Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E08383g2.285ON70470438040.0
SAKL0E07700g2.285ON71266828930.0
Ecym_33242.285ON70670328350.0
KLTH0G10340g2.285ON70870228040.0
Kwal_27.115372.285ON70867527880.0
NCAS0G038002.285ON72667327800.0
NDAI0G006502.285ON68967327670.0
YNL021W (HDA1)2.285ON70667527670.0
ADL216C2.285ON70567327660.0
Skud_14.3082.285ON70671027550.0
Suva_14.3262.285ON70671027530.0
CAGL0J03454g2.285ON69367527430.0
Smik_14.3102.285ON70671027400.0
KNAG0H020102.285ON69369427150.0
ZYRO0A01870g2.285ON70767527090.0
TDEL0G021602.285ON71466726860.0
KAFR0H033202.285ON70267426420.0
Kpol_1039.322.285ON65965625590.0
TPHA0C033902.285ON70170125160.0
TBLA0B069502.285ON79545619210.0
Kpol_1003.372.285ON57831613111e-173
TPHA0H003208.153ON4503673712e-37
KAFR0C029208.153ON4533563632e-36
AFR172C8.153ON4493373553e-35
TDEL0B045808.153ON4463683518e-35
NCAS0B054808.153ON4513673519e-35
CAGL0A03322g8.153ON4504293491e-34
NDAI0B027108.153ON4533523482e-34
TBLA0D021408.153ON4563673473e-34
Kpol_246.58.153ON4533673455e-34
KLTH0E06446g8.153ON4493633421e-33
SAKL0H25124g8.153ON4483453384e-33
KLLA0F09119g8.153ON4523333367e-33
YGL194C (HOS2)8.153ON4523453359e-33
ZYRO0G19316g8.153ON4483363359e-33
Kwal_55.207908.153ON4493333341e-32
Smik_7.798.153ON4523313322e-32
Skud_7.798.153ON4523453323e-32
Ecym_23468.153ON4853333315e-32
KNAG0G013508.153ON4513363279e-32
Kpol_1038.113.8ON4333523251e-31
Suva_14.113.8ON4333283242e-31
KLTH0F19668g3.8ON4323283233e-31
Skud_14.113.8ON4333283223e-31
Kwal_55.221423.8ON4323283207e-31
TBLA0I005603.8ON4333283198e-31
NCAS0C043203.8ON4343283199e-31
KLLA0E01981g3.8ON4323283181e-30
AGR395W3.8ON4333283181e-30
Suva_7.718.153ON4523303191e-30
SAKL0C13706g3.8ON4333283181e-30
Ecym_20103.8ON4333283181e-30
YNL330C (RPD3)3.8ON4333283172e-30
Smik_14.23.8ON4333283162e-30
ZYRO0C03498g3.8ON4333283153e-30
KNAG0A011603.8ON4333283144e-30
KAFR0A086303.8ON4333283145e-30
NDAI0G037403.8ON4333263145e-30
CAGL0B01441g3.8ON4333283135e-30
TPHA0A003003.8ON4333523111e-29
TDEL0A002703.8ON4333263048e-29
TDEL0C050403.362ON4542091893e-14
CAGL0D01430g3.362ON4452091787e-13
SAKL0B07854g3.362ON4892291771e-12
Suva_16.3963.362ON4771771752e-12
Skud_16.3533.362ON4711761742e-12
KLTH0F10582g3.362ON4742221734e-12
TBLA0B023903.362ON5791791734e-12
SAKL0H08338g8.607ON6904271735e-12
Kpol_376.153.362ON5182101715e-12
TDEL0A055208.607ON6743321682e-11
YPR068C (HOS1)3.362ON4701771672e-11
NDAI0A051203.362ON5082371672e-11
KLLA0B09394g3.362ON4412511662e-11
ADL265W8.607ON6943011672e-11
Kwal_23.37243.362ON4732031653e-11
Smik_16.3093.362ON4701761653e-11
NCAS0A111803.362ON4902471653e-11
KAFR0H008903.362ON4742101644e-11
Ecym_82908.607ON7093381645e-11
KNAG0H006303.362ON4562361591e-10
Suva_16.1948.607ON6993741611e-10
Smik_6.3158.607ON6973741602e-10
ADL339W3.362ON4372391582e-10
KLTH0D09592g8.607ON7052621592e-10
TPHA0A011208.607ON6983031583e-10
YPL116W (HOS3)8.607ON6973741574e-10
Skud_16.1648.607ON6973751531e-09
TPHA0M015903.362ON4942981502e-09
ZYRO0C16390g3.362ON4361761474e-09
KAFR0H027908.607ON7171101476e-09
Kpol_479.68.607ON6883421468e-09
Kwal_26.85058.607ON7082541468e-09
CAGL0J06974g8.607ON6782921423e-08
ZYRO0F10780g8.607ON6683341413e-08
TBLA0E040808.607ON6942931413e-08
Ecym_34653.362ON4452321393e-08
KLLA0F00858g8.607ON715651386e-08
NDAI0E024808.607ON684961386e-08
NCAS0C017608.607ON700961342e-07
KNAG0J013008.607ON6771031314e-07
Smik_16.2238.78ON1226137880.065
TBLA0B010602.113ON121748742.8
NCAS0A143807.391ON325169732.9
YPL095C (EEB1)8.574ON45687733.2
Smik_16.1428.574ON45687733.6
SAKL0F12452g7.391ON318169723.9
CAGL0I05500g7.391ON319169714.5
ABL123Cna 1ON49474707.8
KNAG0F008402.13ON416110708.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08383g
         (704 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...  1469   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1118   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...  1096   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1084   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1078   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1075   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1070   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1070   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...  1070   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1065   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1065   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1061   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1060   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1050   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1048   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1039   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...  1022   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...   990   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...   973   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   744   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   509   e-173
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   147   2e-37
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   144   2e-36
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   141   3e-35
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   139   8e-35
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   139   9e-35
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   139   1e-34
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    138   2e-34
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   138   3e-34
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   137   5e-34
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   136   1e-33
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   134   4e-33
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   134   7e-33
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   133   9e-33
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   133   9e-33
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   133   1e-32
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   132   2e-32
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   132   3e-32
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   132   5e-32
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   130   9e-32
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   129   1e-31
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   129   2e-31
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   129   3e-31
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   128   3e-31
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   127   7e-31
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   127   8e-31
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      127   9e-31
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   127   1e-30
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   127   1e-30
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   127   1e-30
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   127   1e-30
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   127   1e-30
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   126   2e-30
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   126   2e-30
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   125   3e-30
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   125   4e-30
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   125   5e-30
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   125   5e-30
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   125   5e-30
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   124   1e-29
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   121   8e-29
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    77   3e-14
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    73   7e-13
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    73   1e-12
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    72   2e-12
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    72   2e-12
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    71   4e-12
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    71   4e-12
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    71   5e-12
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    70   5e-12
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    69   2e-11
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    69   2e-11
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    69   2e-11
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    69   2e-11
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    69   2e-11
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    68   3e-11
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    68   3e-11
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    68   3e-11
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    68   4e-11
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    68   5e-11
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    66   1e-10
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    67   1e-10
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    66   2e-10
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    65   2e-10
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    66   2e-10
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    65   3e-10
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    65   4e-10
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    64   1e-09
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    62   2e-09
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    61   4e-09
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    61   6e-09
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    61   8e-09
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    61   8e-09
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    59   3e-08
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    59   3e-08
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    59   3e-08
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    58   3e-08
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    58   6e-08
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    58   6e-08
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    56   2e-07
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    55   4e-07
Smik_16.223 Chr16 (406804..410484) [3681 bp, 1226 aa] {ON} YPL01...    39   0.065
TBLA0B01060 Chr2 (231926..235579) [3654 bp, 1217 aa] {ON} Anc_2....    33   2.8  
NCAS0A14380 Chr1 complement(2832482..2833459) [978 bp, 325 aa] {...    33   2.9  
YPL095C Chr16 complement(368071..369441) [1371 bp, 456 aa] {ON} ...    33   3.2  
Smik_16.142 Chr16 complement(251287..252657) [1371 bp, 456 aa] {...    33   3.6  
SAKL0F12452g Chr6 complement(971802..972758) [957 bp, 318 aa] {O...    32   3.9  
CAGL0I05500g Chr9 (520414..521373) [960 bp, 319 aa] {ON} highly ...    32   4.5  
ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON} N...    32   7.8  
KNAG0F00840 Chr6 complement(152366..153616) [1251 bp, 416 aa] {O...    32   8.2  

