SD   +LI  M
Sbjct: 209 V----DIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQ-EWISDDAIDLIQGM 263

Query: 279 LRVDPLKRPNICQVV 293
           LR +P +R ++ QV+
Sbjct: 264 LRKNPNERISLAQVL 278

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 100/206 (48%), Gaps = 26/206 (12%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       ++E +       ++  +  +HA    ++HRD+KIEN+
Sbjct: 218 YMLFEYVSGGQLLDYIIQ--HGSIREHQAKKFARGIASALMYLHANN--IVHRDLKIENI 273

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLPI 223
           ++S + E K+ DFG +S +  + +    F    Y         +  PE++  + Y G  +
Sbjct: 274 MISDSSEIKIIDFG-LSNLYDSRKQLYTFCGSLY---------FAAPELLKANPYTGPEV 323

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               D+W+ GV L+       PF+    S     I   K E+P +   S  V +L+S ML
Sbjct: 324 ----DVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKML 377

Query: 280 RVDPLKRPNICQVVEEVSRIQGIPCP 305
            VDP +R  + QVVE    ++G   P
Sbjct: 378 VVDPKRRATLKQVVEHHWMVRGFSGP 403

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 108/225 (48%), Gaps = 38/225 (16%)

Query: 83  KFIVSYIDSHATKSPVNVGMYEVY-------LLMEYCSGGGLIDFMNTRLQNRLQEFEIL 135
           + I+  + SH    P  +G+YEV+       L++EY  GG L D++ +R   RL E E +
Sbjct: 107 EIIIMKLISH----PNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSR--GRLPEKEAI 160

Query: 136 NIMSQVSQGVAAMHALQPPLIHRDIKIENVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEF 194
           +   Q+ +G A  H     + HRD+K EN+LL  KN   K+ DFG  +  ++      E 
Sbjct: 161 HYFRQIIEGTAYCHGFN--ICHRDLKPENLLLDKKNKRIKIADFGMAA--LQTSNKLLET 216

Query: 195 NYVQYDIMKNTTAQYRCPEMI--DLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGES 252
           +          +  Y  PE++    Y G P    SD+W+ G+ L+       PF  +   
Sbjct: 217 SC--------GSPHYASPEIVMGKNYNGGP----SDVWSCGIILFALLTGHLPFNDDNIK 264

Query: 253 AIL----ASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVV 293
            +L    A K++ P     S   ++LIS +L VDP KR +I +++
Sbjct: 265 RLLLKVQAGKYQMPQ--SVSSGAQDLISRILVVDPDKRISINEIL 307

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 102/213 (47%), Gaps = 38/213 (17%)

Query: 97  PVNVGMYEV-------YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMH 149
           P  +G+YEV       YL++EY  GG L D++ +R   +L E E ++   Q+ QGVA  H
Sbjct: 159 PNVMGLYEVWENKSELYLVLEYVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCH 216

Query: 150 ALQPPLIHRDIKIENVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA- 207
           A    + HRD+K EN+LL  KN   K+ DFG  +  +              D + +T+  
Sbjct: 217 AFN--ICHRDLKPENLLLDKKNKIIKIADFGMAALEVS-------------DKLLSTSCG 261

Query: 208 --QYRCPEMI--DLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPA 263
              Y  PE++    Y G P    +D+W+ G+ L+       PF  +    +L  K +   
Sbjct: 262 SPHYASPEIVMGKSYHGSP----TDVWSCGIILFALLTGHLPFNHDNIKKLLL-KVQSGV 316

Query: 264 YPRYSD---RVKNLISVMLRVDPLKRPNICQVV 293
           Y   SD     K+LIS +L VDP KR    +++
Sbjct: 317 YHMPSDLSPDAKDLISKILVVDPDKRLTTTEIL 349

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 109/241 (45%), Gaps = 45/241 (18%)

Query: 66   LNTLRAEVDSMKALR--GNKFIVSYID------SHATKSPVN--VGMYEVYLLMEYCSGG 115
            L T+ +E+  M  L    NK I+S +D       +  + PV+   G  +++ L+E+    
Sbjct: 1049 LGTIPSEIQIMSTLNKTSNKNILSILDFFEDDDYYYVEQPVHGKTGCIDLFDLIEF---- 1104

Query: 116  GLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKL 175
                      +  + EFE   I  Q+  G++ +H  +  ++HRDIK ENV++      KL
Sbjct: 1105 ----------KTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVKL 1152

Query: 176  CDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLPIDEKSDIWALG 233
             DFGS + V   P          +D+   T   Y  PE++  + Y G P     DIWALG
Sbjct: 1153 IDFGSAAYVKNGP----------FDVFVGTI-DYASPEVLRGEKYEGKP----QDIWALG 1197

Query: 234  VFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVV 293
            + LY   +   PF    E  IL    +FP     S    +LI ++L    L+RP+I  + 
Sbjct: 1198 ILLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDIS 1255

Query: 294  E 294
            E
Sbjct: 1256 E 1256

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 107/229 (46%), Gaps = 44/229 (19%)

Query: 83  KFIVSYIDSHATKSPVNVGMYEV-------YLLMEYCSGGGLIDFMNTRLQNRLQEFEIL 135
           + I+  + SH    P  +G+YEV       YL++EY  GG L D++ ++   +L E E +
Sbjct: 124 EIIIMKLISH----PNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSK--GKLPESEAI 177

Query: 136 NIMSQVSQGVAAMHALQPPLIHRDIKIENVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEF 194
           +   Q+ Q VA  H     + HRD+K EN+LL  K    K+ DFG  +            
Sbjct: 178 HYFKQIVQAVAYCHGFN--ICHRDLKPENLLLDKKKRSIKIADFGMAA------------ 223

Query: 195 NYVQYDIMKNTTA---QYRCPEMI--DLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKN 249
                D +  T+     Y  PE++    Y G P    SD+W+ G+ L+       PF  +
Sbjct: 224 -LETSDKLLETSCGSPHYASPEIVLGRKYHGSP----SDVWSCGIILFALLTGHLPFNDD 278

Query: 250 GESAIL----ASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVE 294
               +L    + K++ P +   S   K+LIS +L VDP +R  I Q+++
Sbjct: 279 NVKKLLLKVQSGKYQMPQW--LSVEAKDLISRILVVDPNRRITIDQILQ 325

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 131/275 (47%), Gaps = 29/275 (10%)

Query: 26  KYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFI 85
           ++L  GGFA  + ++           VA   ++ +  + +   L +E+   K+++ ++ I
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLLSEIQIHKSMK-HQNI 201

Query: 86  VSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGV 145
           V ++D    +  +NV     Y+L+  C  G L++ +  R    L E E+     Q+   +
Sbjct: 202 VQFVD--CFEDHINV-----YILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICGAI 252

Query: 146 AAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNT 205
             MH+ +  +IHRD+K+ N+   +N+  K+ DFG ++ V+   R        +Y +    
Sbjct: 253 KYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFG-LAAVLANDRER------KYTVC--G 301

Query: 206 TAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILA----SKFEF 261
           T  Y  PE++ L +      + DIW++GV ++       PF+    + I +    S++ F
Sbjct: 302 TPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSEYTF 360

Query: 262 PAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
           P     S   K LI  +L  DP+ RP+I +++E V
Sbjct: 361 PINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 109/231 (47%), Gaps = 31/231 (13%)

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRL 125
           ++ L  E+  +  L+ + +I++YI    T    +V M+   ++M+YC GG   D +    
Sbjct: 56  IDLLAQEIFFLAELKSD-YIINYI----TTIMEDVSMW---IVMDYCGGGSCSDLIKIVY 107

Query: 126 QNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVI 185
            N + E ++  I+  V  G+  +H  +   IHRDIK  N+LL+ + + KL DFG VSG I
Sbjct: 108 PNGIVEEKVSFIVKNVLLGLQYLHEQKK--IHRDIKAANILLTDDGQVKLGDFG-VSGQI 164

Query: 186 RAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTP 245
           +A    + F    Y         +  PE+I+       DEK DIW+LG+  Y+      P
Sbjct: 165 KATLKRDTFVGTPY---------WMAPEVINKEINNGYDEKVDIWSLGITTYELLKGVPP 215

Query: 246 FEKNGESAILAS-------KFEFPAYPRYSDRVKNLISVMLRVDPLKRPNI 289
             K     ++ S       K   P    Y+D  K+ IS  L  DP  RPN+
Sbjct: 216 LSKYDPVKVMTSLVKRKPPKLHGP----YNDFTKSFISFCLIKDPKLRPNV 262

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 97/199 (48%), Gaps = 31/199 (15%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           E+YL++EY  GG L D++ ++   +L E E ++   Q+  G++  H+    + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRDLKPE 264

Query: 164 NVLLSKNHE-FKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA--QYRCPEMI--DLY 218
           N+LL K     K+ DFG  +              V   +++ +     Y  PE++    Y
Sbjct: 265 NLLLDKKRRIIKIADFGMAAL------------QVSNRLLQTSCGSPHYASPEIVMGKCY 312

Query: 219 RGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILA----SKFEFPAYPRYSDRVKNL 274
            G P    SDIW+ G+ L+       PF  +    +L      +++ P+Y   S   KNL
Sbjct: 313 NGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNL 366

Query: 275 ISVMLRVDPLKRPNICQVV 293
           IS +L VDP KR +  Q++
Sbjct: 367 ISRILVVDPSKRISTEQIL 385

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 96/206 (46%), Gaps = 26/206 (12%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +H     ++HRD+KIEN+
Sbjct: 264 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHLNN--IVHRDLKIENI 319

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E K+ DFG +S V    +    F    Y         +  PE++    Y G  +
Sbjct: 320 MISNSGEIKIIDFG-LSNVFDNRKQLHTFCGSLY---------FAAPELLKAHPYTGPEV 369

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               D+W+ G+ LY       PF+    S     I   K E+P +   S  V +L+S M+
Sbjct: 370 ----DVWSFGIVLYVLVCGKVPFDDENSSVLHEKIRQGKVEYPNH--LSIEVISLLSKMI 423

Query: 280 RVDPLKRPNICQVVEEVSRIQGIPCP 305
            VDP KR ++ QVVE     +G   P
Sbjct: 424 VVDPAKRASLRQVVEHPWMTRGYDFP 449

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 98/193 (50%), Gaps = 22/193 (11%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E    N   Q+   +  +HA    ++HRD+KIEN+
Sbjct: 203 YMLFEYVSGGQLLDYIIQ--HGSLKESHARNFARQILSALKYLHANN--IVHRDLKIENI 258

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLP-ID 224
           ++S N   K+ DFG +S +    +  + +    Y         +  PE++   R  P I 
Sbjct: 259 MISSNGNIKIIDFG-LSNLYDKSKKLKTYCGSLY---------FAAPELL---RANPYIG 305

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFE--FPAYPRY-SDRVKNLISVMLRV 281
            + D+W+ GV LY       PF+ +  S +L  K +     YP++ S  V +L+S ML V
Sbjct: 306 PEIDVWSFGVVLYVLVCGKVPFD-DENSNVLHEKIKQGRVFYPQFLSIEVISLLSTMLVV 364

Query: 282 DPLKRPNICQVVE 294
           DP KR  + QV++
Sbjct: 365 DPFKRATLDQVMK 377

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 109/230 (47%), Gaps = 37/230 (16%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           E+YL++EY  GG L D++ ++   +L E E ++   Q+ +GV+  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 164 NVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA--QYRCPEMI--DLY 218
           N+LL  KN   K+ DFG     +  P            ++K +     Y  PE++    Y
Sbjct: 244 NLLLDKKNRRIKIADFG--MAALELPN----------KLLKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFPAYPRYSDRVKNL 274
            G P    SD+W+ G+ L+       PF  +    +L    + K++ P+    S   ++L
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPS--NLSSEARDL 345

Query: 275 ISVMLRVDPLKRPNICQVVEE--VSRIQGIPCPIKNFYLLRMMDKQEQPR 322
           IS +L +DP KR    ++++   + +   +P       +LR M K    R
Sbjct: 346 ISKILVIDPEKRITTQEILKHPLIKKYDDLPVN----KVLRKMRKDNMAR 391

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 95/206 (46%), Gaps = 26/206 (12%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +H     ++HRD+KIEN+
Sbjct: 217 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIENI 272

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E ++ DFG +S +    +    F    Y         +  PE++    Y G  +
Sbjct: 273 MISSSGEIRIIDFG-LSNLYDPKKQLHTFCGSLY---------FAAPELLKAHPYTGPEV 322

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               DIW+ GV LY       PF+    S     I   K E+P +   S  V +L+S ML
Sbjct: 323 ----DIWSFGVVLYVLVCGKVPFDDENASVLHEKIKQGKVEYPQH--LSIDVISLLSKML 376

Query: 280 RVDPLKRPNICQVVEEVSRIQGIPCP 305
            VDPLKR  + QVV      +G   P
Sbjct: 377 VVDPLKRATLKQVVNHQWMQKGYDFP 402

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 93/190 (48%), Gaps = 27/190 (14%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           E+YL++EY  GG L D++ ++   +L E E ++   Q+ QGV+  H+    + HRD+K E
Sbjct: 210 ELYLVLEYVDGGELFDYLVSK--GKLSEKEAVHYFKQIIQGVSYCHSFN--ICHRDLKPE 265

Query: 164 NVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRG 220
           N+LL  KN   K+ DFG     +  P    + +          +  Y  PE++    Y G
Sbjct: 266 NLLLDKKNKSIKIADFG--MAALELPNKLLQTSC--------GSPHYASPEIVMGKSYHG 315

Query: 221 LPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFPAYPRYSDRVKNLIS 276
            P    SD+W+ G+ L+       PF  +    +L    A KF  P+    S   ++LIS
Sbjct: 316 GP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMPS--TLSPEAQDLIS 369

Query: 277 VMLRVDPLKR 286
            +L +DP KR
Sbjct: 370 RILVIDPSKR 379

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 105/210 (50%), Gaps = 26/210 (12%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGV-AAMHALQPP-LIHRDIKIE 163
           Y+  E+ SGG L+D++       L+E    N   +VS+G+ +A+  L    ++HRD+KIE
Sbjct: 167 YMFFEFISGGQLLDYIIQ--HGSLKE----NHARKVSRGILSALQYLHANNIVHRDLKIE 220

Query: 164 NVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPI 223
           N++LSK  E KL DFG +S +    ++ + F    Y         +  PE++  +  L  
Sbjct: 221 NIMLSKTGEIKLIDFG-LSNMYDPRKSLQTFCGSLY---------FAAPELLKAHPYL-- 268

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
             + D+W+ GV LY       PF+    SA    I   K  +P +   S  V +L+S +L
Sbjct: 269 GPEVDVWSFGVVLYVLVCGKVPFDDENSSALHEKIKKGKVTYPQF--LSIDVISLLSKIL 326

Query: 280 RVDPLKRPNICQVVEEVSRIQGIPCPIKNF 309
            VDP KR  + QVV     ++G   P +++
Sbjct: 327 VVDPQKRATLQQVVNHQWMLKGYDFPPQSY 356

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 109/234 (46%), Gaps = 31/234 (13%)

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRL 125
           ++ L  E+  +  LR   F+ +Y  ++      +V M+   ++ME+C GG   D +    
Sbjct: 76  IDVLAQEIYFLSELRA-PFVTTYYKTYVE----DVSMW---IVMEFCGGGSCADLLKHLP 127

Query: 126 QNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVI 185
           ++RL E ++  I+ +V  G+  +H+ +   IHRD+K  N+LL+   E KL DFG VSG I
Sbjct: 128 EHRLPENKVAYIIREVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG-VSGQI 184

Query: 186 RAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTP 245
            A      F    Y         +  PE+I    G   DEK+DIW+LG+   +      P
Sbjct: 185 MATLKRNTFVGTPY---------WMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPP 233

Query: 246 FEKNGESAILASKFEFPAYP------RYSDRVKNLISVMLRVDPLKRPNICQVV 293
           + K     +L +    P         R++   ++ I++ L  DP  RP    ++
Sbjct: 234 YAKYDPMKVLMN---IPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 98/203 (48%), Gaps = 33/203 (16%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           + +++EY SGG    ++  +   RL+E     + +Q+  GV  MH+    L+HRD+K+EN
Sbjct: 120 IGIVLEYASGGEFYKYIQKK--RRLKESAACRLFAQLISGVYYMHSKG--LVHRDLKLEN 175

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ--YRCPEMIDLYRGLP 222
           +LL KN    + DFG V+  +  P N         ++MK +     Y  PE++   R  P
Sbjct: 176 LLLDKNENLLITDFGFVNEFL--PEN---------ELMKTSCGSPCYAAPELVVTAR--P 222

Query: 223 ID-EKSDIWALGVFLYKTCYYTTPFEKNGESA-----------ILASKFEFPAYPRYSDR 270
            +  K+DIW+ GV +Y       P++ + E+            I  +  +FP Y   +  
Sbjct: 223 YEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPDY--IAPV 280

Query: 271 VKNLISVMLRVDPLKRPNICQVV 293
            ++L+  +L  DP KR  I Q +
Sbjct: 281 PRDLLRAILVADPKKRITIAQTL 303

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 97/198 (48%), Gaps = 27/198 (13%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           E++L++EY  GG L D++ ++   +L E E ++   Q+ QGVA  H     + HRD+K E
Sbjct: 144 ELFLVLEYVEGGELFDYLVSK--GKLPEQEAVHYFRQIIQGVAYCHNYN--ICHRDLKPE 199

Query: 164 NVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRG 220
           N+L+  KNH+ K+ DFG     + A   T +            +  Y  PE++    Y G
Sbjct: 200 NLLVDKKNHQIKIADFG-----MAALETTNKLLETSCG-----SPHYASPEIVMGKNYHG 249