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score = 1469 bits (3804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 704/704 (100%), Positives = 704/704 (100%)

Query: 1   MESKKPAEEPLERPSIKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKTGICYDV 60
           MESKKPAEEPLERPSIKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKTGICYDV
Sbjct: 1   MESKKPAEEPLERPSIKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKTGICYDV 60

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR
Sbjct: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120

Query: 121 EAEEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEA 180
           EAEEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEA
Sbjct: 121 EAEEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEA 180

Query: 181 CKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDW 240
           CKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDW
Sbjct: 181 CKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDW 240

Query: 241 DIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTG 300
           DIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTG
Sbjct: 241 DIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTG 300

Query: 301 GVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLS 360
           GVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLS
Sbjct: 301 GVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLS 360

Query: 361 LAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQ 420
           LAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQ
Sbjct: 361 LAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQ 420

Query: 421 SKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQLPILDLN 480
           SKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQLPILDLN
Sbjct: 421 SKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQLPILDLN 480

Query: 481 LPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDR 540
           LPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDR
Sbjct: 481 LPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDR 540

Query: 541 RYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVH 600
           RYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVH
Sbjct: 541 RYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVH 600

Query: 601 LLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANEN 660
           LLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANEN
Sbjct: 601 LLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANEN 660

Query: 661 KKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704
           KKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE
Sbjct: 661 KKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1118 bits (2893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/668 (75%), Positives = 592/668 (88%)

Query: 37  PVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAEN 96
           PVIVP   P+I Y+ LKTG+CYDVRMRYHAKI+TSYFEYIDPHPEDPRRIYR+YKILAEN
Sbjct: 45  PVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAEN 104

Query: 97  GLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKETEG 156
           GLI+DPTLSG D IG+LM+K+PVREA  EEILQVH+++HL F+ +T ++ RE LLKETE 
Sbjct: 105 GLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETET 164

Query: 157 GDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSN 216
           GDSVYFNNDS LSAKLSCGGAIEACKAVVEGRVKN++AV+RPPGHHAEPEIAGGFCLFSN
Sbjct: 165 GDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSN 224

Query: 217 VAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTI 276
           VAVAA N+LK+YPESVR+IMI+DWDIHHGNGTQKAFY D+RVLYVSLHRY+LGKYYPGT+
Sbjct: 225 VAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTV 284

Query: 277 HGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAA 336
           HGNY+QTGEGKGEGFNCNI WP GG+GDAEYMWAF+QV+MPMGREF+PDLV+ISSGFDAA
Sbjct: 285 HGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAA 344

Query: 337 DGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPD 396
           DGDTIGQCHV+P+CYGHMTHML SLA+GNLCVVLEGGYNLDSIAKSALGV K+L+GEPPD
Sbjct: 345 DGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPD 404

Query: 397 ELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNA 456
           ELP P +QP PEA + IETVIRTQSKYW+CFK+ H NDG NFK+ +T +  ++NFPLQ A
Sbjct: 405 ELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPLQQA 464

Query: 457 IREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQT 516
           IR+ Q+ QLS +F FV LP+L++ +P +T++C+  I D+ET+VV VHDTPEIW++R+  T
Sbjct: 465 IRQEQLQQLSEKFGFVTLPLLNMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPIT 524