Query: 221 LPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFPAYPRYSDRVKNLIS 276
            P    SD+W+ G+ L+       PF  +    +L    + K+  P     S   ++LIS
Sbjct: 250 SP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKYHMPQ--NISSEAQDLIS 303

Query: 277 VMLRVDPLKRPNICQVVE 294
            +L VDP  R  I +V++
Sbjct: 304 KILIVDPRGRITINEVLQ 321

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 103/200 (51%), Gaps = 29/200 (14%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           + +++EY SGG    ++  +   RL+E     + +Q+  GV  MH+    L+HRD+K+EN
Sbjct: 123 IGIVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHSKG--LVHRDLKLEN 178

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ--YRCPEMIDLYRGLP 222
           +LL KN    + DFG V+          EFN+ + ++MK +     Y  PE++   +  P
Sbjct: 179 LLLDKNENLLITDFGFVN----------EFNH-KNELMKTSCGSPCYAAPELVVTTK--P 225

Query: 223 ID-EKSDIWALGVFLYKTCYYTTPFE---KNGESAILASKFEFPA-----YPRYSDRV-K 272
            +  K+DIW+ GV +Y       P++   +N E   +A  + +       +P Y + V +
Sbjct: 226 YEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPEYINPVPR 285

Query: 273 NLISVMLRVDPLKRPNICQV 292
           +L+  +L  +P KR N+ QV
Sbjct: 286 DLLRRILVSNPKKRLNLRQV 305

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 94/195 (48%), Gaps = 26/195 (13%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +HA    ++HRD+KIEN+
Sbjct: 199 YMLFEYVSGGQLLDYIIQ--HGSLKEHHARKFARGIASALQYLHANN--IVHRDLKIENI 254

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E K+ DFG +S +    +    F    Y         +  PE++    Y G  +
Sbjct: 255 MISSSGEIKIIDFG-LSNIFDYRKQLHTFCGSLY---------FAAPELLKAQPYTGPEV 304

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGES----AILASKFEFPAYPRYSDRVKNLISVML 279
               DIW+ G+ LY       PF+    S     I   K ++P++   S  V +L++ M+
Sbjct: 305 ----DIWSFGIVLYVLVCGKVPFDDENSSILHEKIKKGKVDYPSH--LSIEVISLLTRMI 358

Query: 280 RVDPLKRPNICQVVE 294
            VDPL+R  +  VVE
Sbjct: 359 VVDPLRRATLKNVVE 373

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 81/304 (26%), Positives = 130/304 (42%), Gaps = 61/304 (20%)

Query: 26  KYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFI 85
           K +  G FA VY    S  DP     V  + +  + +K  L  L  E+  +K L  +K I
Sbjct: 136 KEIGKGSFAVVYR-GYSNEDPNFKLAVKSVPKSKLKNKKILENLEIEISILKKL-NHKHI 193

Query: 86  VSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTR---------LQNRLQEFE--- 133
           V+ ID    K+       +  L+MEYCS G L   +  R         L    Q+F    
Sbjct: 194 VNLIDCQRNKN-------DFLLIMEYCSLGDLTFLIKKRNELIINHPLLNQIFQKFPSPN 246

Query: 134 ----------ILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLS-------KNHEFKLC 176
                     +LN + Q++  +  + +    LIHRDIK +N+LLS           FK  
Sbjct: 247 PDCNGLNIAFVLNYLQQLASALKFLRSRN--LIHRDIKPQNLLLSTPYTDYHDQQTFKKL 304

Query: 177 DFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ--------YRCPEMIDLYRGLPIDEKSD 228
            +  +S +        +F + ++  + NT+          Y  PE+++  +    + K+D
Sbjct: 305 GYIGISCL--PILKIADFGFARF--LPNTSLAETLCGSPLYMAPEILNYQK---YNAKAD 357

Query: 229 IWALGVFLYKTCYYTTPFEKNGESAILA------SKFEFPAYPRYSDRVKNLISVMLRVD 282
           +W++G  LY+  Y   PF+ N    +L           FP+Y    D +K LIS +L+ D
Sbjct: 358 LWSVGTVLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSYIEIDDDMKFLISRLLKFD 417

Query: 283 PLKR 286
           P+KR
Sbjct: 418 PIKR 421

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 127/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           +L  GGFA  + ++           VA   ++ +  + +   L +E+   K+++ +  IV
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMK-HPNIV 137

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
            +ID     +        VY+L+E C  G L+D +  R    L E E+    +Q+   + 
Sbjct: 138 QFIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIK 188

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTT 206
            MH  +  +IHRD+K+ N+    N+  K+ DFG ++ V+   R        +Y +    T
Sbjct: 189 YMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLANDRER------KYTVC--GT 237

Query: 207 AQYRCPEMI-DLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEF 261
             Y  PE++   + G   +   DIW++GV +Y       PF+    + I     +  + F
Sbjct: 238 PNYIAPEVLAGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQAKEVNIIYERIKSGDYIF 295

Query: 262 PAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296
           P     S  V  LI  +L +DP++RP++ ++++ V
Sbjct: 296 PREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 101/211 (47%), Gaps = 34/211 (16%)

Query: 97  PVNVGMYEVY-------LLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMH 149
           P  +G+YEV+       L++EY  GG L D++ +R   +L E E ++   Q+ +GV+  H
Sbjct: 179 PNVMGLYEVWENKSELFLVLEYVDGGELFDYLVSR--GKLSEREAVHYFKQIIEGVSYCH 236

Query: 150 ALQPPLIHRDIKIENVLLSKN-HEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ 208
           +    + HRD+K EN+LL K  +  K+ DFG     +  P         +  +    +  
Sbjct: 237 SFN--ICHRDLKPENLLLDKKINTIKIADFG--MAALELPN--------KLLVTSCGSPH 284

Query: 209 YRCPEMI--DLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFP 262
           Y  PE++    Y G P    SD+W+ G+ L+       PF  +    +L    + KF+ P
Sbjct: 285 YASPEIVMGKSYHGSP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKFQMP 340

Query: 263 AYPRYSDRVKNLISVMLRVDPLKRPNICQVV 293
                S   ++LIS +L VDP KR  I  ++
Sbjct: 341 Q--NISLEAEDLISRILVVDPEKRIQINDIL 369

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/215 (30%), Positives = 99/215 (46%), Gaps = 39/215 (18%)

Query: 97  PVNVGMYEV-------YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMH 149
           P  +G+Y+V       YL++EY   G L + +  R    L E E +    Q+   V+  H
Sbjct: 87  PNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDR--GALPEREAMKCFRQIIIAVSYCH 144

Query: 150 ALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA-- 207
           AL   ++HRD+K EN+LL  ++  K+ DFG  +              +Q D     T+  
Sbjct: 145 ALG--IVHRDLKPENLLLDSDYNIKVADFGMAA--------------LQTDAALLETSCG 188

Query: 208 --QYRCPEMIDLYRGLPIDE-KSDIWALGVFLYKTCYYTTPF-EKNGESAILASK----- 258
              Y  PE++    GLP +   SD+W+ GV L+       PF E+NG    L  K     
Sbjct: 189 SPHYAAPEIVS---GLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQ 245

Query: 259 FEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVV 293
           FE P     S   ++LIS +L VDP +R  I  ++
Sbjct: 246 FEMPDDTEISKDAQDLISKILVVDPAQRIKIRDIL 280

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 101/203 (49%), Gaps = 39/203 (19%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           V++ +EYC G  L +++   ++ R+   E  ++ SQ+   V   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 165 VLLSKNHEFKLCDFG-----SVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL-- 217
           +LL K  + KL DFG     +  G++              + +  TT  Y  PE+I+   
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGIL--------------ETVCGTTV-YMAPELIERKP 203

Query: 218 YRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEF-PAYPRYSDRV----- 271
           Y G  I    D W+LG+ LY   +   PF+   E   + +K+      P Y D       
Sbjct: 204 YEGYKI----DTWSLGIILYTMIHGAMPFD---EEDDIKTKYRIVNNEPFYDDNFIDANG 256

Query: 272 KNLISVMLRVDPLKRPNICQVVE 294
           K+LI  +L+ DP +RP++ QV++
Sbjct: 257 KDLIMQLLQKDPSQRPSLTQVLQ 279

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 103/213 (48%), Gaps = 23/213 (10%)

Query: 88  YIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAA 147
           YI ++ T    +V M+   ++MEYC GG   D +       L E ++  I   V +G+  
Sbjct: 78  YITNYITTMLEDVSMW---IVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQY 134

Query: 148 MHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIR--APRNTEEFNYVQYDIMKNT 205
           +H  +   IHRD+K  NVLL+ +   KL DFG VSG +R  A RNT    +V        
Sbjct: 135 LHEQRK--IHRDVKAANVLLTDDGLVKLADFG-VSGQLRSTAKRNT----FV-------G 180

Query: 206 TAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILAS---KFEFP 262
           T  +  PE+I        +EK+DIW+LG+ +Y+      P+ K     ++ +   K    
Sbjct: 181 TPYWMAPEIIS-NSSHGYNEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQD 239

Query: 263 AYPRYSDRVKNLISVMLRVDPLKRPNICQVVEE 295
               +SD  K  IS  L  DP +RP   +++++
Sbjct: 240 CMVSFSDAAKLFISACLIKDPDERPTATELLQQ 272

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/354 (22%), Positives = 136/354 (38%), Gaps = 75/354 (21%)

Query: 9   YASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCP-----DNVACLKRVVVPDK 63
           +  G  + +      V   L  G    +Y V+       CP       V  LK+V  P  
Sbjct: 18  WFDGVRISINGKSYLVTTLLREGELTALYQVK-------CPKRSHSGGVYALKKVTCPIG 70

Query: 64  ASLNTLRAEVDSMKALRGNK-FIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMN 122
            +    RA  +     R N  +I + +D    +   + G   +Y+L+ Y   G L D +N
Sbjct: 71  RADFVTRAMTEISNYQRFNSPYITNILDFQVAQH--DNGTKIIYMLLPYFPAGSLQDLIN 128

Query: 123 TRL--QNRLQEFEILNIMSQVSQGVAAMH------------------------------- 149
             +   + L E  ++ +M  + +GV  MH                               
Sbjct: 129 NMIIRGDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLV 188

Query: 150 ------ALQPPL--------IHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAP---RNTE 192
                  L PPL        +H  +  EN++LS      L    +++  +RAP    +  
Sbjct: 189 DAMELDLLSPPLTNSEPSAYVHCGLNPENIMLSSE---GLPVIYNMASCVRAPLELTSNS 245

Query: 193 EFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGE- 251
           +   +Q  + +N+   Y CPE++DL+    I  + DIW+LG   Y   Y  + F +  + 
Sbjct: 246 KLLGLQEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQL 305

Query: 252 ------SAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRI 299
                  +I    F FP  PRYS  +K ++   L +DP KRP+I + + +   +
Sbjct: 306 CGTPIKHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 138/300 (46%), Gaps = 58/300 (19%)

Query: 8   KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV--PDKAS 65
           ++ S  +  VG++  K+LK +  G F  VY + I  P           ++VV+    K  
Sbjct: 25  QFTSNELYEVGNY--KILKQVGEGSFGKVY-LAIHRP---------THRKVVLKSSSKTD 72

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATK-SPVNVGMYEVYLLMEYCSGGGLIDFMNTR 124
            N +R      +     +F   YI    TK   + +   +V++ +EYC G  L D++   
Sbjct: 73  PNVVR------EVFYHRQFDHPYI----TKLYEIIITETKVWMSLEYCPGKELYDYL--L 120

Query: 125 LQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGV 184
           +  R+   E   + +Q+   V   H+L    +HRD+K+EN+LL      KL DFG     
Sbjct: 121 VMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLENILLDMQGNAKLADFGFTREC 178

Query: 185 IRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLPIDEKSDIWALGVFLYKTCYY 242
             A +N       Q + +  TT  Y  PE++  D Y G  I    DIW+LGV LY     
Sbjct: 179 --ATKN-------QLETICGTTV-YMAPELLRRDTYDGFKI----DIWSLGVILYTLING 224

Query: 243 TTPFEKNGESAILASKFEFPAY---PRYSDRVKN-----LISVMLRVDPLKRPNICQVVE 294
           + PF++  E     ++ E+      P Y++++ N     LI  +L  DP KRP++ ++++
Sbjct: 225 SMPFDEEDE-----TRTEWKIINEEPDYNEKIFNANSIELIKSLLIKDPKKRPSMTEILK 279

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/179 (32%), Positives = 84/179 (46%), Gaps = 20/179 (11%)

Query: 116  GLIDFMN-TRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFK 174
            G ID  +   L+  + E+E   I  QV   +  +H+    ++HRDIK ENV++      K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVK 1151

Query: 175  LCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEK-SDIWALG 233
            L DFGS + V   P          +D+   T   Y  PE++    G P D K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---SGEPFDGKPQDIWAIG 1197

Query: 234  VFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQV 292
            V LY   +   PF    E  IL    +F      S+   NLI ++L  +P +RP I +V
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 98/213 (46%), Gaps = 22/213 (10%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +H     ++HRD+KIEN+
Sbjct: 179 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIENI 234

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDE 225
           ++S + E K+ DFG +S +    +    F    Y         +  PE++  +    I  
Sbjct: 235 MISTSGEIKIIDFG-LSNMYDPKKQLHTFCGSLY---------FAAPELLKAHPY--IGP 282

Query: 226 KSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVMLRV 281
           + D+W+ GV LY       PF+    S     I   K E+P +   S  V +L+S ML V
Sbjct: 283 EVDVWSFGVVLYVLVCGKVPFDDENASVLHEKIKQGKVEYPQH--LSIEVISLLSKMLVV 340

Query: 282 DPLKRPNICQVVEEVSRIQGIPCPIKNFYLLRM 314
           DP KR  + QVV      +G   P  ++   R+
Sbjct: 341 DPSKRATLKQVVSHQWMQRGYDFPAPSYLPYRV 373

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 119/255 (46%), Gaps = 39/255 (15%)

Query: 51  NVACLKRVVVPDKAS--LNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLL 108
           N  C  +V+  D A   +  ++ EV  + +L+    I  Y  S+   +       E++++
Sbjct: 42  NRVCAIKVLNLDSADDEVEDVQKEVQFLSSLKQVPNITHYYGSYLNNT-------ELWVI 94

Query: 109 MEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLS 168
           MEYC+GG L   +      ++ E  I  IM ++   +A MH  +  +IHRDIK  NVL++
Sbjct: 95  MEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--IALMHIHKDGVIHRDIKAANVLIT 149

Query: 169 KNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ---YRCPEMIDLYRGLPIDE 225
            +   KLCDFG  + +             Q  I + T A    +  PE+I    G+  D 
Sbjct: 150 NDGHIKLCDFGVAAQL------------SQTKIRRQTMAGTPYWMAPEVI--MEGVYYDT 195

Query: 226 KSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYP------RYSDRVKNLISVML 279
           K DIW+LG+  Y+      P+      A+ A +    + P      ++S  +K  I++ L
Sbjct: 196 KVDIWSLGITAYEIATGNPPY--CDVEALRAMQLITKSKPPRLEGRQHSSALKEFIALCL 253

Query: 280 RVDPLKRPNICQVVE 294
             DP +RP+  ++++
Sbjct: 254 DEDPKERPSAEELLK 268

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 108/230 (46%), Gaps = 37/230 (16%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           E+YL++EY  GG L D++ ++   +L E E ++   Q+ +GV+  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 164 NVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA--QYRCPEMI--DLY 218
           N+LL  KN   K+ DFG     +  P            ++K +     Y  PE++    Y
Sbjct: 244 NLLLDKKNRRIKIADFG--MAALELPN----------KLLKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFPAYPRYSDRVKNL 274
            G P    SD+W+ G+ L+       PF  +    +L    + K++ P     S   ++L
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPM--NLSAEARDL 345

Query: 275 ISVMLRVDPLKRPNICQVVEE--VSRIQGIPCPIKNFYLLRMMDKQEQPR 322
           IS +L +DP KR    ++++   + +   +P       +LR M +    R
Sbjct: 346 ISKILVIDPAKRITTQEILKHPLIKKYDDLPVN----KILRKMKRDNMAR 391

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 85/356 (23%), Positives = 145/356 (40%), Gaps = 76/356 (21%)

Query: 5   QIEKYASGTI----------LPVGSHQVKVLKYLASGGFAHVYSVE-----ISPPDPVCP 49
           Q+ K+  GT           L +   +  + K L    F+ +Y V+      +   P   
Sbjct: 6   QLLKFICGTCCCCCDYSESYLSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTP--R 63

Query: 50  DNVACLKRVVVP--DKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYL 107
            N+  LKR+  P  +  S++    EVD+ K  + + +I+  +DS   +     G   VY+
Sbjct: 64  TNLYALKRIRCPFGNIESISGAMKEVDNYKRFQ-SPYIIHLVDSQVAQQ--RDGSKTVYI 120

Query: 108 LMEYCSGGGLIDFMNTRLQNR--LQEFEILNIMSQVSQGVAAMHA--------------- 150
           L+ Y   G L D  +  L N   + E E + I+  +++G+  +H                
Sbjct: 121 LLPYFPLGSLQDSTSRNLLNGTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHD 180

Query: 151 ------------------LQPPLI------------HRDIKIENVLLSKNHEFKLCDFGS 180
                             L+  ++            HRDIK  N+L S +    + + GS
Sbjct: 181 AVSMSYSDEAAFLLEDTPLELDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGS 240

Query: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240
            S    +     +   +Q  +  + T  Y  PE++ +     +D K DIW+LG   Y   
Sbjct: 241 CSKADLSINTGMQLTELQAWVSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFML 300

Query: 241 YYTTPFEK----NGES---AILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNI 289
           +  +PFE+    +G S   AI    F FP+  RYS+ +  LI+  L+V+P  RP+I
Sbjct: 301 FGISPFEREEQISGASLKYAIGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 86/317 (27%), Positives = 137/317 (43%), Gaps = 53/317 (16%)