Query: 517 GIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNY 576
           G IDPS+SIIVD  L +I W++ R+Y +ID+NIPQ+LFE  NY  + +SQE+L+Y+WDNY
Sbjct: 525 GTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNY 584

Query: 577 LKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGD 636
           LK+F +L KVAFIG+GDAY GIVHLLGHRDTRSVVK A+SF+D KPLK +VPL+DE+LG+
Sbjct: 585 LKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGN 644

Query: 637 WYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDS 696
           WYFKNSLVFTS  HSCWG+  NENKK RK++GRVLK D  GM NI +ERF+EATDFILDS
Sbjct: 645 WYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDS 704

Query: 697 FEEWSESE 704
           FEEWS+SE
Sbjct: 705 FEEWSDSE 712

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/703 (70%), Positives = 601/703 (85%)

Query: 2   ESKKPAEEPLERPSIKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKTGICYDVR 61
           ESK+  +  ++      ++N  TA +  +  + +RP+IVP  KPKI Y  LKTG+CYDVR
Sbjct: 4   ESKQKRKLEIDGNDTIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVR 63

Query: 62  MRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVRE 121
           MRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI+DPTLSG D IG+LM+K+P+RE
Sbjct: 64  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIRE 123

Query: 122 AEEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEAC 181
           A E+EIL VHS++H++F+  T  + RE LLKETE GDSVY+NNDS +SAKLSCGGAIEAC
Sbjct: 124 ATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEAC 183

Query: 182 KAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWD 241
           KAVVEGRVKN++AVVRPPGHHAEPE+AGGFCLFSNVAVAA N+LK+YPESVRK+MI+DWD
Sbjct: 184 KAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWD 243

Query: 242 IHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGG 301
           IHHGNGTQ+AFY+D+RVLYVSLHRY+LG+YYPGT +GNY+Q+GEGKGEGFNCNI W  GG
Sbjct: 244 IHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGG 303

Query: 302 VGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSL 361
           VGDAEYMWAFEQ+++PMGREF+PDLV+ISSGFDAADGDTIGQCHV+PACYGHMTHML SL
Sbjct: 304 VGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSL 363

Query: 362 AKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQS 421
           AKGN+CVVLEGGYNLDSIAKSALGV KVL+GEPPDELP P KQP PEA   IETVIR Q+
Sbjct: 364 AKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQA 423

Query: 422 KYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQLPILDLNL 481
           KYW CFK++HGN G+N+K+ +  +L  +NFPLQ+A+R+ Q  +LS ++ FV LP+LD+ L
Sbjct: 424 KYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMEL 483

Query: 482 PANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDRR 541
             +T++C+  I +++TL++ VHDTPE+W++R+  TG IDPS+SIIVD  L + NWA+ R 
Sbjct: 484 SGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRS 543

Query: 542 YGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHL 601
           YGIIDINIPQ+LFE  NY  V +SQE+L YLWD+YLKFF  L +VAF+GIGDAY G VHL
Sbjct: 544 YGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHL 603

Query: 602 LGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANENK 661
           LGHRDTRS+VKCAISF DKK L+ +VPL+DE++ DWYFKNSL+FTS  HSCWG+  N++K
Sbjct: 604 LGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSK 663

Query: 662 KLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704
           K RKK+GRVLK + DGM NI +ERFEEATDFILDSFEEWS+SE
Sbjct: 664 KPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1084 bits (2804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/702 (70%), Positives = 593/702 (84%), Gaps = 8/702 (1%)

Query: 8   EEPLERPSIKEIKNEGTAYTLPSKDESQ-----RPVIVPPTKPKIRYSLLKTGICYDVRM 62
           EEP E+  I  +K +  + TL     +Q     RP IVP  +PK+ Y+ LKTG+CYDVRM
Sbjct: 10  EEPSEQ--INGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLCYDVRM 67

Query: 63  RYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVREA 122
           RYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSG DSIGDLM+K+PVREA
Sbjct: 68  RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVREA 127

Query: 123 EEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEACK 182
            +EEILQVH+++HL+FIS+T  + R+ LLKETE GDSVYFNNDSYLSAKLSCGGAIEACK
Sbjct: 128 TDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACK 187

Query: 183 AVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDI 242
           AVVEGRVKN++AVVRPPGHHAEPE+AGGFCLFSNVAVAA N+LK+YPESVRKIM++DWD+
Sbjct: 188 AVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDV 247

Query: 243 HHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGV 302
           HHGNGTQKAFYDDDRVLY+SLHR++LGKYYPGTIHGN D+ GEGKGEGFNCNI WP  GV
Sbjct: 248 HHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGV 307

Query: 303 GDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSLA 362
           GD+EY+WAFEQVIMPMGREF PDLV+ISSGFDAADGDT+GQCHVTP+CYGHMTHML SLA
Sbjct: 308 GDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLA 367

Query: 363 KGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSK 422
           +GNLC VLEGGY+LDSIAKSAL V KVL+GEPPDELP   KQP  EA ++I++VI+TQSK
Sbjct: 368 RGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPV-VKQPKLEAVEVIDSVIKTQSK 426

Query: 423 YWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQLPILDLNLP 482
           YW CFK+ HGNDG +FK+  T T   +NFPLQNAIR+ Q+  L+++F FV LP+    LP
Sbjct: 427 YWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLFKKELP 486

Query: 483 ANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDRRY 542
            +T +C+  I D+  ++V VHDTP IW++R   TG IDPS+SIIVD  L +I WA  R Y
Sbjct: 487 DDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASSRNY 546

Query: 543 GIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLL 602
           G+IDINIPQ+L E  NY  V ++QE+L+++WDNYLK+F +L +VAF+ IGDA+ G+VHLL
Sbjct: 547 GVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGVVHLL 606

Query: 603 GHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANENKK 662
           GHRDTRSVVK A+SF+D++PL+ ++PL+DETL DWYFKNSLVF S+ H+CWG+  NENKK
Sbjct: 607 GHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGNENKK 666

Query: 663 LRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704
            RKK+GRVLK D DG+ NI +ERFEEATDFILD+FEEWS+SE
Sbjct: 667 PRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1078 bits (2788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/675 (72%), Positives = 585/675 (86%), Gaps = 1/675 (0%)

Query: 30  SKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRV 89
           S+ + +RPVIVP  + K+ Y+ LKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+
Sbjct: 35  SETKVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 94

Query: 90  YKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERES 149
           YKILAENGLI DPTLSG D IGDLM+K+P REA +EEILQVH+ +HL+F+S+T  + RE 
Sbjct: 95  YKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQ 154

Query: 150 LLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAG 209
           LLKETE GDSVYFNNDSYLSAKLSCGGAIEAC+AVVEGRVKN++AVVRPPGHHAEP++AG
Sbjct: 155 LLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAG 214

Query: 210 GFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLG 269
           GFCLFSNVAVAA N+LK+YPESV+KIMI+DWD+HHGNGTQKAFY+DDRVLYVSLHR++LG
Sbjct: 215 GFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELG 274

Query: 270 KYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLI 329
           KYYPGTIHGN D+ GEGKGEGFNCNI WP  GVGDAEY+WAFEQV++PMGREF+PDLV+I
Sbjct: 275 KYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVII 334

Query: 330 SSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKV 389
           SSGFDAADGDT+GQCHVTP+CYGHMTHML SLA+GN+C VLEGGY+LDSIAKSALGV KV
Sbjct: 335 SSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKV 394

Query: 390 LVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTR 449
           L+GEPPDELP   KQP PEA ++I+ VI+ QS+YW CFK+ H NDG +FK+ +T TL  R
Sbjct: 395 LIGEPPDELPV-VKQPKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNR 453

Query: 450 NFPLQNAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIW 509
           NFPLQ AIR+ QV  L++++NFV LP++   LP +T LC+  I DS++++V VHDTPEIW
Sbjct: 454 NFPLQTAIRQQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIW 513

Query: 510 SERDTQTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEIL 569
           ++R   TG IDPS+SIIVD  L +I WA  R YG+IDINIPQ+L E  NY  V ++QE+L
Sbjct: 514 AQRSRATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVL 573

Query: 570 IYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPL 629
           +Y+WD+YLK+F +L KVAF+ IGDAY G+VHLLGHRDTR+VVK AISF+D++PL+ +VPL
Sbjct: 574 VYIWDSYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPL 633

Query: 630 IDETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEA 689
           +DE+L DWYFKNSLVF S+ H+CWG+   ENKK RKK+GRVLK + DG+ NI +ERFEEA
Sbjct: 634 VDESLADWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEA 693

Query: 690 TDFILDSFEEWSESE 704
           TDFILD+FEEWS+SE
Sbjct: 694 TDFILDTFEEWSDSE 708

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1075 bits (2780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/673 (72%), Positives = 576/673 (85%), Gaps = 2/673 (0%)

Query: 32  DESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYK 91
           D S+RPVIVPP   ++ Y+ LKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YK
Sbjct: 56  DVSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYK 115

Query: 92  ILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLL 151
           ILAENGLI+DPTLSG + IGDLM+K+PVR+A EEEIL+VHS++H DFI +T  + RE LL
Sbjct: 116 ILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELL 175

Query: 152 KETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGF 211
           K TE GDSVYFNNDS+ SAKL  GG+IEACKAVVEGRVKNS+AVVRPPGHHAEP+ AGGF
Sbjct: 176 KATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGF 235

Query: 212 CLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKY 271
           CLFSNVA+AA N+LK+YPESVR+IMI+DWDIHHGNGTQKAFYDDDRVLY+SLHR++LGKY
Sbjct: 236 CLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKY 295

Query: 272 YPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISS 331
           YPGTI+G YDQTGEGKGEGFNCNITWP GGVGDAEY+WAFEQV+MPM REF+PDLV+ISS
Sbjct: 296 YPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISS 355

Query: 332 GFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLV 391
           GFDAADGD+IGQCHVTP+CYGHMTHML SLAKGNLCVVLEGGYNLD+IA+SAL V K+L+
Sbjct: 356 GFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILI 415

Query: 392 GEPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNF 451
           GEPPDELP P + P PEA ++I+ VIR QSKYW CFK R+GN G NFKD I  +L ++NF
Sbjct: 416 GEPPDELPDPLRDPKPEAIEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNF 475

Query: 452 PLQNAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSE 511
           PLQ AIRE Q++ LS  F F  LP+L   LP +T+LC+  +  S+T+++  HDTPEIW++
Sbjct: 476 PLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAK 535

Query: 512 RDTQTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIY 571
           RD   G IDPSSSIIVD+ L  I WA +++YG+IDINIPQ LFE  NY  + +SQE+L Y
Sbjct: 536 RDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTY 595

Query: 572 LWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLID 631
           +WDNYLK+F N++KVAFIGIGDAY GIVHLLGHRDTRSVVK  I+F+ +K L+ +VPL+D
Sbjct: 596 IWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVD 655

Query: 632 ETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEATD 691
           E+L DWYFKNSLVF+  +H+ WG    ENKK RKKYGR+L+ + DG+ NI +ERFEEATD
Sbjct: 656 ESLSDWYFKNSLVFSDKSHTYWGD--KENKKPRKKYGRLLRCETDGINNIVEERFEEATD 713

Query: 692 FILDSFEEWSESE 704
           FILDSFEEWS+SE
Sbjct: 714 FILDSFEEWSDSE 726

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1070 bits (2767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/673 (72%), Positives = 577/673 (85%), Gaps = 2/673 (0%)

Query: 32  DESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYK 91
           D   R +IVPP   +I Y+ LKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YK
Sbjct: 19  DPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYK 78

Query: 92  ILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLL 151
           ILAENGLI+DPTLSG D IGDLM+K+PVREA  EEIL+VHS++HLDFI  T ++ RE LL
Sbjct: 79  ILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLL 138