Query: 8   KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVP--DKAS 65
           ++ +  +  VG++  K++K +  G F  VY     P            ++VV+   DK  
Sbjct: 25  QFTAEELSEVGNY--KIMKQIGEGSFGKVYLASHKPTH----------RKVVLKTSDKND 72

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRL 125
            N +R      +     +F   YI        V V   +V++ +EYC G  L + +    
Sbjct: 73  PNVVR------EVFYHRQFDYLYI---TRLYEVIVTETKVWMALEYCPGKELYEHL--LA 121

Query: 126 QNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVI 185
             R+   E   + +Q+   +   H+L    +HRD+K+EN+LL K    KL DFG     +
Sbjct: 122 LKRISLDECSRLFAQIVGAIYYAHSLN--CVHRDLKLENILLDKKGNAKLTDFGFTRECV 179

Query: 186 RAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPIDEKSDIWALGVFLYKTCYYT 243
                       Q D +  TT  Y  PE+ +   Y G  I    DIWALGV LY     +
Sbjct: 180 SKS---------QLDTICGTTV-YMAPELTERKSYDGFKI----DIWALGVILYTMINGS 225

Query: 244 TPFEKNGESAILASKF----EFPAYPR--YSDRVKNLISVMLRVDPLKRPNICQVVEE-V 296
            PF+++ E+    +K+    E P       S   K+LI  +L  DP +RP+I +++    
Sbjct: 226 MPFDEDDEA---KTKWKIVNEMPEINEDLVSPDAKDLIEQLLAKDPNERPSIEKILTHPF 282

Query: 297 SRIQGIPCPIKNFYLLR 313
            +  GIP   K   +LR
Sbjct: 283 LQPYGIPLMEKTQKILR 299

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 105/210 (50%), Gaps = 19/210 (9%)

Query: 88  YIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAA 147
           +I ++ T    +V M+   ++MEYC GG   D +       + E ++  I+    +G+  
Sbjct: 72  FITNYITTLTEDVTMW---IVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKY 128

Query: 148 MHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA 207
           +H  +   IHRDIK  N+LL+   + KL DFG VSG IRA      F    Y        
Sbjct: 129 LHDQKK--IHRDIKAANILLTDCGKVKLGDFG-VSGQIRATMKRGTFVGTPY-------- 177

Query: 208 QYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILAS--KFEFPA-Y 264
            +  PE+I+  +    +EK+DIW+LG+  Y+      P  K     ++ +  K + P  +
Sbjct: 178 -WMAPEVIN-KQCKGYNEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLH 235

Query: 265 PRYSDRVKNLISVMLRVDPLKRPNICQVVE 294
            +YS++ K  +S+ L  DP +RP+I  ++E
Sbjct: 236 GQYSEKAKYFVSLCLIKDPKQRPSIEALLE 265

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 102/215 (47%), Gaps = 26/215 (12%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +HA    ++HRD+KIEN+
Sbjct: 245 YMLFEYVSGGQLLDYIIQ--HGSLREHHARRFARGIASALQYLHANN--IVHRDLKIENI 300

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLPI 223
           ++S + E KL DFG +S +    +    F    Y         +  PE++  + Y G  +
Sbjct: 301 MISTSGEIKLIDFG-LSNLYDNRKQLHTFCGSLY---------FAAPELLKANPYTGPEV 350

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               D+W+ GV LY       PF+    S     I   K E+  +   S  V +L+S ML
Sbjct: 351 ----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYSQH--LSIEVISLLSKML 404

Query: 280 RVDPLKRPNICQVVEEVSRIQGIPCPIKNFYLLRM 314
            VDP +R ++ QVV+    ++G      ++  LR+
Sbjct: 405 VVDPKRRASLKQVVDHHWMVRGYDTAPPSYLPLRV 439

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 89/203 (43%), Gaps = 22/203 (10%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +Y++++YCS   L   +  R    L E E   +M Q+  G+  +H     +IH D+K+ N
Sbjct: 116 IYMILDYCSNNSLQSILQYR--GSLNEVECKELMIQLCGGIYWLHL--NNVIHGDLKLSN 171

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPE---MIDLYRGL 221
           +L  +  + K+CDFGS      +PR   E     Y +   T   ++      M  L    
Sbjct: 172 ILFDEGQQLKICDFGSSFIATSSPRGPGEIMGTPYYLAPETVYTHKNINKSGMAILLISF 231

Query: 222 PIDEKSDIWALGVFLYKTCYYTTPFEKNGESA-----------ILASKFEFPAYPRYSDR 270
           PI    DIW++G+ LY   Y   PF K+ +             I +   EFP        
Sbjct: 232 PI----DIWSMGIVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAG 287

Query: 271 VKNLISVMLRVDPLKRPNICQVV 293
            + LI  ML  +PL+R  + ++V
Sbjct: 288 AQQLILKMLSQNPLERITLVEIV 310

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 97/208 (46%), Gaps = 28/208 (13%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +H     ++HRD+KIEN+
Sbjct: 9   YMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHMNN--IVHRDLKIENI 64

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E K+ DFG +S +    +    F    Y         +  PE++    Y G  +
Sbjct: 65  MISTSGEIKIIDFG-LSNMYNPKKQLHTFCGSLY---------FAAPELLKACPYTGPEV 114

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               D+W+ GV L+       PF+    S     I   K E+P +   S  V +L+S ML
Sbjct: 115 ----DVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKML 168

Query: 280 RVDPLKRPNICQVV--EEVSRIQGIPCP 305
            VDP KR ++ QVV  + + R    P P
Sbjct: 169 VVDPTKRASLKQVVNHQWMQRGYDFPAP 196

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 95/195 (48%), Gaps = 23/195 (11%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           +V++  EYC G  L D +   LQ R+     + + +Q+   V   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 164 NVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGL 221
           N+LL KN   KL DFG            E       + +  TT  Y  PE+I  + Y G 
Sbjct: 159 NILLDKNGNAKLTDFGFTR---------ECMTKTSLETICGTTV-YMAPELIKRESYDGF 208

Query: 222 PIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKF-EFPAYPR--YSDRVKNLISVM 278
            I    DIW+LGV LY     + PF+++ E+        E P +     S+  K+L+  +
Sbjct: 209 KI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAKDLLIKL 264

Query: 279 LRVDPLKRPNICQVV 293
           L  DP +RP++ +++
Sbjct: 265 LSKDPNERPSMQEIL 279

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 96/199 (48%), Gaps = 23/199 (11%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +Y L+EY   G  +  +  +    L E       SQ+   V ++H +   +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNETCARYYASQIIDAVDSLHNIG--IIHRDIKPEN 254

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNT-----TAQYRCPEMI-DLY 218
           +LL KN + KL DFG+   +   P NT +     +D+   +     TA+Y  PE++ D Y
Sbjct: 255 ILLDKNMKVKLTDFGTAKILPEEPSNTAD-GKPYFDLYAKSKSFVGTAEYVSPELLNDNY 313

Query: 219 RGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPA-YPRYSDRVKN 273
                D + DIWA G  LY+      PF+   E      ++  ++ F A +P+    VK+
Sbjct: 314 ----TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQI---VKD 366

Query: 274 LISVMLRVDPLKRPNICQV 292
           L+  +L  DP  R  I Q+
Sbjct: 367 LVKKLLVRDPNDRLTIKQI 385

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 135/299 (45%), Gaps = 56/299 (18%)

Query: 8   KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVP--DKAS 65
           ++ S  +  VG++  K+L  +  G F  VY  +  P             +VV+   DK  
Sbjct: 26  QFTSCGLKEVGNY--KILDQIGEGSFGKVYLAQHRPTHT----------KVVLKSSDKND 73

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRL 125
            N +R      +     +F   YI        V +   +V++ +EYC G  L D + +  
Sbjct: 74  PNIVR------EVFYHRQFDYPYI---TKLYEVIITETKVWMALEYCPGKELYDRVLS-- 122

Query: 126 QNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVI 185
            +R+   E + + +Q+  GV   H+L    +HRD+K+EN+LL K+ + KL DFG      
Sbjct: 123 MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLENILLDKSGDAKLTDFGFTR--- 177

Query: 186 RAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPIDEKSDIWALGVFLYKTCYYT 243
                 E       + +  TT  Y  PE+I+   Y G  I    DIW+LGV LY     +
Sbjct: 178 ------ECMTKTTLETICGTTV-YMAPELIERKSYDGFKI----DIWSLGVILYTMINGS 226

Query: 244 TPFEKNGESAILASKFEFPAY---PRYSDRV-----KNLISVMLRVDPLKRPNICQVVE 294
            PF+++ E     +K E+      P+ ++ +     K+LI  +L  +P  RP + Q+++
Sbjct: 227 MPFDEDDE-----TKTEWKIVHQTPQLNENIVTADAKDLILRLLAKNPNDRPTVEQILK 280

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 95/195 (48%), Gaps = 23/195 (11%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           V++ +EYC G  L D++   L+ R+   E   + +Q+   V   H+LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLP 222
           +LL KN    L DFG            E     Q + +  TT  Y  PE+I  + Y G  
Sbjct: 159 ILLDKNGYAMLTDFGFTR---------ECATKTQLETVCGTTV-YMAPELIKREAYDGYK 208

Query: 223 IDEKSDIWALGVFLYKTCYYTTPFEKNGESAI-LASKFEFPAY--PRYSDRVKNLISVML 279
           +    D W+LG+ LY   +   PF+++      L    E PA      S + K+LI  +L
Sbjct: 209 V----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLL 264

Query: 280 RVDPLKRPNICQVVE 294
             +  +RPN+ +V++
Sbjct: 265 DKNAAQRPNLNEVLQ 279

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 85/296 (28%), Positives = 135/296 (45%), Gaps = 50/296 (16%)

Query: 8   KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPD--KAS 65
           ++ S  +  VG++  ++L+ +  G F  VY     P            ++VV+    K+ 
Sbjct: 25  QFMSDDLTEVGNY--RILRQIGEGSFGKVYLAHHLP----------THRKVVLKSSAKSD 72

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATK-SPVNVGMYEVYLLMEYCSGGGLIDFMNTR 124
            N +R      +     +F   YI    TK   + V   +V++ +EYC G  L + +  R
Sbjct: 73  PNVVR------EVFYHRQFEFPYI----TKLYEIIVTETKVWMALEYCPGKELYEHL-LR 121

Query: 125 LQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGV 184
           L  R+   E   + +Q+S  +   H+L    +HRD+K+EN+LL K    KL DFG     
Sbjct: 122 LH-RIPVDECSRLFAQISGAMYYAHSLN--CVHRDLKLENILLDKVGNAKLTDFGFTREC 178

Query: 185 IRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLPIDEKSDIWALGVFLYKTCYY 242
             A +N  E        +  TT  Y  PE+I  + Y G  I    D+W+LGV LY     
Sbjct: 179 --ASKNILE-------TICGTTV-YMAPELIKRERYDGFKI----DVWSLGVILYTLLNG 224

Query: 243 TTPFE----KNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVE 294
             PF+    KN E  I+     F +     D V +L+S +L  DP+ RP++ +V+E
Sbjct: 225 FMPFDEEQQKNTEWKIVNEMPSFDSTLLGPDAV-DLLSKLLAKDPIDRPSMKEVLE 279

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/249 (29%), Positives = 113/249 (45%), Gaps = 45/249 (18%)

Query: 8   KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV--PDKAS 65
           ++ S  ++ VG++  ++LK +  G F  VY     P            ++VV+   DK  
Sbjct: 29  QFMSDELIEVGNY--RILKQIGEGSFGKVYLALHRPTH----------RKVVLKTSDKND 76

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATKS-PVNVGMYEVYLLMEYCSGGGLIDFMNTR 124
            N +R      +     +F   YI    TK   + V   +V++ +EYC G  L D +   
Sbjct: 77  PNIVR------EVFYHRQFDYPYI----TKVYEIIVTETKVWMALEYCPGKELYDHL--L 124

Query: 125 LQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGV 184
              R+   E   + +Q+   V   H+L    +HRD+K+EN+LL K+   KL DFG     
Sbjct: 125 FSKRIPIAECTELFAQIVGAVYYAHSLN--CVHRDLKLENILLDKHGRAKLTDFGFTREC 182

Query: 185 IRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPIDEKSDIWALGVFLYKTCYY 242
           +   R+T E        +  TT  Y  PE+I+   Y G  I    DIWALGV LY   Y 
Sbjct: 183 M--TRSTLE-------TVCGTTV-YMAPELIERKSYDGFKI----DIWALGVILYTMIYG 228

Query: 243 TTPFEKNGE 251
             PF+++ E
Sbjct: 229 AMPFDEDDE 237

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 101/215 (46%), Gaps = 26/215 (12%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +H     ++HRD+KIEN+
Sbjct: 254 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHGNN--IVHRDLKIENI 309

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLPI 223
           ++S + + K+ DFG +S +  + +    F    Y         +  PE++  + Y G  +
Sbjct: 310 MISTSGDIKIIDFG-LSNLYDSKKQLNTFCGSLY---------FAAPELLKANPYVGPEV 359

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               DIW+ GV LY       PF+    S     I   K ++P +   S  V +L+S ML
Sbjct: 360 ----DIWSFGVVLYVLACGKVPFDDENSSVLHEKIKQGKVDYPQH--LSIEVISLLSKML 413

Query: 280 RVDPLKRPNICQVVEEVSRIQGIPCPIKNFYLLRM 314
            VDP KR ++ Q+V      +G      ++  LR+
Sbjct: 414 VVDPKKRASLQQIVNHPWMTRGFDTKAPSYLPLRV 448

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 96/208 (46%), Gaps = 28/208 (13%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +H     ++HRD+KIEN+
Sbjct: 284 YMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHLNN--IVHRDLKIENI 339

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E K+ DFG +S +    +    F    Y         +  PE++    Y G  +
Sbjct: 340 MISTSGEIKIIDFG-LSNMFNPKKQLHTFCGSLY---------FAAPELLKACPYTGPEV 389

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               D+W+ GV LY       PF+    S     I   K E+P +   S  V +L+S ML
Sbjct: 390 ----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKML 443

Query: 280 RVDPLKRPNICQVV--EEVSRIQGIPCP 305
            VDP KR  + QVV  + + R    P P
Sbjct: 444 VVDPSKRATLKQVVNHQWMQRGYDFPAP 471

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 84/305 (27%), Positives = 134/305 (43%), Gaps = 40/305 (13%)

Query: 1   MNQPQIEKYASGTILPVGSH-QVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVV 59
           +   +I  +  G+IL  GS  +V + ++  +G  A V  V  S    V  +N + +    
Sbjct: 18  LKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIVGSN 77

Query: 60  VPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLID 119
            PD       R E+  MK L     +  Y D   TKS        +Y+++EY   G L +
Sbjct: 78  DPDLLPYGIER-EIIIMKLLNHTNVLRLY-DVWETKS-------NLYMVLEYVEKGELFN 128

Query: 120 FMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFG 179
            +  R    L E E +    Q+  G++  HAL   ++HRD+K EN+LL      K+ DFG
Sbjct: 129 LLVER--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFG 184

Query: 180 SVSGVIRAPRNTEEFNYVQYDIMKNTTA---QYRCPEMIDLYRGLPIDE-KSDIWALGVF 235
             +                 D +  T+     Y  PE++    GLP    +SD+W+ GV 
Sbjct: 185 MAA-------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVI 228

Query: 236 LYKTCYYTTPF-EKNG--ESAIL---ASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNI 289
           LY       PF E NG   S +L   + ++E P     S   ++LI+ +L VDP +R   
Sbjct: 229 LYALLTGRLPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKT 288

Query: 290 CQVVE 294
            ++++
Sbjct: 289 REILK 293

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 92/195 (47%), Gaps = 26/195 (13%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         +   +  +HA    ++HRD+KIEN+
Sbjct: 209 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIGSALQYLHANN--IVHRDLKIENI 264

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E K+ DFG +S V    +    F    Y         +  PE++    Y G  +
Sbjct: 265 MISTSGEIKIIDFG-LSNVYDPRKQLHTFCGSLY---------FAAPELLKARPYLGPEV 314

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               D+W+ GV LY       PF+    S     I     E+P +   S  V +L+S ML
Sbjct: 315 ----DVWSFGVVLYVLVCGKVPFDDEVSSVLHEKIKQGNVEYPNH--LSIEVLSLLSKML 368

Query: 280 RVDPLKRPNICQVVE 294
            VDP +R ++ QV+E
Sbjct: 369 VVDPERRASLKQVIE 383

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 97/203 (47%), Gaps = 23/203 (11%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           VYLLMEY   G L   +  R      +      + Q++  +  +H  Q  +IHRD+K EN
Sbjct: 164 VYLLMEYLVYGELYKLL--RSHGPFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPEN 219

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPID 224
           +L+  N+  KL DFG     I  PR  +             T  Y  PEMI   R    D
Sbjct: 220 ILIGFNNVIKLTDFG---WSIINPRGVKRKTLC-------GTIDYLSPEMI---RSREYD 266

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVMLR 280
           +K D+WALGV  Y+    + PFE++ +      IL +  +FP     S  VK+LIS +L+
Sbjct: 267 DKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPE--TVSHDVKDLISKLLK 324

Query: 281 VDPLKRPNICQVVEEVSRIQGIP 303
            +P +R ++  V++    I+  P
Sbjct: 325 YNPSERISMRDVMKHPWIIRNKP 347

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 107/225 (47%), Gaps = 31/225 (13%)

Query: 69  LRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNR 128
           +R E+  + +L+    I  Y  S+   +       +++++MEYC+GG L   +   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLIDT-------KLWVIMEYCAGGSLRTLLRPGI--- 108