Query: 152 KETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGF 211
           K TE GDSVYFN+DSY SAKL  GGAIEACKAVVEGRVKN++AVVRPPGHHAEPE AGGF
Sbjct: 139 KATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGF 198

Query: 212 CLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKY 271
           CLFSNVA+AA N+LK+YPESVRKI+I+DWDIHHGNGTQKAFYDDDR+LYVSLHR+++GKY
Sbjct: 199 CLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKY 258

Query: 272 YPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISS 331
           YPGTIHG YDQTGEGKGEGFNCNITWP GGVGDAEYMWAFEQ++MPMGREF+PDLV+IS+
Sbjct: 259 YPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISA 318

Query: 332 GFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLV 391
           GFDAADGDTIGQCHVTP+CYGHMTHML SLA+GN+ VVLEGGYNLDSIA SAL V K+L+
Sbjct: 319 GFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILI 378

Query: 392 GEPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNF 451
           GEPPDELP   + P PE  +MI+ V+R QSKYW CFK++ GN G +F++ I +++ T+NF
Sbjct: 379 GEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNF 438

Query: 452 PLQNAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSE 511
           PLQ+AIR+ QV  LS +FNF +LPI    LP +T+LC+S I +S T+++ VHDTPEIW++
Sbjct: 439 PLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAK 498

Query: 512 RDTQTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIY 571
           RD   G IDPSSSIIVD++L MI WA++R+YG+IDINIPQ L E  NY  + ++QE+LI 
Sbjct: 499 RDAIQGTIDPSSSIIVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLIN 558

Query: 572 LWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLID 631
           LWDNYLK+F N+ K+AF+GIGDAY GIVHLLGHRDTRSVVK  I+F+ +K LK +VPL+D
Sbjct: 559 LWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVD 618

Query: 632 ETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEATD 691
           E+LG+WYFKNSLVF++  H  WG    ENKK RKKYGRVL+ D DG++NI +ERFEEATD
Sbjct: 619 ESLGEWYFKNSLVFSNKNHIYWGD--KENKKPRKKYGRVLRCDTDGISNIMEERFEEATD 676

Query: 692 FILDSFEEWSESE 704
           FILDSFEEWS+SE
Sbjct: 677 FILDSFEEWSDSE 689

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1070 bits (2767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/675 (71%), Positives = 578/675 (85%), Gaps = 2/675 (0%)

Query: 30  SKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRV 89
           +  +S+R VIVP   PKI YS LKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+
Sbjct: 34  TTSKSKRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 93

Query: 90  YKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERES 149
           YKILAENGLI DPTLSG D +GDLM+K+PVR A  EEIL+VH+++HL+FI  TE++ RE 
Sbjct: 94  YKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREE 153

Query: 150 LLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAG 209
           LLKETE GDSVYFNNDSY SA+L CGGAIEACKAVVEGRVKNS+AVVRPPGHHAEP+ AG
Sbjct: 154 LLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAG 213

Query: 210 GFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLG 269
           GFCLFSNVAVAA N+LK+YPESVR+IMI+DWDIHHGNGTQK+FY DD+VLYVSLHR+++G
Sbjct: 214 GFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMG 273

Query: 270 KYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLI 329
           KYYPGTI G YDQTGEGKGEGFNCNITWP GGVGDAEYMWAFEQV+MPMGREF+PDLV+I
Sbjct: 274 KYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVII 333

Query: 330 SSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKV 389
           SSGFDAADGDTIGQCHVTP+CYGHMTHML SLA+GNLCVVLEGGYNLD+IA+SAL V KV
Sbjct: 334 SSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKV 393

Query: 390 LVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTR 449
           L+GEPPDELP P   P PE  +MI+ VIR QSKYW+CF+ RH N G NF + I  ++ ++
Sbjct: 394 LIGEPPDELPDPLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISK 453

Query: 450 NFPLQNAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIW 509
           NFPLQ AIR+ Q   LS +FNFV LP++ ++LP NT+LCT  I +S T++++VHDT +IW
Sbjct: 454 NFPLQKAIRQQQQHYLSDEFNFVTLPLVSMDLPDNTVLCTPNISESNTIIIVVHDTSDIW 513

Query: 510 SERDTQTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEIL 569
           ++R+  +G ID SSS+I+DN+L  I W +DR+YGIID+NIP TLFE  NY G+ +SQE+L
Sbjct: 514 AKRNVISGTIDLSSSVIIDNSLDFIKWGLDRKYGIIDVNIPLTLFEPDNYSGMITSQEVL 573

Query: 570 IYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPL 629
           IYLWDNY+K+F ++ K+AFIGIGD+Y GIVHLLGHRDTR+V K  I+FL  K LK +VPL
Sbjct: 574 IYLWDNYIKYFPSVAKIAFIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPL 633

Query: 630 IDETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEA 689
           +DETL +WYFKNSL+F++++H CW    NE++K RKK+GRVL+ D DG+ NI +ERFEEA
Sbjct: 634 VDETLSEWYFKNSLIFSNNSHQCW--KENESRKPRKKFGRVLRCDTDGLNNIIEERFEEA 691

Query: 690 TDFILDSFEEWSESE 704
           TDFILDSFEEWS+ E
Sbjct: 692 TDFILDSFEEWSDEE 706

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score = 1070 bits (2766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/673 (72%), Positives = 582/673 (86%), Gaps = 3/673 (0%)

Query: 35  QRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILA 94
           +RPVIVPP +PKI Y  LKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILA
Sbjct: 33  KRPVIVPPVRPKISYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 92

Query: 95  ENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKET 154
           ENGLI+DPTLSG D IG+LM K+PVREA EEEIL VHS++H++F+  T  ++RE LLKET
Sbjct: 93  ENGLIEDPTLSGIDEIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKET 152

Query: 155 EGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLF 214
           E GDSVY+NNDS +SA+LSCGGAIEACKAVVEGRVKN++AVVRPPGHHAEP +AGGFCLF
Sbjct: 153 EAGDSVYYNNDSLISARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLF 212