Query: 129 LQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAP 188
           ++E  I  IM ++   + ++H  +  +IHRDIK  N+L++ N   KLCDFG  + + ++ 
Sbjct: 109 IEEKYIGVIMREILVALISIH--RDNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQS- 165

Query: 189 RNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEK 248
                   ++   M   T  +  PE+I    G+  D K DIW+LG+  Y+      P+  
Sbjct: 166 -------MLKRQTMAG-TPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCH 215

Query: 249 NGESAILASKFEFPAYP------RYSDRVKNLISVMLRVDPLKRP 287
               AI A +    + P       YS  +K  I++ L  DP +RP
Sbjct: 216 --MEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 102/208 (49%), Gaps = 22/208 (10%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E        Q+   +  +H+    ++HRD+KIEN+
Sbjct: 176 YMLFEYVSGGQLLDYIIQ--HGSLKESRARTFTRQICSALKYLHSHN--IVHRDLKIENI 231

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLP-ID 224
           ++SK+   KL DFG +S +       + +    Y         +  PE++   +  P I 
Sbjct: 232 MISKDGNIKLIDFG-LSNLYDKCNKLKTYCGSLY---------FAAPELL---KATPYIG 278

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPA--YPRY-SDRVKNLISVMLRV 281
            + D+W+ GV LY       PF+ +  S +L  K +     YP++ S  V +L+S ML V
Sbjct: 279 PEIDVWSFGVVLYVLVCGKVPFD-DENSNVLHEKIKQGKVFYPQFLSIEVISLLSKMLVV 337

Query: 282 DPLKRPNICQVVEEVSRIQGIPCPIKNF 309
           DP KR  + QV+     ++    P K++
Sbjct: 338 DPFKRATLDQVMNHHWMVRDCDGPPKSY 365

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 115/251 (45%), Gaps = 34/251 (13%)

Query: 52  VACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEY 111
           V  L +  +  +  +  +  E ++++ +  +K IV    +   +S        +Y L+EY
Sbjct: 207 VKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVKLFFTFQDES-------SLYFLLEY 259

Query: 112 CSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNH 171
           C  G  +  M  +    L E       +QV   +  +H     +IHRDIK EN+LL K  
Sbjct: 260 CPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDYLHT--NGIIHRDIKPENILLDKEF 315

Query: 172 EFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNT-----TAQYRCPEMIDLYRGLPIDEK 226
           + KL DFG+   +  +  N       ++D++  +     TA+Y  PE+++      +D +
Sbjct: 316 KIKLTDFGTAKILDSSTNN-------KFDLLTRSKSFVGTAEYVAPELLN---DSFVDYR 365

Query: 227 SDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPA-YPRYSDRVKNLISVMLRV 281
            D+WA G  LY+      PF+   E      ++  ++ F A +P     +++L+  +L  
Sbjct: 366 CDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLI---IRDLVKKILVK 422

Query: 282 DPLKRPNICQV 292
           D  +RP+I Q+
Sbjct: 423 DLNQRPSISQI 433

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 99/201 (49%), Gaps = 31/201 (15%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           + +++EY SGG    ++  + + RL+E     + SQ+  GV  MH+    L+HRD+K+EN
Sbjct: 135 IGIVLEYASGGEFYKYI--QRKRRLKEVNASRLFSQLVSGVHYMHSKG--LVHRDLKLEN 190

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ--YRCPEMIDLYRGLP 222
           +LL KN    + DFG V+          EF+  +  +MK +     Y  PE++ + R   
Sbjct: 191 LLLDKNENLMITDFGFVN----------EFSN-ENVLMKTSCGSPCYAAPELV-VSREAY 238

Query: 223 IDEKSDIWALGVFLYKTCYYTTPFEK-----NGE------SAILASKFEFPAYPRYSDRV 271
           +  K DIW+ GV LY       P++      NG+      S I A+  +FP Y   +   
Sbjct: 239 VGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGDDISKLYSYITATPLKFPDY--VNPLP 296

Query: 272 KNLISVMLRVDPLKRPNICQV 292
           ++L+  +L  DP +R  +  +
Sbjct: 297 RDLLRRILVADPRRRYTLGHI 317

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 94/206 (45%), Gaps = 26/206 (12%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +H     ++HRD+KIEN+
Sbjct: 156 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHLNN--IVHRDLKIENI 211

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E ++ DFG +S +    +    F    Y         +  PE++    Y G  +
Sbjct: 212 MISSSGEIRIIDFG-LSNMYDPKKQLHTFCGSLY---------FAAPELLKAHPYTGPEV 261

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
               DIW+ GV LY       PF+    S     I   K E+P +   S  V +L+S ML
Sbjct: 262 ----DIWSFGVVLYVLVCGKVPFDDENASVLHEKIKQGKVEYPQH--LSIDVISLLSKML 315

Query: 280 RVDPLKRPNICQVVEEVSRIQGIPCP 305
            VDP KR  + QVV      +G   P
Sbjct: 316 VVDPYKRATLKQVVHHQWMQKGYDFP 341

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 95/200 (47%), Gaps = 31/200 (15%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           E+YL++EY  GG L D++ ++   +L E E +    Q+ +GV   H+    + HRD+K E
Sbjct: 234 ELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSFN--ICHRDLKPE 289

Query: 164 NVLLSKNHEF-KLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA--QYRCPEMI--DLY 218
           N+LL K  +  K+ DFG  +              V   ++K +     Y  PE++    Y
Sbjct: 290 NLLLDKKRKLIKIADFGMAAL------------QVSNTLLKTSCGSPHYASPEIVMGKTY 337

Query: 219 RGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILA----SKFEFPAYPRYSDRVKNL 274
            G P    SD+W+ G+ L+       PF  +    +L      +++ P Y   S   K+L
Sbjct: 338 NGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--LSKDAKDL 391

Query: 275 ISVMLRVDPLKRPNICQVVE 294
           IS +L V+P  R    Q++E
Sbjct: 392 ISRILLVNPKARLTTEQILE 411

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score = 79.3 bits (194), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/187 (32%), Positives = 88/187 (47%), Gaps = 25/187 (13%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           VYLLMEY   G L  + + R      +    + + Q++  +  MH+    ++HRDIK EN
Sbjct: 196 VYLLMEYLVNGEL--YKHLRSHGPFNDITASHFVHQMADALNYMHS--KNILHRDIKPEN 251

Query: 165 VLLSKNHEFKLCDFG-SVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPI 223
           +LL   +  KL DFG SVS V  + R T              T  Y  PE+I   +    
Sbjct: 252 ILLGFQNTLKLTDFGWSVSNVGNSKRKT-----------LCGTMDYLSPELI---KSREY 297

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVML 279
           D K D+WALGV  Y+    + PFE++ +      I+     FP   + S   ++LIS +L
Sbjct: 298 DNKVDVWALGVLTYELLVGSPPFEEDTKELTYKRIIKRDLRFP--DQVSPHARDLISRLL 355

Query: 280 RVDPLKR 286
             DP  R
Sbjct: 356 EYDPQNR 362

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 80.1 bits (196), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 113/235 (48%), Gaps = 32/235 (13%)

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRL 125
           ++ L  E+  +  LR   F+ +Y  +       +V M+   ++ME+C GG   D +    
Sbjct: 79  IDVLAQEIYFLSELRA-PFVTTYFKTFVE----DVSMW---IVMEFCGGGSCADLLKHLP 130

Query: 126 QNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVI 185
           ++RL E ++  I+ +V  G+  +H+ +   IHRDIK  N+LL+ + E KL DFG VSG I
Sbjct: 131 EHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAANILLTDDGEVKLGDFG-VSGQI 187

Query: 186 RAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTP 245
            A      F    Y         +  PE+I   +    +EK+DIW+LG+   +      P
Sbjct: 188 MATLKRTTFVGTPY---------WMAPEII-AKKDNGYNEKADIWSLGITAIELLTGQPP 237

Query: 246 FEKNGESAILAS-------KFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVV 293
           + K+    +L +       K +     R++   ++ I++ L  DP  RP+  +++
Sbjct: 238 YAKHDPMKVLVNIPLRKPPKLQ----GRFTGSARDFIALCLIKDPDLRPSAAELL 288

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 93/195 (47%), Gaps = 26/195 (13%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +HA    ++HRD+KIEN+
Sbjct: 207 YMLFEYVSGGQLLDYIIQ--HGSLKEHHARKFARGIASALQYLHANN--IVHRDLKIENI 262

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E K+ DFG +S +  + +    F    Y         +  PE++    Y G  +
Sbjct: 263 MISNSGEIKIIDFG-LSNIFDSKKKLHTFCGSLY---------FAAPELLKAQPYTGPEV 312

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGES----AILASKFEFPAYPRYSDRVKNLISVML 279
               DIW+ G+ LY       PF+    S     I   K ++P++   S    +L++ M+
Sbjct: 313 ----DIWSFGIVLYVLVCGKVPFDDENSSILHEKIKKGKVDYPSH--LSIDAVSLLTRMI 366

Query: 280 RVDPLKRPNICQVVE 294
            VDPLKR  +  V +
Sbjct: 367 VVDPLKRATLKNVTD 381

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 85/184 (46%), Gaps = 22/184 (11%)

Query: 116  GLIDFMN-TRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFK 174
            G ID  +   L+  + EFE   I  QV  G+  +H  +  ++HRDIK ENV++      K
Sbjct: 1069 GSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVK 1126

Query: 175  LCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLPIDEKSDIWAL 232
            L DFGS + V   P          +D+   T   Y  PE++  + Y G P     DIWA+
Sbjct: 1127 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAV 1171

Query: 233  GVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQV 292
            G+ LY   +   PF    E  I+    +F      S+   NLI  +L  +  KRP I  +
Sbjct: 1172 GILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDI 1229

Query: 293  VEEV 296
             ++V
Sbjct: 1230 YDDV 1233

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 95/192 (49%), Gaps = 31/192 (16%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           E+YL++EY  GG L D++ ++   +L E E ++   Q+ +GV+  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSFCHSFN--ICHRDLKPE 243

Query: 164 NVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA--QYRCPEMI--DLY 218
           N+LL  KN + K+ DFG     +  P            ++K +     Y  PE++    Y
Sbjct: 244 NLLLDKKNRKIKIADFG--MAALELPNK----------LLKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFPAYPRYSDRVKNL 274
            G P    SD+W+ G+ L+       PF  +    +L    + K++ P     S   ++L
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPM--NLSAEARDL 345

Query: 275 ISVMLRVDPLKR 286
           IS +L ++P KR
Sbjct: 346 ISKILVINPEKR 357

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 115/244 (47%), Gaps = 34/244 (13%)

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRL 125
           +N L  E+  +  L+       YI ++ T    +V M+   ++MEYC GG   D +    
Sbjct: 57  INLLAQEIFFLAELKS-----PYITNYITTMTEDVSMW---IIMEYCGGGSCADLLRNIY 108

Query: 126 QNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVI 185
              L E +   I  +V +G+  +H  +   IHRDIK  N+LL+   + KL DFG VSG I
Sbjct: 109 NCGLPESKSAYITREVLKGLEYLHEQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQI 165

Query: 186 RAPRNTEEFNYVQYDIMKNTTAQYRCPEMI----DLYRGLPIDEKSDIWALGVFLYKTCY 241
           RA      F           T  +  PE++    D Y     DEK+DIW+LG+ +Y+   
Sbjct: 166 RATLKRGTF---------VGTPFWMAPEVVSKDSDGY-----DEKADIWSLGITVYELLK 211

Query: 242 YTTPFEKNGESAILAS--KFEFPA-YPRYSDRVKNLISVMLRVDPLKRPNICQVV--EEV 296
            + P  K     ++ +  K + P  +  YS   K+ ++  L  +P  RP+  +++  E V
Sbjct: 212 GSPPLYKCDPMKVMVNLPKRKPPVLHGHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFV 271

Query: 297 SRIQ 300
           + +Q
Sbjct: 272 TNLQ 275

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 96/205 (46%), Gaps = 24/205 (11%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E      +  ++  +  +H     ++HRD+KIEN+
Sbjct: 198 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFVRGIASALQYLHLNN--IVHRDLKIENI 253

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLP-ID 224
           ++S + E K+ DFG +S +    +    F    Y         +  PE++   +  P I 
Sbjct: 254 MISTSGEIKIIDFG-LSNLYDNKKQLHTFCGSLY---------FAAPELL---KANPYIG 300

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVMLR 280
            + DIW+ GV +Y       PF+    S     I   K E+P +   S    +L+S ML 
Sbjct: 301 PEVDIWSFGVVIYVLVCGKVPFDDENASVLHEKIKKGKVEYPQH--LSIECISLLSKMLV 358

Query: 281 VDPLKRPNICQVVEEVSRIQGIPCP 305
           VDPLKR ++ QV       +G   P
Sbjct: 359 VDPLKRASLKQVCNHQWMQRGFDFP 383

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 93/195 (47%), Gaps = 26/195 (13%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +HA    ++HRD+KIEN+
Sbjct: 206 YMLFEYVSGGQLLDYIIQ--HGSLKEHHARKFARGIASALQYLHANN--IVHRDLKIENI 261

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E K+ DFG +S +    +    F    Y         +  PE++    Y G  +
Sbjct: 262 MISSSGEIKIIDFG-LSNIFDYRKQLHTFCGSLY---------FAAPELLKAQPYTGPEV 311

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGES----AILASKFEFPAYPRYSDRVKNLISVML 279
               DIW+ G+ LY       PF+    S     I   K ++P++   S    +L++ M+
Sbjct: 312 ----DIWSFGIVLYVLVCGKVPFDDENSSILHEKIKKGKVDYPSH--LSIEAISLLTRMI 365

Query: 280 RVDPLKRPNICQVVE 294
            +DPLKR  +  VV+
Sbjct: 366 VIDPLKRATLKNVVD 380

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 112/248 (45%), Gaps = 40/248 (16%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +Y L+EY   G  +  +  +    L E       SQ+   V ++H++   +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNEICARYYASQIIDAVDSLHSIG--IIHRDIKPEN 254

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNT-----TAQYRCPEMI-DLY 218
           +LL K+ + KL DFG+   +   P N  +     +D+   +     TA+Y  PE++ D Y
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNAADGKPC-FDLYAKSKSFVGTAEYVSPELLNDSY 313

Query: 219 RGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPA-YPRYSDRVKN 273
                D + DIWA G  LY+      PF+   E      ++  ++ F A +P+    VK+
Sbjct: 314 ----TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQI---VKD 366

Query: 274 LISVMLRVDPLKRPNICQV----------VEEVSRIQGIPCPIKNFYLLRMMDKQEQPRV 323
           L+  +L  DP  R  I Q+           E+ S   G P  I+++       K     +
Sbjct: 367 LVKKLLVRDPNDRLAIEQIKAHVFFDKINFEDGSVWDGDPPEIQSY-------KISAEAM 419

Query: 324 SPPPHVPQ 331
            PPP V +
Sbjct: 420 KPPPKVSE 427

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 120/252 (47%), Gaps = 34/252 (13%)

Query: 52  VACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEY 111
           V  L +  +  +  +  +  E ++++ L+  K I+S   +   +S        +Y L+EY
Sbjct: 183 VKILNKEYLIKQKKVKYVNIEKNTLQRLKNTKGIISLYFTFQDES-------SLYFLLEY 235

Query: 112 CSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNH 171
              G L+  M  R    + E       +Q+   +  MH     +IHRD+K EN+LL  + 
Sbjct: 236 APNGDLLSLM--RKHGSVNEKCTQYYAAQIIDALGFMH--DKGVIHRDLKPENILLDVDM 291

Query: 172 EFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNT-----TAQYRCPEMI-DLYRGLPIDE 225
           + KL DFG+     R   +T E + ++YD++  +     TA+Y  PE++ D Y    +D 
Sbjct: 292 KVKLTDFGTA----RLLDSTSE-DDLKYDLLTRSNSFVGTAEYVSPELLNDNY----VDF 342

Query: 226 KSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPA-YPRYSDRVKNLISVMLR 280
           + DIWA G  L++      PF+ N E      ++  +F F A +P     V++L+  +L 
Sbjct: 343 RCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVMKVQFAFTAGFPM---TVRDLVKNILI 399

Query: 281 VDPLKRPNICQV 292
            +P +R  I Q+
Sbjct: 400 KNPERRLLINQI 411

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 122/273 (44%), Gaps = 30/273 (10%)

Query: 19  SHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKA 78
           +H   V + +  G F  VY       + V    V  L+         L  L  E+  +  
Sbjct: 19  AHNYIVKECVGRGNFGDVYRAIDRTTNKVVAIKVVDLENT----NERLEVLAQEIFFLAE 74

Query: 79  LRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIM 138
           L+ + +I++YI +    +        ++++MEYC GG   D +     N L E ++  I 
Sbjct: 75  LK-SPYIINYITTLLEDA-------SMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYIT 126

Query: 139 SQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQ 198
            ++ +G+  +H  +   IHRDIK  N+LL++    KL DFG VSG +++           
Sbjct: 127 REILKGLQYLH--EQKKIHRDIKAANILLTEEGHVKLGDFG-VSGQLKSTLRRGTIVGTP 183

Query: 199 YDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASK 258
           Y +     +Q      I+ Y     DEK DIW+LG+ +++      P  K     +LA+ 
Sbjct: 184 YWMAPEVASQ-----NIEGY-----DEKIDIWSLGITVFELLKGVPPLVKLDPIRVLAN- 232

Query: 259 FEFPAYPR----YSDRVKNLISVMLRVDPLKRP 287
               + PR    YSD  K+ +++ L  +P +RP
Sbjct: 233 LSRKSAPRLQGAYSDAAKSFVALCLIKNPNERP 265

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 123/292 (42%), Gaps = 41/292 (14%)

Query: 5   QIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKA 64
           QI  +  G  L +GS     L Y  + G  +  ++++         NV  +     PD  
Sbjct: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTG--NQAAIKVISKTIFQDSNVTSMVDNTTPDAL 71

Query: 65  SLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTR 124
                R E+  MK L     +  Y D   T S        +Y+++EY   G L + +  R
Sbjct: 72  PYGIER-EIVIMKLLNHANVLRLY-DVWETNS-------NLYMVLEYAEKGELFNLLVER 122

Query: 125 LQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGV 184
               L E E +    Q+  G++  HAL   ++HRD+K EN+LL   +  K+ DFG     
Sbjct: 123 --GPLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDTKYNIKIADFG----- 173

Query: 185 IRAPRNTEEFNYVQYDIMKNTTA---QYRCPEMIDLYRGLPIDE-KSDIWALGVFLYKTC 240
             A   TE       D +  T+     Y  PE++    G+P     SD+W+ GV LY   
Sbjct: 174 -MAALETE-------DKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILYALL 222

Query: 241 YYTTPFE------KNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKR 286
               PF+      +N    + A +FE P     S   +NLIS +L V+P +R
Sbjct: 223 TGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAER 274

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 91/193 (47%), Gaps = 32/193 (16%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +Y+++EY   G L + +  R    L E E +    Q+  G++  HAL   ++HRD+K EN
Sbjct: 106 LYMVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPEN 161

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA---QYRCPEMIDL--YR 219
           +LL   +  K+ DFG       A   TE       D +  T+     Y  PE+I    Y 
Sbjct: 162 LLLDHKYNIKIADFG------MAALETE-------DKLLETSCGSPHYAAPEIISGLPYH 208

Query: 220 GLPIDEKSDIWALGVFLYKTCYYTTPFE------KNGESAILASKFEFPAYPRYSDRVKN 273
           GL    ++D+W+ G+ L+       PF+      +N    + + +FE P     S   ++
Sbjct: 209 GL----ETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQD 264

Query: 274 LISVMLRVDPLKR 286
           LIS +L VDP KR
Sbjct: 265 LISKILTVDPKKR 277

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/268 (28%), Positives = 109/268 (40%), Gaps = 39/268 (14%)

Query: 26  KYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNT---LRAEVDSMKALRGN 82
           K L  G F  VY V       VC      LK +   D    N     R EV+   +LR  
Sbjct: 113 KVLGKGKFGRVYCVRHIESGFVC-----ALKAMEKKDIIQYNIEKQFRREVEIQSSLRHP 167

Query: 83  KFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVS 142
                Y   H  K         VYLLMEY   G L   +  R  +   +      + Q++
Sbjct: 168 NLTQLYGYFHDEK--------RVYLLMEYLVNGELYKHLKGR--SHFNDVVASYYVYQMA 217

Query: 143 QGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIM 202
             +  MH  +  ++HRDIK EN+++  N+  KL DFG     +  P+ ++          
Sbjct: 218 DALDYMH--ERNILHRDIKPENIIIGFNNTIKLTDFG---WSVITPKGSKRKTLC----- 267

Query: 203 KNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASK 258
              T  Y  PE+I   R    +EK D+WALGV  Y+    + PFE+  +      IL   
Sbjct: 268 --GTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRN 322

Query: 259 FEFPAYPRYSDRVKNLISVMLRVDPLKR 286
             FP +       ++LIS +L  DP  R
Sbjct: 323 LIFPDH--VDTEARHLISRLLEYDPGDR 348

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 133/287 (46%), Gaps = 51/287 (17%)

Query: 28   LASGGFAHVY-SVEISPPDPVCPDNVACLKRVVVPDKASLN--------TLRAEVDSMKA 78
            +  G F  VY S+ I+  +      +  +K+V VP   + N         L++EV ++K 
Sbjct: 1157 IGKGSFGAVYLSLNITTGE------MMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKD 1210

Query: 79   LRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIM 138
            L  +  IV Y+ S      +   +Y ++L  EY +GG +   +  RL  R  E  I ++ 
Sbjct: 1211 L-DHLNIVQYLGSE-----IRGNIYSLFL--EYVAGGSVGSLI--RLYGRFDEKLIRHLN 1260

Query: 139  SQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQ 198
            +QV  G+  +H+    ++HRD+K +N+LL ++   K+ DF    G+ +  +N     Y  
Sbjct: 1261 TQVLSGLKYLHS--KGILHRDMKADNLLLDEDGICKISDF----GISKKSKNI----YSN 1310

Query: 199  YDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASK 258
             D+    T  +  PEM+D  +G     K DIW+LG  + +      P+  N E  ++A+ 
Sbjct: 1311 SDMTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWS-NLE--VVAAM 1365

Query: 259  FEF------PAYPR-----YSDRVKNLISVMLRVDPLKRPNICQVVE 294
            F+       P  P       S + K+ +S    +DP KRP    ++E
Sbjct: 1366 FQIGKSKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLE 1412

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 100/206 (48%), Gaps = 37/206 (17%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           + +++E+ SGG    ++  + + RL+E     + +Q+  GV  MH+    L+HRD+K+EN
Sbjct: 128 IGIVLEFASGGEFYKYL--QRKRRLKEPHACQLFAQLISGVTYMHS--KGLVHRDLKLEN 183

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ--YRCPEMI---DLYR 219
           +LL KN    + DFG V+          EF +   ++MK +     Y  PE++   + YR
Sbjct: 184 LLLDKNENLIITDFGFVN----------EF-FGSNELMKRSCGSPCYAAPELVLSTEPYR 232

Query: 220 GLPIDEKSDIWALGVFLYKTCYYTTPFEK-----NGESA------ILASKFEFPAYPRYS 268
                 K DIW+ G+ LY       P++      NG+        I  +  +FPAY   S
Sbjct: 233 A----RKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGKLYQYITKTALKFPAY--IS 286

Query: 269 DRVKNLISVMLRVDPLKRPNICQVVE 294
              ++LI  +L  +P +R +I  + +
Sbjct: 287 PLARDLIRKILTANPSRRISISYICK 312

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 93/198 (46%), Gaps = 28/198 (14%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +YL++EY   G L + +       L E E +N   Q+  G++  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVD--HGPLPEREAINCFRQIIIGISYCHALG--IVHRDLKPEN 157

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA--QYRCPEMIDLYRGLP 222
           +LL   +  K+ DFG  +    A            D+++ +     Y  PE++    GLP
Sbjct: 158 LLLDSFYNIKIADFGMAALQTDA------------DLLETSCGSPHYAAPEIV---SGLP 202

Query: 223 IDE-KSDIWALGVFLYKTCYYTTPF-EKNGESAILASK-----FEFPAYPRYSDRVKNLI 275
            +   SD+W+ GV L+       PF E+NG    L  K     FE P     S   ++LI
Sbjct: 203 YEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLI 262

Query: 276 SVMLRVDPLKRPNICQVV 293
             +L VDP +R  I  ++
Sbjct: 263 GKILVVDPRQRIKIRDIL 280

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 100/200 (50%), Gaps = 29/200 (14%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           + +++EY SGG    ++  + + RL+E     + +Q+  GV  MH+    L+HRD+K+EN
Sbjct: 124 IGIVLEYASGGEFYRYI--QRKRRLKETAGCRLFTQLVSGVNYMHS--KGLVHRDLKLEN 179

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ--YRCPEMIDLYRGLP 222
           +LL K+    + DFG V+  ++             D+MK +     Y  PE++   +  P
Sbjct: 180 LLLDKHENLVITDFGFVNEFLK-----------DNDLMKTSCGSPCYAAPELVISTK--P 226

Query: 223 ID-EKSDIWALGVFLYKTCYYTTPFE---KNGESAILASKFEFPA-----YPRYSDRV-K 272
            +  K+DIW+ G+ LY       P++   +N E   +A  + F       +P Y   + +
Sbjct: 227 YEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFITRTSLKFPEYISPIPR 286

Query: 273 NLISVMLRVDPLKRPNICQV 292
           +L+  +L  DP KR NI Q+
Sbjct: 287 DLLRRLLVSDPRKRLNIRQI 306

>Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AFL101C
          Length = 366

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 112/268 (41%), Gaps = 39/268 (14%)

Query: 26  KYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFI 85
           K L  G F  VY V   P   +C       K ++  +       R EV+   +LR     
Sbjct: 112 KILGKGKFGKVYCVRHIPSGFICALKAMEKKEIIQYNIEK--QFRREVEIQSSLRHPNLT 169

Query: 86  VSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGV 145
             Y   H  K         VYL+MEY   G L   +  R  N   +      + Q++  +
Sbjct: 170 QLYGYFHDEK--------RVYLVMEYLVNGELYKHLKGR--NHFSDEVASYYVYQMAGAL 219

Query: 146 AAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNT 205
             MH  +  ++HRDIK EN+++  N+  KL DFG    VI    N++ F        + T
Sbjct: 220 DYMH--ERNILHRDIKPENIIIGFNNVIKLTDFGW--SVI----NSKGFK-------RKT 264

Query: 206 ---TAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASK 258
              T  Y  PE+I   +    DEK D+WALGV  Y+    + PFE+  +      IL   
Sbjct: 265 LCGTVDYLSPELI---KSREYDEKVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRN 321

Query: 259 FEFPAYPRYSDRVKNLISVMLRVDPLKR 286
             FP +       ++LIS +L  DP  R
Sbjct: 322 LVFPDH--IDPDARHLISRLLEYDPANR 347

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 91/187 (48%), Gaps = 16/187 (8%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +    +  L E +   I  +V +G+  +H  +   IHRDIK  N
Sbjct: 86  IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKGLRYLHEQKK--IHRDIKAAN 143

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPID 224
           +LL+ +   KL DFG VSG I+A    + F           T  +  PE++        +
Sbjct: 144 ILLTDDGMVKLGDFG-VSGQIKATLKKDTF---------VGTPYWMAPEVVKKDES-GYN 192

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESAILAS--KFEFPA-YPRYSDRVKNLISVMLRV 281
           EK+DIW+LG+ +Y+      P  K     ++ S  K   P  +  YS+  K+ IS  L  
Sbjct: 193 EKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRAPKLHGHYSEDAKSFISHCLIK 252

Query: 282 DPLKRPN 288
           DP  RPN
Sbjct: 253 DPNARPN 259

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 100/211 (47%), Gaps = 34/211 (16%)

Query: 97  PVNVGMYEV-------YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMH 149
           P  +G+YEV       YL++EY  GG L D++ +R   +L E E ++   Q+ QGV+  H
Sbjct: 212 PNVMGLYEVWENKSELYLILEYVDGGELFDYLVSR--GKLPEAEAIHYFKQIIQGVSYCH 269

Query: 150 ALQPPLIHRDIKIENVL-LSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ 208
           +    + HRD+K EN+L   K    K+ DFG     +  P+   + +          +  
Sbjct: 270 SFN--ICHRDLKPENLLIDKKKKSIKIADFG--MAALELPKKLLQTSC--------GSPH 317

Query: 209 YRCPEMI--DLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFP 262
           Y  PE++    Y G P    SD+W+ G+ L+       PF  +    +L    A K++ P
Sbjct: 318 YASPEIVMGKSYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKYQMP 373

Query: 263 AYPRYSDRVKNLISVMLRVDPLKRPNICQVV 293
                SD  K+LIS +L V P KR    +++
Sbjct: 374 K--NLSDEAKDLISRILVVSPSKRLTTVEIL 402

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 93/194 (47%), Gaps = 17/194 (8%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +Y L+EY   G  +  M  +    L E       +Q+   +  +H+    ++HRDIK EN
Sbjct: 241 LYFLLEYAPNGDFLSIM--KKYGSLNEDCACYYSAQIIDAIDFLHS--KGIVHRDIKPEN 296

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI-DLYRGLPI 223
           +LL K+ + KL DFG+   +   P  T+ ++ +        TA+Y  PE++ D Y    +
Sbjct: 297 ILLDKDFKVKLTDFGTAKILEPKPNTTDSYDLLSRSKSFVGTAEYVSPELLNDNY----V 352

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPA-YPRYSDRVKNLISVM 278
           D + DIWA G  L++      PF+   E      ++  ++ F A +P     V++L+  +
Sbjct: 353 DYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV---VRDLVKGI 409

Query: 279 LRVDPLKRPNICQV 292
           L   P +R  I Q+
Sbjct: 410 LIKQPAQRLTIPQI 423

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/249 (29%), Positives = 115/249 (46%), Gaps = 28/249 (11%)

Query: 50  DNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLM 109
           D V  +K VV  +   LN + AE+  +K L  N  IV Y      KS      YE+Y+L+
Sbjct: 48  DQVVAIKEVVYENDEELNDIMAEISLLKNLNHNN-IVKY-HGFIRKS------YELYILL 99

Query: 110 EYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSK 169
           EYC+ G L   + +R    L E E    ++Q   G+  +H     +IHRDIK  N+LLS 
Sbjct: 100 EYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSA 156

Query: 170 NHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDI 229
           ++  KL DFG VS ++ +   T              T  +  PE++   RG      SDI
Sbjct: 157 DNTVKLADFG-VSTIVNSSALTLA-----------GTLNWMAPEILG-NRG--ASTLSDI 201

Query: 230 WALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYP--RYSDRVKNLISVMLRVDPLKRP 287
           W+LG  + +      P+    ++ I  +      YP   +S+ +K+ +S     +  KRP
Sbjct: 202 WSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRP 261

Query: 288 NICQVVEEV 296
              Q+++ V
Sbjct: 262 TADQLLKHV 270

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 100/200 (50%), Gaps = 31/200 (15%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQ-NRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKI 162
           +V++ +EYC G  L D +   LQ  R+   E + + SQ+   V   H+L    +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKL 165

Query: 163 ENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRG 220
           EN+LL K+   KL DFG            E    V  + +  TT  Y  PE+ +   Y G
Sbjct: 166 ENILLDKDGNAKLTDFGFTR---------ECMEKVNLETICGTTV-YMAPELTERKPYDG 215

Query: 221 LPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFE-FPAYPRYSDRV-----KNL 274
             I    DIW+LGV LY     + PF+++ E+    +K++     P Y+ +      ++L
Sbjct: 216 FKI----DIWSLGVILYTMLSGSMPFDEDDEA---KTKWKIINEEPEYNSKFMTAEGEDL 268

Query: 275 ISVMLRVDPLKRPNICQVVE 294
           +  +L+ D   RP++ ++++
Sbjct: 269 VRKLLQKDSNLRPSVREILQ 288

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 115/243 (47%), Gaps = 35/243 (14%)

Query: 54  CLKRVVVPDKAS--LNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEY 111
           C  +V+  D A   +  ++ E+  + +L+    I  Y  S+   +       +++++MEY
Sbjct: 45  CAIKVLNLDSADDEVEDVQKEIQFLSSLKQVPNITHYYGSYLNDT-------KLWVIMEY 97

Query: 112 CSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNH 171
           C+GG L   +      ++ E  I  IM ++    A MH  +  +IHRDIK  NVL++ + 
Sbjct: 98  CAGGSLRTLLR---PGKIGEQYIGVIMRELL--TALMHIHKDGVIHRDIKAANVLITNDG 152

Query: 172 EFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ---YRCPEMIDLYRGLPIDEKSD 228
             KLCDFG  + +             Q  I + T A    +  PE+I    G+  D K D
Sbjct: 153 HIKLCDFGVAAQL------------SQTKIRRQTMAGTPYWMAPEVI--MEGVYYDTKVD 198

Query: 229 IWALGVFLYKTCYYTTPF-EKNGESAI-LASKFEFPAYP--RYSDRVKNLISVMLRVDPL 284
           IW+LG+  Y+      P+ E     A+ L +K + P     ++S  +K +I++ L  DP 
Sbjct: 199 IWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDEDPK 258

Query: 285 KRP 287
           +RP
Sbjct: 259 ERP 261

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 100/200 (50%), Gaps = 30/200 (15%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILN------IMSQVSQGVAAMHALQPPLIHR 158
           +Y L+EY   G   DF++      ++++  LN        +Q+   +  +H  Q  +IHR
Sbjct: 237 LYFLLEYAPNG---DFLSV-----IKKYGSLNQDCSVYYSAQILDAIDYLH--QKGVIHR 286

Query: 159 DIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI-DL 217
           DIK EN+LL K+ + KL DFG+   ++     T+ +N ++       TA+Y  PE++ D 
Sbjct: 287 DIKPENILLDKDMKVKLTDFGTAK-LVEKDETTQTYNLLERSKSFVGTAEYVSPELLNDN 345

Query: 218 YRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPA-YPRYSDRVK 272
           Y    +D K DIWA G  L++      PF+   E      ++  ++ F A +P     ++
Sbjct: 346 Y----VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLI---IR 398

Query: 273 NLISVMLRVDPLKRPNICQV 292
           +LI  +L  +P +R +  QV
Sbjct: 399 DLIKQILVKNPEQRLDTLQV 418

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 102/209 (48%), Gaps = 34/209 (16%)

Query: 100 VGMYEVY-------LLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQ 152
           +G++EV+       L++EY  GG L D++ ++   +L E+E ++   Q+ +GVA  H+  
Sbjct: 178 MGLFEVWENKNDLFLVLEYVDGGELFDYLVSK--GKLPEWEAVHYFKQIIEGVAFCHSYN 235

Query: 153 PPLIHRDIKIENVLLS-KNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRC 211
             + HRD+K EN+LL  KN   K+ DFG  +  +  P    E +          +  Y  
Sbjct: 236 --ICHRDLKPENLLLDKKNKIIKIADFGMAA--LELPNKLLETSC--------GSPHYAS 283

Query: 212 PEMI--DLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAIL----ASKFEFPAYP 265
           PE++    Y G P    SD+W+ G+ L+       PF  +    +L    + +F  P   
Sbjct: 284 PEIVMGKPYHGGP----SDVWSCGIILFALLTGHLPFNDDNIRKLLLKVQSGRFRLPR-- 337