Query: 215 SNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPG 274
           SNVAVAA N+LK+YPESVR++MI+DWDIHHGNGTQKAFY D+RVLYVSLHRY+LGKYYPG
Sbjct: 213 SNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPG 272

Query: 275 TIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFD 334
           T +GNYDQ G+GKGEGFNCNI W   GVGDAEYMWAFEQV++PMGREF+PDLV+ISSGFD
Sbjct: 273 TSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFD 332

Query: 335 AADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEP 394
           AADGDTIGQCHV+PACYGH+THML SLA+GN+CVVLEGGYNLDSIAKSALGV KVL+GEP
Sbjct: 333 AADGDTIGQCHVSPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEP 392

Query: 395 PDELPAPKKQPTPEAKKMIET-VIRTQSKYWSCFKNRHGNDGINFKD-AITSTLDTRNFP 452
           PDELP P KQP PEA   I+  +++ QSKYW+CFK RHGNDGIN+++ A+  +L ++NFP
Sbjct: 393 PDELPQPLKQPKPEAIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFP 452

Query: 453 LQNAIR-EYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSE 511
           LQ       Q  +L+ ++ FV LP+L++ LP++T++C+  I  ++ +++ VHDTPEIW++
Sbjct: 453 LQKCCSPTTQFRRLAKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQ 512

Query: 512 RDTQTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIY 571
           RD+ TG IDPS+SIIVD  + +INWA+ R YG+IDINIPQ+LFE  NY  V SSQE++ Y
Sbjct: 513 RDSLTGHIDPSTSIIVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTY 572

Query: 572 LWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLID 631
           LWD+YLK F +L +VAF+GIGDAY G VHLLGHRDTRSVVKCAI+F DKK L+ +VPL+D
Sbjct: 573 LWDSYLKTFPHLARVAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVD 632

Query: 632 ETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEATD 691
           E+LGDWYFKNSLVFTS+ H CWG+  N++KK RKK+GRVL+  CDGM NI +ER EEATD
Sbjct: 633 ESLGDWYFKNSLVFTSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATD 692

Query: 692 FILDSFEEWSESE 704
           FILDSFEEWSESE
Sbjct: 693 FILDSFEEWSESE 705

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1065 bits (2755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/710 (68%), Positives = 591/710 (83%), Gaps = 10/710 (1%)

Query: 1   MESKKPAEEPLERP------SIKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKT 54
           M+S +   E LE P      +++  K +  + +  S++  +R VIVP   PKI YS LKT
Sbjct: 1   MDSARVKNEVLENPDHDLKRTLENTKEDQNSLSTTSRN--KRQVIVPACTPKIHYSPLKT 58

Query: 55  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLM 114
           G+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSG D IGDLM
Sbjct: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDIGDLM 118

Query: 115 VKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSC 174
           +K+PVR A  EEIL+VH+++HL+FI  TE++ RE LLKETE GDSVYFNNDSY SA+L C
Sbjct: 119 LKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPC 178

Query: 175 GGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           GGAIEACKAVVEGRVKNS+AVVRPPGHHAEP+ AGGFCLFSNVAVAA N+LK+YPESVR+
Sbjct: 179 GGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRR 238

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           IMI+DWDIHHGNGTQK+FY DD+VLYVSLHR+++GKYYPGTI G YDQTGEGKGEGFNCN
Sbjct: 239 IMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCN 298

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           ITWP GGVGDAEYMWAFEQV+MPMGREF+PDLV+ISSGFDAADGDTIGQCHV+P+CYGHM
Sbjct: 299 ITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVSPSCYGHM 358

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIE 414
           THML SLA+GNLCVVLEGGYNLD+IA+SAL V KVL+GEPPDELP     P PE  +MI+
Sbjct: 359 THMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSLSDPKPEVIEMID 418

Query: 415 TVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQL 474
            VIR QSKYW+CF+ RH N G NF + I  ++ ++NFPLQ AIR+ Q+  LS++F+FV L
Sbjct: 419 KVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLQYLSNEFSFVTL 478

Query: 475 PILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMI 534
           P++++ LP NT LCT  + +S  L+V+VHDT ++W++R+  +G ID SSS+I+DN +  I
Sbjct: 479 PLINMGLPDNTALCTPNVFESNALLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFI 538

Query: 535 NWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDA 594
            W +DR+YGIID+NIP TLFE  NY G+ +SQE+LIYLWDNY+K+F N+ K+AFIGIGD+
Sbjct: 539 KWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDS 598

Query: 595 YGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWG 654
           + GIVHLLGHRDTR+V K  I+FL  K LK +VPL+DETL +WYFKNSL+F++++H CW 
Sbjct: 599 HSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCW- 657

Query: 655 STANENKKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704
              NE++K RKK+GRVL+ D DG++N  +ERFEEATDFILDSFEEWS+ E
Sbjct: 658 -KENESRKPRKKFGRVLRCDTDGLSNTIEERFEEATDFILDSFEEWSDDE 706

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1065 bits (2753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/710 (68%), Positives = 589/710 (82%), Gaps = 10/710 (1%)

Query: 1   MESKKPAEEPLERP------SIKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKT 54
           M+S     E LE P       ++ +K E  + +  SK+  +R VIVP   PK+ Y+ L+T
Sbjct: 1   MDSATVKNEVLETPDQDLKHKLEGMKEEQNSLSTTSKN--KRQVIVPACTPKLHYTPLRT 58

Query: 55  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLM 114
           G+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSG D +GDLM
Sbjct: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118

Query: 115 VKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSC 174
           +K+PVR A  EEIL+VH+++HL+FI  TE++ RE LLKETE GDSVYFNNDSY SA+L C
Sbjct: 119 LKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPC 178

Query: 175 GGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           GGAIEACKAVVEGRVKNS+AVVRPPGHHAEP+ AGGFCLFSNVAVAA N+LK+YPESVR+
Sbjct: 179 GGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRR 238