Query: 266 RYSDRVKNLISVMLRVDPLKRPNICQVVE 294
             S   ++LI+ +L V+P +R  I  +++
Sbjct: 338 NISLEAQDLIAKILVVNPRQRIKISDILK 366

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 113/240 (47%), Gaps = 36/240 (15%)

Query: 65   SLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTR 124
            +++ LR EV ++K L  +  IV Y+   A       G+Y ++L  EY +GG +   +  R
Sbjct: 1186 TVDALRLEVSTLKDL-DHLNIVQYLGFEAKN-----GIYSLFL--EYVAGGSVGSLI--R 1235

Query: 125  LQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGV 184
            +  R  +  I ++  QV QG++ +H+    ++HRD+K +N+LL ++   K+ DFG     
Sbjct: 1236 MYGRFDDILIRHLTIQVLQGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDFG----- 1288

Query: 185  IRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTT 244
                R + +  Y   ++    T  +  PEM+D  +G     K DIW+LG  + +      
Sbjct: 1289 --ISRKSNDI-YSNSEMTMKGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKR 1343

Query: 245  PFEKNGESAILASKFEF-----------PAYPRYSDRVKNLISVMLRVDPLKRPNICQVV 293
            P+  N E  ++A+ F+               P  S+  K  +     +DP KRP   +++
Sbjct: 1344 PWS-NFE--VVAAMFKIGQAKSAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLL 1400

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 108/218 (49%), Gaps = 22/218 (10%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +Y L+EY S G L+  +  +      E   +   +Q+   +  +H++   +IHRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPEN 389

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNT-----TAQYRCPEMI-DLY 218
           +LL+K+ + KL DFG+ + ++   + ++  +   +++++ +     TA+Y  PE++ D Y
Sbjct: 390 ILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY 448

Query: 219 RGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPAYPRYSDRVKNL 274
                D + DIWA G  L++      PF+   E      I+  ++ F A   +   +++L
Sbjct: 449 ----TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTA--GFPTILRDL 502

Query: 275 ISVMLRVDPLKRPNICQVVEEV-SRIQGIPCPIKNFYL 311
           I  +L  +P  R  I Q+   +  R +    P   +YL
Sbjct: 503 IKKILIKNPNNRLTIHQIKSHLFYRSKDFSNPWNIWYL 540

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 131/285 (45%), Gaps = 49/285 (17%)

Query: 28   LASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLN--------TLRAEVDSMKAL 79
            +  G F  VY         V    +  +K+V VP  +S N         LR+EV ++K L
Sbjct: 1187 IGKGSFGAVYLCL-----NVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL 1241

Query: 80   RGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMS 139
              +  IV Y+      S     +Y ++L  EY +GG +   +  R+  R  E  I ++ +
Sbjct: 1242 -DHLNIVQYLGFENKNS-----IYSLFL--EYVAGGSVGSLI--RMYGRFDESLIKHLTT 1291

Query: 140  QVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQY 199
            QV +G+A +H+    ++HRD+K +N+LL ++   K+ DF    G+ R  ++     Y   
Sbjct: 1292 QVLRGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNS 1341

Query: 200  DIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKF 259
            D+    T  +  PEM+D  +G     K DIW+LG  + +      P+  N E  ++A+ F
Sbjct: 1342 DMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWS-NLE--VVAAMF 1396

Query: 260  EF------PAYPRYS----DRV-KNLISVMLRVDPLKRPNICQVV 293
            +       P  P  +     RV ++ +     +DP KRP   +++
Sbjct: 1397 KIGKSKSAPPIPEDTLPLITRVGRSFLDACFEIDPEKRPTATKLL 1441

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 128/285 (44%), Gaps = 49/285 (17%)

Query: 28   LASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKAS--------LNTLRAEVDSMKAL 79
            +  G F  VY + ++    V    +  +K+V VP+ +S        +  L++EV ++K L
Sbjct: 1044 IGKGSFGAVY-LALN----VTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL 1098

Query: 80   RGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMS 139
              +  IV Y+           G+Y ++L  EY +GG +   +  R+  R  +  I ++  
Sbjct: 1099 -NHVNIVQYLGFEEKN-----GIYSLFL--EYVAGGSVGSLI--RMYGRFDDQLIRHLTK 1148

Query: 140  QVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQY 199
            QV +G+A +H+    ++HRD+K +N+LL  +   K+ DF    G+ R   N     Y   
Sbjct: 1149 QVLEGLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDF----GISRKSNNI----YSNS 1198

Query: 200  DIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKF 259
            D+    T  +  PEM+D   G     K DIW+LG  + +      P+  N E  ++A+ F
Sbjct: 1199 DMTMRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPWS-NFE--VVAAMF 1253

Query: 260  EF---PAYPRYSDRVKNLISVM--------LRVDPLKRPNICQVV 293
            +       P   D  K+L+S            +DP  RP    +V
Sbjct: 1254 QIGKSKTAPPIPDDTKDLVSPAGQSFLDQCFEIDPEMRPTADSLV 1298

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 89/193 (46%), Gaps = 30/193 (15%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           ++Y+++EY   G L + +  R    L E E +    Q+  G++  HAL   ++HRD+K E
Sbjct: 100 DLYMVLEYVEKGELFNLLVER--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPE 155

Query: 164 NVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA---QYRCPEMIDLYRG 220
           N+LL      KL DFG  +                 D +  T+     Y  PE++    G
Sbjct: 156 NLLLDHKFNVKLADFGMAA-------------LESKDKLLETSCGSPHYAAPEIVS---G 199

Query: 221 LPIDE-KSDIWALGVFLYKTCYYTTPFE------KNGESAILASKFEFPAYPRYSDRVKN 273
           LP    +SD+W+ GV LY       PF+      +N    + + KFE P     S   ++
Sbjct: 200 LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQD 259

Query: 274 LISVMLRVDPLKR 286
           LI+ +L VDP +R
Sbjct: 260 LIARILTVDPEQR 272

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 93/195 (47%), Gaps = 26/195 (13%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y+L EY SGG L+D++       L+E         ++  +  +H+    ++HRD+KIEN+
Sbjct: 207 YMLFEYVSGGQLLDYIIQ--HGSLKEHHARKFARGIASALQYLHSNN--IVHRDLKIENI 262

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDL--YRGLPI 223
           ++S + E K+ DFG +S +    +    F    Y         +  PE++    Y G  +
Sbjct: 263 MISSSGEIKIIDFG-LSNIFDYRKQLHTFCGSLY---------FAAPELLKAQPYTGPEV 312

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGES----AILASKFEFPAYPRYSDRVKNLISVML 279
               DIW+ G+ LY       PF+    S     I   K ++P++   S    +L++ M+
Sbjct: 313 ----DIWSFGIVLYVLVCGKVPFDDENSSILHEKIKKGKVDYPSH--LSIEAISLLTKMI 366

Query: 280 RVDPLKRPNICQVVE 294
            VDPL+R  +  VV+
Sbjct: 367 VVDPLRRATLKTVVD 381

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 115/249 (46%), Gaps = 28/249 (11%)

Query: 50  DNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLM 109
           D V  +K +V  +   LN + AE+  +K L  +  IV Y      KS      YE+Y+L+
Sbjct: 48  DQVVAIKEIVYENDEELNDIMAEISLLKNLNHHN-IVKY-HGFIRKS------YELYILL 99

Query: 110 EYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSK 169
           EYC+ G L   + +R    L E E    ++Q   G+  +H     +IHRDIK  N+LLS 
Sbjct: 100 EYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSA 156

Query: 170 NHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDI 229
           ++  KL DFG VS ++ +   T              T  +  PE++   RG      SDI
Sbjct: 157 DNTVKLADFG-VSTIVNSSALTLA-----------GTLNWMAPEILG-NRG--ASTLSDI 201

Query: 230 WALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYP--RYSDRVKNLISVMLRVDPLKRP 287
           W+LG  + +      P+    ++ I  +      YP   +S+ +K+ +S     +  KRP
Sbjct: 202 WSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRP 261

Query: 288 NICQVVEEV 296
              Q+++ V
Sbjct: 262 TADQLLKHV 270

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 88/192 (45%), Gaps = 24/192 (12%)

Query: 106  YLLMEYCSGG--GLIDFMN-TRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKI 162
            Y  +E    G  G ID  +   ++  + E E + I  Q++ G+  +H     ++HRDIK 
Sbjct: 1033 YYYIETAVHGTSGSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKD 1090

Query: 163  ENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRG 220
            ENV++  N   K+ DFGS + V   P          +D+   T   Y  PE++  + Y G
Sbjct: 1091 ENVIVDCNGFVKIVDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEG 1139

Query: 221  LPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLR 280
             P     DIWA+GV LY   Y   PF    E  IL +     +  R SD    LI  +L 
Sbjct: 1140 KP----QDIWAIGVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILN 1193

Query: 281  VDPLKRPNICQV 292
                KRP+I ++
Sbjct: 1194 RSVSKRPSIDEI 1205

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 88/194 (45%), Gaps = 34/194 (17%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +YL++EY   G L + +  R    L E E +    Q+   ++  HAL   ++HRD+K EN
Sbjct: 94  LYLILEYAEKGELFNLLVDR--GPLPEKEAVKCFRQIIIAISYCHALG--IVHRDLKPEN 149

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA----QYRCPEMIDL--Y 218
           +LL  ++  K+ DFG  +              +Q D     T+     Y  PE++    Y
Sbjct: 150 LLLDNDYNIKIADFGMAA--------------LQTDARLLETSCGSPHYAAPEIVSGLPY 195

Query: 219 RGLPIDEKSDIWALGVFLYKTCYYTTPF-EKNGESAILASK-----FEFPAYPRYSDRVK 272
           RG      SD+W+ GV L+       PF E NG    L  K     FE P     S   +
Sbjct: 196 RGFA----SDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQ 251

Query: 273 NLISVMLRVDPLKR 286
           NLIS +L VDP +R
Sbjct: 252 NLISRILVVDPTQR 265

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 100/204 (49%), Gaps = 29/204 (14%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           + +++EY SGG    ++  + + RL+E +   I +Q+  GV+ +H+    L+HRD+K+EN
Sbjct: 151 IGIVLEYASGGEFYKYI--KFKKRLKESKACTIFAQLISGVSYIHS--KGLVHRDLKLEN 206

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ--YRCPEMIDLYRGLP 222
           +LL K     + DFG V+ V +  +           +M        Y  PE++      P
Sbjct: 207 LLLDKAGNLLITDFGFVNEVTKTNK-----------LMHTPCGSPCYAAPELVTSVE--P 253

Query: 223 ID-EKSDIWALGVFLYKTCYYTTPFEK-----NGESAILASKF---EFPAYPRYSDRV-K 272
            +  K+DIW+ GV LY       P++      NG   +   K+   +   +P Y + V +
Sbjct: 254 YNARKADIWSCGVILYAMLAGYLPWDDDPKNINGTDIVKLYKYIENQPLKFPEYINMVPR 313

Query: 273 NLISVMLRVDPLKRPNICQVVEEV 296
           +L+  ML +DP KR ++  +++  
Sbjct: 314 DLLRRMLEIDPAKRMSMKHILQHA 337

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 84/193 (43%), Gaps = 22/193 (11%)

Query: 106  YLLMEYCSGGGLIDFMN-TRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
            YL  E     G ID  +   L+  + EFE   +  QV+ G+  +H     ++HRDIK EN
Sbjct: 1051 YLETEMHGETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDEN 1108

Query: 165  VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLP 222
            V++      KL DFGS + V   P          +D+   T   Y  PE++  + Y G P
Sbjct: 1109 VIVDNKGFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP 1157

Query: 223  IDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVD 282
                 DIWA+GV LY   Y   PF    E  IL       +    S     LI  +L   
Sbjct: 1158 ----QDIWAIGVLLYTIIYKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRS 1211

Query: 283  PLKRPNICQVVEE 295
              KRP I  ++E+
Sbjct: 1212 VSKRPTIDDIMED 1224

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 92/192 (47%), Gaps = 30/192 (15%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +Y+++EY   G L + +  +    LQE E +    Q+  G++  HAL   ++HRD+K EN
Sbjct: 102 LYMVLEYAEKGELFNLLVEK--GPLQEQEAIRFFRQIIIGISYCHALG--IVHRDLKPEN 157

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA---QYRCPEMIDLYRGL 221
           +LL   +  K+ DFG       A   TE       D +  T+     Y  PE++    G+
Sbjct: 158 LLLDHKYNIKIADFG------MAALETE-------DKLLETSCGSPHYAAPEIVS---GI 201

Query: 222 PIDE-KSDIWALGVFLYKTCYYTTPFE------KNGESAILASKFEFPAYPRYSDRVKNL 274
           P     SD+W+ GV L+       PF+      +N    + + +FE P+    S   ++L
Sbjct: 202 PYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDL 261

Query: 275 ISVMLRVDPLKR 286
           ++ +L VDP KR
Sbjct: 262 LAKILTVDPEKR 273

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 99/204 (48%), Gaps = 33/204 (16%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           + +++EY SGG    ++  +   RL+E     + +Q+  GV  MH+    L+HRD+K+EN
Sbjct: 120 IGIVLEYASGGEFYKYIQKK--RRLKEGPACRLFAQLISGVYYMHSKG--LVHRDLKLEN 175

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ--YRCPEMIDLYRGLP 222
           +LL KN    + DFG V+  +  P N         ++MK +     Y  PE++   R  P
Sbjct: 176 LLLDKNENLLITDFGFVNEFL--PEN---------ELMKTSCGSPCYAAPELVVTAR--P 222

Query: 223 ID-EKSDIWALGVFLYKTCYYTTPFEKNGESA-----------ILASKFEFPAYPRYSDR 270
            +  K+D+W+ GV LY       P++ + E+            I  +  +FP Y   +  
Sbjct: 223 YEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPDY--IAPV 280

Query: 271 VKNLISVMLRVDPLKRPNICQVVE 294
            ++L+  +L  DP +R  I + ++
Sbjct: 281 PRDLLREILIPDPKRRITISKTLK 304

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 95/202 (47%), Gaps = 21/202 (10%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +Y L+EY S G  +  +  +    L E       SQ+   V ++HA+   +IHRDIK EN
Sbjct: 199 LYFLLEYASHGDFLGLI--KKYGSLNEKCARYYASQIIDAVDSLHAIG--IIHRDIKPEN 254

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEE----FNYVQYDIMKNTTAQYRCPEMI-DLYR 219
           +LL K+ + KL DFG+   +   P N  +    F+          TA+Y  PE++ D Y 
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARSKSFVGTAEYVSPELLNDSY- 313

Query: 220 GLPIDEKSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPA-YPRYSDRVKNL 274
               D + DIWA G  LY+      PF+   E      ++  ++ F A +P  +   K+L
Sbjct: 314 ---TDSRCDIWAFGCILYQMVAGKPPFKAANEYLTFQKVMKIQYAFTAGFPLIA---KDL 367

Query: 275 ISVMLRVDPLKRPNICQVVEEV 296
           +  +L  +P  R  + Q+   V
Sbjct: 368 VKKLLVREPNDRLTVEQIKAHV 389

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 92/192 (47%), Gaps = 28/192 (14%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           ++YL++EY   G L + +  R    L E E +    Q+  GV+  HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPE 160

Query: 164 NVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA--QYRCPEMIDLYRGL 221
           N+LL   +  K+ DFG       A   TE        +++ +     Y  PE++    G+
Sbjct: 161 NLLLDHKYNIKIADFG------MAALETE------GKLLETSCGSPHYAAPEIVS---GI 205

Query: 222 PIDE-KSDIWALGVFLYKTCYYTTPF-EKNGESAILASK-----FEFPAYPRYSDRVKNL 274
           P     SD+W+ GV L+       PF E++G    L  K     FE P+    S   ++L
Sbjct: 206 PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQDL 265

Query: 275 ISVMLRVDPLKR 286
           IS +L VDP +R
Sbjct: 266 ISRILTVDPERR 277

>CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209c IPL1
           ser/thr protein kinase
          Length = 358

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 111/269 (41%), Gaps = 33/269 (12%)

Query: 28  LASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVS 87
           L  G F  VY V       +C   +  +++  +     L  L+ EVD    +     I  
Sbjct: 106 LGKGKFGKVYCVRHKKSGFICA--LKAIEKNEILQFNLLKQLKREVDIQLGMDHPNIIKL 163

Query: 88  YIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAA 147
           Y   H  K         VYLLME+   G L  + + +      +    + + Q++  +  
Sbjct: 164 YAHFHDEK--------RVYLLMEHSINGEL--YKSLKNNGPFNDVLASHYIYQIADALHY 213

Query: 148 MHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA 207
           MH  +  +IHRD+K ENVL+  ++  KL DFG     I  P  ++             T 
Sbjct: 214 MH--KKRIIHRDVKPENVLIGFDNVVKLADFG---WSILNPEGSKRKTLC-------GTI 261

Query: 208 QYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPA 263
            Y  PEMI        DE+ D+WALGV  Y+      PFE+N +      IL     FP 
Sbjct: 262 DYLSPEMITPRE---YDEQVDVWALGVLAYELVVGVPPFEENSKELTYKRILKCDLNFPE 318

Query: 264 YPRYSDRVKNLISVMLRVDPLKRPNICQV 292
               S   K+LIS +L  D  +R ++  V
Sbjct: 319 --SISKDAKDLISKLLVTDTTQRLSLTGV 345

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 86/191 (45%), Gaps = 22/191 (11%)

Query: 106  YLLMEYCSGGGLIDFMN-TRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
            Y+ +E     G ID  +   L+  + EFE   I  Q+  G+  +H     ++HRDIK EN
Sbjct: 877  YIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVHRDIKDEN 934