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           IMI+DWDIHHGNGTQK+FY DD+VLY+SLHR+++GKYYPGTI G YDQTGEGKGEGFNCN
Sbjct: 239 IMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCN 298

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           ITWP GGVGDAEYMWAFEQV+MPMGREF+PDLV+ISSGFDAADGDTIGQCHVTP+CYGHM
Sbjct: 299 ITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHM 358

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIE 414
           THML SLA+GNLCVVLEGGYNLD+IA SAL V KVL+GEPPDELP P   P PE  +MI+
Sbjct: 359 THMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGEPPDELPDPLSDPKPEVIEMID 418

Query: 415 TVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQL 474
            V+R QSKYW+CF+ RH N G NF + I  ++ ++NFPLQ AIR+ Q+  LS +FNFV L
Sbjct: 419 KVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTL 478

Query: 475 PILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMI 534
           P++++ LP N +LCT  + +S TL+V+VHDT ++W++R+  +G ID SSS+++DN L  I
Sbjct: 479 PLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFI 538

Query: 535 NWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDA 594
            W +DR+YGIID+NIP TLFE  NY G+ +SQE+LIYLWDNY+K+F  + K+A+IGIGD+
Sbjct: 539 KWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDS 598

Query: 595 YGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWG 654
           Y GIVHLLGHRDTR+V K  I+FL  K LK +VPL+DETL +WYFKNSLVFT+++H CW 
Sbjct: 599 YSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCW- 657

Query: 655 STANENKKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704
              NE++K RKK+GRVL+ D DG++N  +ERFEEATDFILDSFEEWS+ E
Sbjct: 658 -KENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1061 bits (2743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/675 (71%), Positives = 579/675 (85%), Gaps = 2/675 (0%)

Query: 30  SKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRV 89
           +  + +RPVIVP  K +I Y+ LKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+
Sbjct: 21  ASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 80

Query: 90  YKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERES 149
           YKILAENGLI DPTLSG + IGDLM+K+P+R A  EEIL+VHS++HL+FI +TE++ RE 
Sbjct: 81  YKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREE 140

Query: 150 LLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAG 209
           LLKETE GDSVYFNNDSY +++L CGGAIEACKAVVEGRVKNS+AVVRPPGHHAEPE AG
Sbjct: 141 LLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAG 200

Query: 210 GFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLG 269
           GFCLFSNVAVAA N+LK+YPESVR+I+I+DWD+HHGNGTQKAFYDDDRVLY+SLHR++LG
Sbjct: 201 GFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELG 260

Query: 270 KYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLI 329
           KYYPGTI G YDQ GEGKG+GFNCNITWP GGVGDAEYMWAFEQV+MPMGREF+PDLV+I
Sbjct: 261 KYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVII 320

Query: 330 SSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKV 389
           SSGFDAADGDTIGQCHVTP+CYGHMTHML SLA+GNLCVVLEGGYNLD+IA SAL V K+
Sbjct: 321 SSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKI 380

Query: 390 LVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTR 449
           L+GEPPDELP P ++P  EA ++I+ VI  QSKYW CF  R+GN G+  ++ + + + ++
Sbjct: 381 LIGEPPDELPDPLREPKAEALEIIDKVISLQSKYWKCFGKRYGNLGLPSENVVKALMMSK 440

Query: 450 NFPLQNAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIW 509
           +FPLQ AIR+ Q  QLS  F FV LP+L++ +P ++++C+  + +  T++V+VHDTPEIW
Sbjct: 441 SFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEIW 500

Query: 510 SERDTQTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEIL 569
           ++R+  TG IDPS+S++VD+  + I W ++R+YGI+DINIPQ+LFE  NY  V +SQEIL
Sbjct: 501 AKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEIL 560

Query: 570 IYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPL 629
           IY+WDNYLKFF +L KVAFIGIGDA  GIVHLLGHRDTRSVVK  +SF+ KK LK +VPL
Sbjct: 561 IYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPL 620

Query: 630 IDETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEA 689
           ++E+LGDWYFKNSLVFT  +HSCWG   NEN+K RKK+GRVL+ D +GM NI +ER EE+
Sbjct: 621 VNESLGDWYFKNSLVFTDHSHSCWGD--NENRKPRKKFGRVLRCDAEGMNNIIEERLEES 678

Query: 690 TDFILDSFEEWSESE 704
           TDFILDSFEEWS+SE
Sbjct: 679 TDFILDSFEEWSDSE 693

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1060 bits (2740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/710 (68%), Positives = 587/710 (82%), Gaps = 10/710 (1%)

Query: 1   MESKKPAEEPLERPS------IKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKT 54
           M+S+   +E  E P       ++E K +    +L +   ++R VIVP   PKI YS LKT
Sbjct: 1   MDSEIVKKEAWENPDGNLKRRLEETKEDQN--SLSTTSNNKRQVIVPACTPKIHYSPLKT 58

Query: 55  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLM 114
           G+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSG D +GDLM
Sbjct: 59  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLM 118

Query: 115 VKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSC 174
           +K+PVR A  EEIL+VH+++HL+FI  TE++ RE LLKETE GDSVYFNNDSY SA+L C
Sbjct: 119 LKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPC 178

Query: 175 GGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           GGAIEACKAVVEGRVKNS+AVVRPPGHHAEP+ AGGFCLFSNVAVAA N+LK+YPESVR+
Sbjct: 179 GGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRR 238

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           IMI+DWDIHHGNGTQK+FY DD+VLYVSLHR+++GKYYPGTI G YDQ GEGKGEGFNCN
Sbjct: 239 IMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCN 298

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           ITWP GGVGDAEYMWAFEQV+MPMGREF+PDLV+ISSGFDAADGDTIGQCHVTP+CYGHM
Sbjct: 299 ITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHM 358