Query: 165  VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLP 222
            V++  N   KL DFGS +     P          +++    T  Y  PE++  + Y+G P
Sbjct: 935  VIVDSNGFVKLIDFGSAAYTKTGP----------FEVFVG-TIDYAAPEILGGNPYKGKP 983

Query: 223  IDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVD 282
                 DIWALGV LY   Y   PF    E  IL  +  F      +    +LI  +L   
Sbjct: 984  ----QDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLIRWILTKS 1037

Query: 283  PLKRPNICQVV 293
               RP+I ++V
Sbjct: 1038 VNDRPSIDEIV 1048

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 85/183 (46%), Gaps = 20/183 (10%)

Query: 116  GLIDFMNT-RLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFK 174
            G +D  +    ++ + EFE   I  Q+  G+  +H     ++HRDIK ENV++      K
Sbjct: 1038 GSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1095

Query: 175  LCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKS-DIWALG 233
            L DFGS + V   P          +D+   T   Y  PE++    G P + KS DIWA+G
Sbjct: 1096 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG---GNPYEGKSQDIWAIG 1141

Query: 234  VFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVV 293
            + LY   Y   PF    E  IL  +  F      S   K LI+ +L     KRP I ++ 
Sbjct: 1142 ILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEIC 1199

Query: 294  EEV 296
            ++V
Sbjct: 1200 QDV 1202

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 92/192 (47%), Gaps = 28/192 (14%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           ++YL++EY   G L + +  R    L E E +    Q+  GV+  HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPE 160

Query: 164 NVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA--QYRCPEMIDLYRGL 221
           N+LL   +  K+ DFG       A   TE        +++ +     Y  PE++    G+
Sbjct: 161 NLLLDHKYNIKIADFGM------AALETE------GKLLETSCGSPHYAAPEIVS---GI 205

Query: 222 PIDE-KSDIWALGVFLYKTCYYTTPF-EKNGESAILASK-----FEFPAYPRYSDRVKNL 274
           P     SD+W+ GV L+       PF E++G    L  K     FE P+    S   ++L
Sbjct: 206 PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRALLLKVQKGEFELPSDDEISREAQDL 265

Query: 275 ISVMLRVDPLKR 286
           IS +L VDP +R
Sbjct: 266 ISKILTVDPERR 277

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 69/240 (28%), Positives = 106/240 (44%), Gaps = 41/240 (17%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +YL++EY   G L + +  R    L E E +    Q+   ++  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVDR--GPLPEREAIKCFKQIIIAISYCHALG--IVHRDLKPEN 157

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDI-MKNTTA---QYRCPEMIDLYRG 220
           +LL  ++  K+ DFG  +              +Q D  M  T+     Y  PE++    G
Sbjct: 158 LLLDNSYNIKIADFGMAA--------------LQTDAGMLETSCGSPHYAAPEIVS---G 200

Query: 221 LPIDE-KSDIWALGVFLYKTCYYTTPF-EKNGESAILASK-----FEFPAYPRYSDRVKN 273
           LP +   SD+W+ GV L+       PF E+NG    L  K     FE P     S   ++
Sbjct: 201 LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQD 260

Query: 274 LISVMLRVDPLKRPNICQVVEE--VSRIQGIP-------CPIKNFYLLRMMDKQEQPRVS 324
           LI  +L VDP +R  I  ++    + + Q I         P +N YL  + D      V+
Sbjct: 261 LIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADADNHTSVT 320

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 97/206 (47%), Gaps = 41/206 (19%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           + +++EY  GG    ++  +   RL+E     + SQ+  GV  +H+    L+HRD+K+EN
Sbjct: 125 IGIVLEYACGGEFYKYIQKK--RRLKEMNACRLFSQLISGVHYIHS--KGLVHRDLKLEN 180

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ--YRCPEMIDLYRGLP 222
           +LL KN    + DFG V+      RN         ++MK +     Y  PE++      P
Sbjct: 181 LLLDKNENLVITDFGFVNEF--CSRN---------ELMKTSCGSPCYAAPELV--ISAEP 227

Query: 223 ID-EKSDIWALGVFLYKTCYYTTPFE---KNGESA--------ILASKFEFPAY----PR 266
            +  K+DIW+ GV LY       P++    N E +        I ++  +FP Y    PR
Sbjct: 228 YEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRLYNYINSTPLKFPDYILPIPR 287

Query: 267 YSDRVKNLISVMLRVDPLKRPNICQV 292
                 +L+  ML  DP KR N+ Q+
Sbjct: 288 ------DLLRRMLVSDPKKRINLKQI 307

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 95/194 (48%), Gaps = 18/194 (9%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +Y L+EY   G  +  +  +  +  QE  +    +Q+   +  +H     ++HRDIK EN
Sbjct: 232 LYFLLEYAPNGDFLSVIK-KFGSLSQECAVY-YSAQILDAIDYLH--HKGIVHRDIKPEN 287

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI-DLYRGLPI 223
           +LL K+ + KL DFG+   ++     T+ FN ++       TA+Y  PE++ D Y    +
Sbjct: 288 ILLDKDMKVKLTDFGTAR-ILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDNY----V 342

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPA-YPRYSDRVKNLISVM 278
           D K DIWA G  L++      PF+   E      ++  ++ F A +P     +++LI  +
Sbjct: 343 DYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV---IRDLIKKI 399

Query: 279 LRVDPLKRPNICQV 292
           L   P +R +  Q+
Sbjct: 400 LVKSPEQRLDASQI 413

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 92/190 (48%), Gaps = 24/190 (12%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC GG   D +     N L E ++  I+ +V+ G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRK--IHRDIKAAN 146

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPID 224
           +LL++    KL DFG VSG IR+    + F    Y +      +  C E +D Y     +
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIRSTLKRDTFVGTPYWM----APEVVCCE-VDGY-----N 195

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESAILAS-------KFEFPAYPRYSDRVKNLISV 277
           EK+DIW+LG+  Y+      P  K     ++ +       K + P    +SD  K+ ++ 
Sbjct: 196 EKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSDAAKDFVAG 251

Query: 278 MLRVDPLKRP 287
            L   P  RP
Sbjct: 252 CLVKTPADRP 261

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 96/198 (48%), Gaps = 23/198 (11%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +Y L+EY   G  +  M  +    L E       +Q+  G+  +H+    +IHRDIK EN
Sbjct: 256 LYFLLEYAPNGDFLSVM--KKYGSLSEDCTRYYSAQIIDGIKYLHS--KGIIHRDIKPEN 311

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTE----EFNYVQYDIMKNTTAQYRCPEMI-DLYR 219
           +LL K+ + K+ DFG+    I  P+N +    EFN +        TA+Y  PE++ D Y 
Sbjct: 312 ILLDKDMKVKITDFGTAK--ILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELLNDSY- 368

Query: 220 GLPIDEKSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPA-YPRYSDRVKNL 274
              +D + DIWA G  +++      PF+   E      ++  ++ F A +P     V++L
Sbjct: 369 ---VDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVV---VRDL 422

Query: 275 ISVMLRVDPLKRPNICQV 292
           +  +L   P +R  I Q+
Sbjct: 423 VKRILLKVPEQRLTIPQI 440

>Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W
           (REAL)
          Length = 716

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 86/195 (44%), Gaps = 18/195 (9%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +YL MEYC GG     + TR   R+ E +     S+V   +  +H L    I+RD+K EN
Sbjct: 393 LYLCMEYCMGGEFFRALQTRKSKRITEEDAKFYASEVVAALEYLHLLG--FIYRDLKPEN 450

Query: 165 VLLSKNHEFKLCDFG-SVSGVIRAPRNTEEFNYVQYDIMKN--------TTAQYRCPEMI 215
           +LL ++    L DF  S+          ++  Y+   +  +         T +Y  PE+I
Sbjct: 451 ILLHQSGHVMLSDFDLSIQATGSRDPTMKDSTYLDTKVCSDGFRTNSFVGTEEYLAPEVI 510

Query: 216 DLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPAYPRYSDRV 271
              RG       D W LG+ +Y+  +  TPF+ +      S IL    +FP     S   
Sbjct: 511 ---RGNGHTAAVDWWTLGILVYEMLFGCTPFKGDNSNETFSKILTEDVKFPHDKEISKHC 567

Query: 272 KNLISVMLRVDPLKR 286
           K+LI  +L  +  KR
Sbjct: 568 KDLIKRLLNKNESKR 582

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 92/193 (47%), Gaps = 16/193 (8%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +Y L+EY   G  +  M  +    L E       +Q+  G+  +H  +  +IHRDIK EN
Sbjct: 278 LYFLLEYAPNGDFLSIM--KKYGSLNEECARYYGAQILNGIYFLH--RHGIIHRDIKPEN 333

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPID 224
           +LL K+ + KL DFG+   ++     TEE++          TA+Y  PE+++      +D
Sbjct: 334 ILLDKSMKVKLTDFGTAK-LLNRKDGTEEYDLTTRSKSFVGTAEYVSPELLN---DSWVD 389

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPA-YPRYSDRVKNLISVML 279
            K DIWA G  L++      PF+   E      ++  ++ F A +P     V++L+  +L
Sbjct: 390 HKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPMV---VRDLVKQIL 446

Query: 280 RVDPLKRPNICQV 292
              P  R  I Q+
Sbjct: 447 VKKPEHRLTIPQI 459

>KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {ON}
           weakly similar to uniprot|Q03306 YDR466W Saccharomyces
           cerevisiae YDR466W Protein kinase with similarity to
           mammalian phosphoinositide-dependent kinase 1 (PDK1) and
           yeast Pkh1p and Pkh2p, two redundant upstream activators
           of Pkc1p; identified as a multicopy suppressor of a pkh1
           pkh2 double mutant
          Length = 647

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 94/200 (47%), Gaps = 17/200 (8%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +Y ++++  GG L+  + T  Q R  E    + M Q+   +  +H  +  ++HRD+K EN
Sbjct: 86  LYFVLDFAPGGELLQLLQT--QGRFNEAWTKHFMCQLIDALEYIHGCK--VVHRDLKPEN 141

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPID 224
           +LLS   +  + DFG  S +      +   ++V        TA+Y  PE++   +    +
Sbjct: 142 LLLSSEGKLMITDFGVASNLAATDNLSSTSSFV-------GTAEYVSPELLLQNKS---N 191

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRY--SDRVKNLISVMLRVD 282
             SDIWA+G  LY+    T PF    E A          +  Y  S  + +L+S +L +D
Sbjct: 192 FCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYHWIYMVSQHITDLVSKILVLD 251

Query: 283 PLKRPNICQVVEEVSRIQGI 302
           P  R  + Q ++  +  QGI
Sbjct: 252 PDSRYTLPQ-IKNHAWFQGI 270

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 134/297 (45%), Gaps = 52/297 (17%)

Query: 8   KYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVP--DKAS 65
           +++S  +  VG++  K+LK +  G F  VY            ++    ++VV+   +K  
Sbjct: 25  QFSSNELKEVGNY--KILKQVGEGSFGKVY----------LANHKLTHQKVVLKTGEKKD 72

Query: 66  LNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRL 125
            N +R EV   +      FI    +   T+S       +V++ +EYC G  L D++   L
Sbjct: 73  PNVVR-EVFYHRQF-DFPFITKLYEVIVTES-------KVWMALEYCPGNELYDYL---L 120

Query: 126 Q-NRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGV 184
           Q  R+   E   + +Q+   V   H+LQ   +HRD+K+EN+LL K     L DFG     
Sbjct: 121 QKQRIPLDETSKLFAQIVGAVFYAHSLQ--CVHRDLKLENILLDKQGYAMLTDFGFTR-- 176

Query: 185 IRAPRNTEEFNYVQYDIMKNTTAQYRCPEMI--DLYRGLPIDEKSDIWALGVFLYKTCYY 242
                  E     Q + +  TT  Y  PE+I  + Y G     K D W+LG+ LY   + 
Sbjct: 177 -------ECATKTQLETICGTTV-YMAPELIKRESYDGY----KVDTWSLGIILYTMLHG 224

Query: 243 TTPFEKNGESAI-LASKFEFP----AYPRYSDRVKNLISVMLRVDPLKRPNICQVVE 294
             PF++   +   L    E P    AY       K+LI  +LR  P +RP++ +V+E
Sbjct: 225 FMPFDEEDPTLTGLKIMNEMPPIVDAYTNV--HAKDLILKLLRKTPSERPSLNKVLE 279

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 127/285 (44%), Gaps = 49/285 (17%)

Query: 28   LASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLN--------TLRAEVDSMKAL 79
            +  G F  VY         V    +  +K+V VP  +S N         LR+EV ++K L
Sbjct: 1181 IGKGSFGAVYLCL-----NVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL 1235

Query: 80   RGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMS 139
              +  IV Y+            +Y ++L  EY +GG +   +  R+  R  E  I ++ +
Sbjct: 1236 -DHLNIVQYLGFENKN-----NIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLTT 1285

Query: 140  QVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQY 199
            QV +G+A +H+    ++HRD+K +N+LL ++   K+ DF    G+ R  ++     Y   
Sbjct: 1286 QVLKGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKDI----YSNS 1335

Query: 200  DIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKF 259
            D+    T  +  PEM+D  +G     K DIW+LG  + +      P+  N E  ++A+ F
Sbjct: 1336 DMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWS-NLE--VVAAMF 1390

Query: 260  EF-----------PAYPRYSDRVKNLISVMLRVDPLKRPNICQVV 293
            +               P  S   +N +     ++P KRP   +++
Sbjct: 1391 KIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 90/193 (46%), Gaps = 23/193 (11%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           VYL+MEY   G L   +  R      +      + Q++  +  +H  +  +IHRD+K EN
Sbjct: 227 VYLIMEYLVYGELYKLL--RSHGPFNDIIASRFVYQIADALNHLH--EKGIIHRDLKPEN 282

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPID 224
           +L+  N+  KL DFG     I  P+  +             T  Y  PEMI   R    D
Sbjct: 283 ILIGFNNVLKLTDFG---WSIINPKGVKRKTLC-------GTIDYLSPEMI---RSREYD 329

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVMLR 280
           +  D+WALGV  Y+      PFE++ +      IL  +  FP     S  V++LIS +L+
Sbjct: 330 DTVDVWALGVLTYELVAGDPPFEEDSKELTYKRILKGEIRFPG--TVSQDVRDLISRLLK 387

Query: 281 VDPLKRPNICQVV 293
            DP +R  + +V+
Sbjct: 388 NDPKERILLKEVM 400

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 109/228 (47%), Gaps = 31/228 (13%)

Query: 73  VDSMKALRGNKF--IVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQ 130
           ++ +  ++G+K   IV++IDS+  K        +++++MEY  GG L D +   +   L 
Sbjct: 372 INEILVMKGSKHSNIVNFIDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LT 421

Query: 131 EFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRN 190
           E +I  +  +  +G+  +H+    +IHRDIK +N+LLS N + KL DFG  + +      
Sbjct: 422 EGQIGAVCRETLKGLQFLHS--KGVIHRDIKSDNILLSMNGDIKLTDFGFCAQI------ 473

Query: 191 TEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPF--EK 248
             E N  +  ++   T  +  PE++      P   K DIW+LG+ + +      P+  E 
Sbjct: 474 -NEVNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 527

Query: 249 NGESAILASKFEFPAY---PRYSDRVKNLISVMLRVDPLKRPNICQVV 293
              +  L +    P        SD +K  +   L+VDP  R N  +++
Sbjct: 528 PLRALYLIATNGTPKLKDPENLSDTLKEFLGWCLKVDPEDRANAAELL 575

>KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 361

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 116/274 (42%), Gaps = 39/274 (14%)

Query: 26  KYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFI 85
           K L  G F  VY V+      +C   +  +++  +         R EV+   + +     
Sbjct: 104 KILGKGKFGKVYCVKHRETGLICA--LKAMEKKEIVQYTIQKQFRREVEIQGSFKHKNLT 161

Query: 86  VSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFM--NTRLQNRLQEFEILNIMSQVSQ 143
             Y   +  K         VYLLMEY   G L  F+  N  L   L  +     + Q++ 
Sbjct: 162 QLYGFFYDEK--------RVYLLMEYVYYGELYKFLKNNGPLNETLASY----FVYQMAN 209

Query: 144 GVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFG-SVSGVIRAPRNTEEFNYVQYDIM 202
            +  MH+    ++HRDIK EN+L+  N+  KL DFG SV       R T           
Sbjct: 210 ALDYMHS--KNILHRDIKPENILIGFNNTIKLTDFGWSVYNEDGQKRKT----------- 256

Query: 203 KNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASK 258
              T  Y  PE+I   +    + K D+WALGV  Y+    + PFE++ +      IL   
Sbjct: 257 LCGTIDYLSPELI---KSREYNNKVDVWALGVLTYELLVGSPPFEEDTKEMTYRRILRCD 313

Query: 259 FEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQV 292
            +FP     S + ++LI  +L+ +P KR  + +V
Sbjct: 314 LKFPL--NVSPQARDLIVRLLQFEPSKRIPLSEV 345

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 91/192 (47%), Gaps = 28/192 (14%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           ++YL++EY   G L + +  R    L E E +    Q+  GV+  HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPE 160

Query: 164 NVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA--QYRCPEMIDLYRGL 221
           N+LL   +  K+ DFG       A   TE        +++ +     Y  PE++    G+
Sbjct: 161 NLLLDHKYNIKIADFGM------AALETE------GKLLETSCGSPHYAAPEIVS---GI 205

Query: 222 PIDE-KSDIWALGVFLYKTCYYTTPF-EKNGESAILASK-----FEFPAYPRYSDRVKNL 274
           P     SD+W+ GV L+       PF E++G    L  K     FE P+    S   ++L
Sbjct: 206 PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDL 265

Query: 275 ISVMLRVDPLKR 286
           I  +L VDP +R
Sbjct: 266 ICKILTVDPKRR 277

>YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putative
           serine/threonine protein kinase implicated in the
           regulation of phospholipid asymmetry through the
           activation of phospholipid translocases (flippases)
           Lem3p-Dnf1p/Dnf2p; similar to Fpk1p
          Length = 720

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 92/216 (42%), Gaps = 25/216 (11%)

Query: 84  FIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQ 143
           FIV+   S  TK         +YL MEYC GG     + TR    + E +     S+V  
Sbjct: 383 FIVTLYHSFQTKD-------YLYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVA 435

Query: 144 GVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFG-SVSGVIRAPRNTEEFNYVQYDIM 202
            +  +H L    I+RD+K EN+LL ++    L DF  S+          ++  Y+   I 
Sbjct: 436 ALEYLHLLG--FIYRDLKPENILLHQSGHVMLSDFDLSIQATGSKKPTMKDSTYLDTKIC 493

Query: 203 KN--------TTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGE--- 251
            +         T +Y  PE+I   RG       D W LG+ +Y+  +  TPF+ +     
Sbjct: 494 SDGFRTNSFVGTEEYLAPEVI---RGNGHTAAVDWWTLGILIYEMLFGCTPFKGDNSNET 550

Query: 252 -SAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKR 286
            S IL    +FP     S   K+LI  +L  +  KR
Sbjct: 551 FSNILTKDVKFPHDKEVSKNCKDLIKKLLNKNEAKR 586

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 103/225 (45%), Gaps = 38/225 (16%)

Query: 72  EVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQE 131
           E+  MK LR +  ++S  D   T S        +Y+++EY   G L + +  +    L E
Sbjct: 84  EIIIMKLLR-HANVLSLYDVWETNS-------NLYMILEYAEKGELFNLLVEK--GPLPE 133

Query: 132 FEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNT 191
            E +    Q+  G++  HAL   ++HRD+K EN+LL      K+ DFG       A   T
Sbjct: 134 KEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFG------MAALET 185

Query: 192 EEFNYVQYDIMKNTTA---QYRCPEMIDLYRGLPIDE-KSDIWALGVFLYKTCYYTTPFE 247
           E       D +  T+     Y  PE++    G+P    +SD+W+ GV L+       PF+
Sbjct: 186 E-------DKLLETSCGSPHYAAPEIVS---GIPYHGFESDVWSCGVILFALLTGRLPFD 235

Query: 248 ------KNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKR 286
                 +N    + + +FE P     S   ++LIS +L VDP KR
Sbjct: 236 EEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKR 280

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 91/192 (47%), Gaps = 28/192 (14%)

Query: 104 EVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIE 163
           ++YL++EY   G L + +  R    L E E +    Q+  GV+  HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPEHEAIRFFRQIIIGVSYCHAL--GIVHRDLKPE 160

Query: 164 NVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTA--QYRCPEMIDLYRGL 221
           N+LL   +  K+ DFG       A   TE        +++ +     Y  PE++    G+
Sbjct: 161 NLLLDHKYNIKIADFG------MAALETE------GKLLETSCGSPHYAAPEIVS---GI 205

Query: 222 PIDE-KSDIWALGVFLYKTCYYTTPF-EKNGESAILASK-----FEFPAYPRYSDRVKNL 274
           P     SD+W+ GV L+       PF E++G    L  K     FE P+    S   ++L
Sbjct: 206 PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDL 265

Query: 275 ISVMLRVDPLKR 286
           I  +L VDP +R
Sbjct: 266 IRKILTVDPERR 277

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 95/202 (47%), Gaps = 39/202 (19%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           + +++EY SGG    ++  + + RL+E     + +Q+  GV  MH+    L+HRD+K+EN
Sbjct: 128 IGIVLEYASGGEFYKYI--QRKRRLKESTACRLFAQLISGVTYMHSKN--LVHRDLKLEN 183

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ--YRCPEMIDLYRGLP 222
           +LL KN    + DFG V+  +  P N         + MK +     Y  PE++   R   
Sbjct: 184 LLLDKNENLVITDFGFVNEFL--PDN---------EYMKTSCGSPCYAAPELVISTRPY- 231

Query: 223 IDEKSDIWALGVFLYKTCYYTTPFEKNGESA-----------ILASKFEFPAY----PRY 267
           +  K+D+W+ G+ LY       P++ +  +            I  +  +FP Y    PR 
Sbjct: 232 VARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFPEYITPIPR- 290

Query: 268 SDRVKNLISVMLRVDPLKRPNI 289
                +L+  +L  DP KR N+
Sbjct: 291 -----DLLRKILVPDPNKRVNM 307

>ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {ON}
           some similarities with uniprot|Q03306 Saccharomyces
           cerevisiae YDR466W
          Length = 890

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 126/274 (45%), Gaps = 31/274 (11%)

Query: 28  LASGGFAHVY-SVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIV 86
           L +G ++ VY +V+ S P  V    V   + ++  +K    T+     ++ A   +  IV
Sbjct: 18  LGNGSYSRVYKAVDRSDPQRVYAVKVCSKRHIIHENKVKYVTIEKNTLNLLARANHPGIV 77

Query: 87  SYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVA 146
               +   +         +Y ++++ +GG L+  +N     +  E    + ++Q+     
Sbjct: 78  KLHSTFHDEE-------NLYFVLDFAAGGELLSLLNR--VGKFTEPCARHFIAQLIDTTE 128

Query: 147 AMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTE-EFNYVQYDIMKNT 205
            +H+    +IHRD+K ENVLL ++    + DFG+ + + +   NTE   ++V        
Sbjct: 129 FIHSQG--VIHRDLKPENVLLHRDGRLMVTDFGTATNITK--ENTEGGASFV-------G 177

Query: 206 TAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEF 261
           TA+Y  PE++ LY        SD+WALG  LY+      PF    E      I+A   E+
Sbjct: 178 TAEYVSPELL-LYNQCQF--ASDVWALGCMLYQFIEGVPPFRGENELHTFEKIVA--LEY 232

Query: 262 PAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEE 295
           P        V +L+  +L +DP +RP++  + ++
Sbjct: 233 PWANNNKGGVVSLVRRILTLDPSQRPSLTSIKQD 266

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 114/248 (45%), Gaps = 28/248 (11%)

Query: 50  DNVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLM 109
           D V  +K +V      LN + AE+  +K L  +  IV Y      KS      YE+Y+L+
Sbjct: 48  DQVVAIKEIVYESDEELNDIMAEISLLKNLNHDN-IVKY-HGFIRKS------YELYILL 99

Query: 110 EYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSK 169
           EYC+ G L   + +R    L E E  + ++Q   G+  +H     +IHRDIK  N+LLS 
Sbjct: 100 EYCANGSLRRLI-SRSSTGLSENESKSYVTQTLLGLKYLHG--EGVIHRDIKAANILLSA 156

Query: 170 NHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDI 229
           ++  KL DFG VS ++ +   T              T  +  PE++   RG      SDI
Sbjct: 157 DNTVKLADFG-VSTIVNSSALTLA-----------GTLNWMAPEILG-NRG--ASTLSDI 201

Query: 230 WALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYP--RYSDRVKNLISVMLRVDPLKRP 287
           W+LG  + +      P+    ++ I  +      YP   +S+ +K+ +S     +  KRP
Sbjct: 202 WSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRP 261

Query: 288 NICQVVEE 295
              Q+++ 
Sbjct: 262 TADQLLKH 269

>TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.92
           YDR490C
          Length = 819

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 96/195 (49%), Gaps = 19/195 (9%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +Y ++EY   G L+  +  R    L      +  +Q+   + A+H++   +IHRDIK EN
Sbjct: 219 LYFVLEYAPHGDLLALL--RRHGSLSRAVTCHYAAQLLSAIGALHSVG--VIHRDIKPEN 274

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFN-YVQYDIMKNTTAQYRCPEMIDLYRGLPI 223
           VLL  ++  KL DFG+ + + +   N E+ + +V    +   TA+Y  PE++        
Sbjct: 275 VLLDSHYRAKLTDFGTAALLPQTHSNLEQVSRHVTTSFVG--TAEYVPPELLAAGHA--- 329

Query: 224 DEKSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPAYPRYSDRVKNLISVML 279
           D   D+WA    +++      PF+   E      ++A ++ +P  P +   +K+L+  +L
Sbjct: 330 DGTCDLWAWACVVFQLIAGRPPFQARNEFLTFQNVMAVRYTYP--PGFPSDLKDLLRRVL 387

Query: 280 RVDPLKR---PNICQ 291
           R +P +R   P I Q
Sbjct: 388 RHEPRQRLLQPQITQ 402

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 100/210 (47%), Gaps = 25/210 (11%)

Query: 106 YLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENV 165
           Y++ EY SGG L+D++       L+E    +    ++ G+A +HA    ++HRD+KIEN+
Sbjct: 218 YMMFEYVSGGQLLDYIIQ--HGSLREPLARSFARAIASGLAYLHANN--VVHRDLKIENI 273

Query: 166 LLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLP-ID 224
           +L+   E K+ DFG +S +         +    Y         +  PE++   R  P I 
Sbjct: 274 MLTAAGEIKIIDFG-LSNLFDPRAKLTTYCGSLY---------FAAPELL---RAKPYIG 320

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESA----ILASKFEFPAYPRYSDRVKNLISVMLR 280
            + DIW+ GV LY       PF+    +A    I   K  +PA    S    +L++ ML 
Sbjct: 321 PEIDIWSFGVILYVLVVGKVPFDDENSNALHEKIKRGKVSYPA--TLSIECISLLTKMLT 378

Query: 281 VDPLKRPNICQVVEEVSRIQGIP-CPIKNF 309
           V+P +R  + ++V     ++G    P K+F
Sbjct: 379 VNPKRRATLKEIVTHHWMVRGYGNIPAKSF 408

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 81/275 (29%), Positives = 122/275 (44%), Gaps = 30/275 (10%)

Query: 25  LKYLASGGFAHVY-SVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSMKALRGNK 83
           L  L  G ++ VY +VE S         V   K ++   K    T+  ++ +M A  G+ 
Sbjct: 13  LDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKKVKYVTIEKDLLNMLAKGGHL 72

Query: 84  FIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQ 143
            IV    +          +  +Y ++EY SGG L+  +  RL  RL E    +I +Q+  
Sbjct: 73  GIVKLFCTFHD-------IENLYFVLEYVSGGELLALIQ-RL-GRLTEDLSRHITAQLVD 123

Query: 144 GVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMK 203
            V  MH+    +IHRD+K ENVLLS+     + DFG  +    A R  E        +  
Sbjct: 124 TVDYMHS--KGVIHRDLKPENVLLSQEGRVVITDFG--AACTAADRKFENTKRTASFV-- 177

Query: 204 NTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGE------SAILAS 257
             TA+Y  PE++ L+        SDIWALG  +Y+      PF    E         L  
Sbjct: 178 -GTAEYVSPELL-LHSQCGFS--SDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDY 233

Query: 258 KFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQV 292
           K+ F   P    +V +++  +L  DPLKRP+  Q+
Sbjct: 234 KWLFSNSP----QVVSIVQSILVTDPLKRPSAAQL 264

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 97/201 (48%), Gaps = 25/201 (12%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           +Y L+EY   G  +  +  +    L E   +   +Q+   + +MH+    +IHRDIK EN
Sbjct: 193 LYFLLEYAPNGDFLSLI--KKFGTLNEECTIYYSAQIIDAIGSMHSHG--IIHRDIKPEN 248

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNT-----TAQYRCPEMI-DLY 218
           +LL  N + KL DFG+   +    + +++     Y+++  +     TA+Y  PE++ D Y
Sbjct: 249 ILLDGNMKIKLTDFGTAKLL---QKKSDKNGKPHYNLLTRSSSFVGTAEYVSPELLSDNY 305

Query: 219 RGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGE----SAILASKFEFPA-YPRYSDRVKN 273
                D K DIWA G  +Y+      PF+   E      ++  +F F A +P     +++
Sbjct: 306 ----TDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAGFPTI---IRD 358

Query: 274 LISVMLRVDPLKRPNICQVVE 294
           L+  +L   P KR  I Q+ E
Sbjct: 359 LVKNILVKQPEKRLTIPQIKE 379

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 87/188 (46%), Gaps = 24/188 (12%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           ++++MEYC+GG L   +      ++ E  I  IM +V   +  +H  +  +IHRDIK  N
Sbjct: 95  LWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMREVLVALKCIH--KDNVIHRDIKAAN 149

Query: 165 VLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPID 224
           VL++     KLCDFG  + V +     +      Y         +  PE+I    G+  D
Sbjct: 150 VLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPY---------WMAPEVI--MEGVYYD 198

Query: 225 EKSDIWALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYP------RYSDRVKNLISVM 278
            K DIW+LG+  Y+      P+ +    A+ A +    + P       YS  +K  I++ 
Sbjct: 199 TKVDIWSLGITTYEIATGNPPYCE--VEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALC 256

Query: 279 LRVDPLKR 286
           L  DP +R
Sbjct: 257 LDEDPKER 264

>TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1.271
            YJL095W
          Length = 1429

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 123/279 (44%), Gaps = 49/279 (17%)

Query: 28   LASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLN--------TLRAEVDSMKAL 79
            +  G F  VY         V    +  +K+V VP   S N         LRAE+ ++K L
Sbjct: 1130 IGKGSFGAVYLCL-----NVTTGEMMAVKQVEVPKYGSQNEQIIHTVEALRAEMSTLKNL 1184

Query: 80   RGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMS 139
              +  IV Y+   A K  +N       L +EY +GG +   +  R+  R  E  I ++ +
Sbjct: 1185 -DHLNIVQYLGFEA-KDHMNS------LFLEYVAGGSVGSLI--RMYGRFDEVMIKHLTT 1234

Query: 140  QVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNYVQY 199
            QV +G++ +H+    ++HRD+K +N+LL +    K+ DF    G+ R  ++     Y   
Sbjct: 1235 QVLRGLSYLHSRG--ILHRDMKADNLLLDQEGVCKISDF----GISRKSKDI----YSNS 1284

Query: 200  DIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESAILASKF 259
            ++    T  +  PEM+D  +G     K DIW++G  + +      P+  N E  ++A+ F
Sbjct: 1285 EMTMRGTVFWMAPEMVDTAQGY--SAKVDIWSMGCVVLEMFAGKRPWS-NLE--VVAAMF 1339

Query: 260  EF-----------PAYPRYSDRVKNLISVMLRVDPLKRP 287
            +               P  S   ++ I    ++DP  RP
Sbjct: 1340 KIGKSKSAPPIPEDTLPLISQSGRDFIDACFQIDPEARP 1378

>Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON}
           similar to Ashbya gossypii ADR167W
          Length = 896

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 118/289 (40%), Gaps = 37/289 (12%)

Query: 17  VGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVVPDKASLNTLRAEVDSM 76
           VG    + ++ L  G    VY V     D +    +    +  +  +  +  + AE + +
Sbjct: 477 VGPQSFEKIRLLGQGDVGKVYLVREKKSDRLYA--LKIFGKAEMIKRKKIKRILAEQEIL 534

Query: 77  KALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFMNTRLQNRLQEFEILN 136
            A   + FIV+   S  T+         +YL MEYC GG     + TR    + E +   
Sbjct: 535 -ATSNHPFIVTLYHSFQTED-------YLYLCMEYCMGGEFFRALQTRKTKCISEDDARF 586

Query: 137 IMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSVSGVIRAPRNTEEFNY 196
             S+V+  +  +H +    I+RD+K EN+LL ++    L DF  +S   + PRN +    
Sbjct: 587 YASEVTAALEYLHLMG--FIYRDLKPENILLHQSGHIMLSDF-DLSVQAKGPRNPQVKGN 643

Query: 197 VQYDIMKNT-------------TAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYT 243
            Q  ++                T +Y  PE+I   RG       D W LG+  Y+  +  
Sbjct: 644 AQSSLVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTASVDWWTLGILTYEMLFGF 700

Query: 244 TPFEKNGE------SAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKR 286
           TPF+  GE      S IL  +  FP     S   K+LI  +L     KR
Sbjct: 701 TPFK--GENTNQTFSNILKVEATFPNNNEISRTCKDLIKKLLIKSETKR 747

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 89/204 (43%), Gaps = 33/204 (16%)

Query: 105 VYLLMEYCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIEN 164
           VYL MEYC GG     + TR    + E +     S+V+  +  +H L    I+RD+K EN
Sbjct: 509 VYLCMEYCMGGEFFRALQTRKAKSISEDDARFYASEVTAALEYLHLLG--FIYRDLKPEN 566

Query: 165 VLLSKNHEFKLCDF----------------GSVSGVIRAPRNTEEFNYVQYDIMKNTTAQ 208
           +LL K+    L DF                 + S ++     +E F    +      T +
Sbjct: 567 ILLHKSGHIMLSDFDLSVQANDAAKPVKRVATQSSMVDTKVFSEGFRTNSF----VGTEE 622

Query: 209 YRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCYYTTPFEKNGESA------ILASKFEFP 262
           Y  PE+I   RG       D W LG+ +Y+  +  TPF+  GE+       IL ++  FP
Sbjct: 623 YIAPEVI---RGNGHTAAVDWWTLGILIYEMLFGCTPFK--GENTNETFCNILKNEVTFP 677

Query: 263 AYPRYSDRVKNLISVMLRVDPLKR 286
            +   S   K+LI  +L  +  KR
Sbjct: 678 EHHEISRHCKDLIRKLLSKNESKR 701

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,488,252
Number of extensions: 2775880
Number of successful extensions: 12855
Number of sequences better than 10.0: 1852
Number of HSP's gapped: 11635
Number of HSP's successfully gapped: 1895
Length of query: 777
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 659
Effective length of database: 39,950,811
Effective search space: 26327584449
Effective search space used: 26327584449
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)