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIE 414
           THML SLA+GNLCVVLEGGYNLD+IA+SAL V KVL+GEPPDELP     P PE  +MI+
Sbjct: 359 THMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSSSDPKPEVIEMID 418

Query: 415 TVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQL 474
            VIR QSKYW+CF+ RH N G NF + I  ++ ++NFPLQ AIR+ Q   LS +FN V L
Sbjct: 419 KVIRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTL 478

Query: 475 PILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMI 534
           P+++++LP NT+LCT  + +S TL+V+VHDT +IW++R+  +G ID SSS+I+DN L  I
Sbjct: 479 PLINMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFI 538

Query: 535 NWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDA 594
            W +DR+YGIID+NIP +LFE  NY G+ +SQE+LIYLWDNY+K+F  + K+AF+GIGD+
Sbjct: 539 KWGLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDS 598

Query: 595 YGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWG 654
           Y GIVHLLGHRDTR+V K  I+FL  K LK +VPL+DETL +WYFKNSL+F++++H CW 
Sbjct: 599 YSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCW- 657

Query: 655 STANENKKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704
              NE++K RKK+GRVL+ D DG+ N  +ERFEEATDFILDSFEEWS+ E
Sbjct: 658 -KENESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1050 bits (2715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/694 (68%), Positives = 575/694 (82%), Gaps = 1/694 (0%)

Query: 11  LERPSIKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFT 70
           +  PS+K  +N  +     S   S+R +IV P  PK+RY+ LKTG+CYDVRMRYHAKIFT
Sbjct: 1   MTEPSVKR-ENPDSQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFT 59

Query: 71  SYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQV 130
           SYFEYIDPHPEDPRRIYR+YKILAENGLI DP LSG D IGDLM+K+PVREA  +E+L+V
Sbjct: 60  SYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEV 119

Query: 131 HSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVK 190
           HS++HL+FI    ++  + LLK TE GDSVYFNNDS  SAKLSCGGAIEACKAVVEGRVK
Sbjct: 120 HSKEHLEFIESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVK 179

Query: 191 NSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQK 250
           N+ AVVRPPGHH+EPE AGGFCLFSNVAVA+ N+L++YPESVR+IMI+DWDIHHGNGTQK
Sbjct: 180 NAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQK 239

Query: 251 AFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWA 310
           AFYDDDRVLY+SLHR++LGKYYPGT  G+YD+TGEGKGEGFNCNITWP GGVGDAEYMWA
Sbjct: 240 AFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWA 299

Query: 311 FEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVL 370
           FEQV+MPM REF PDLV+IS+GFDAADGDTIGQCHV+P+CYGHMTHML SLA GNLCVVL
Sbjct: 300 FEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVL 359

Query: 371 EGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNR 430
           EGGYNLD+IA+SAL V KVL+GEPP+EL  P K P PEA ++I  VIR QSKYW CF+ R
Sbjct: 360 EGGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRR 419

Query: 431 HGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTS 490
           HGN G  F+  +T ++ T NFPLQ+AIR+ Q S LS +F FV+ P+ ++ L  +T++C+ 
Sbjct: 420 HGNSGCTFEKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSP 479

Query: 491 GIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIP 550
            + + +T++++V DTPEIW++RD   G IDPS+SII D AL  I WAM+R YG+ID+NIP
Sbjct: 480 EVYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIP 539

Query: 551 QTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSV 610
           Q+LFE  NY  + ++QE++ ++WDNY++FF +  K+AF+G+GDA  GIVHLLGHRDTRS 
Sbjct: 540 QSLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSK 599

Query: 611 VKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRV 670
           VK  I+F+ +K LK ++PL+DETLGDWYFKNSLVF+   H+CWG   NENKK RKK+GRV
Sbjct: 600 VKSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRV 659

Query: 671 LKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704
           L+ + DG+TNI +ERFEEATDF+LDSFEEWSES+
Sbjct: 660 LRCNSDGLTNIIEERFEEATDFMLDSFEEWSESD 693

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1048 bits (2709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/675 (70%), Positives = 572/675 (84%), Gaps = 3/675 (0%)

Query: 30  SKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRV 89
           S    +R +IVP  +PKI Y+ LKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+
Sbjct: 36  SNGRQKRQIIVPACEPKIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 95

Query: 90  YKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERES 149
           YKILAENGLI DPTLSG D IG+LM+K+PVREA  EE+LQVH+++HL+FI +T Q+ RE 
Sbjct: 96  YKILAENGLINDPTLSGEDDIGELMLKIPVREATVEELLQVHTKEHLEFIEKTSQMNREE 155

Query: 150 LLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAG 209
           LLKETE GDSVYFN+DSY +AKL CGGAIEACKAVVEGRVKN++AV+RPPGHHAEPE+AG
Sbjct: 156 LLKETETGDSVYFNSDSYSAAKLPCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEMAG 215

Query: 210 GFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLG 269
           GFCLFSNVAVAA N+LK+YPESVR+I+I+DWDIHHGNGTQKAFY+DDRVLY+SLHR++LG
Sbjct: 216 GFCLFSNVAVAAQNILKNYPESVRRILILDWDIHHGNGTQKAFYNDDRVLYISLHRFELG 275

Query: 270 KYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLI 329
           KYYPGTIHG YDQTGEGKGEGFNCNITWP GGVGDAEYM AFEQ++MPM RE+ PDLV+I
Sbjct: 276 KYYPGTIHGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREYRPDLVII 335

Query: 330 SSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKV 389
           SSGFDAADGDTIGQCHV+P+CYGHMTHML SLA+GNLCV LEGGYNLD+IA SAL V K+
Sbjct: 336 SSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVALEGGYNLDAIATSALSVAKI 395

Query: 390 LVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTR 449
           L+GEPP+ELP P K P  EA +MI+ VI  QSKYW CF+ R GN G NFK+ +T +L T+
Sbjct: 396 LIGEPPEELPDPSKNPKLEAIEMIDKVIHVQSKYWKCFR-RLGNSGCNFKEPVTESLITK 454

Query: 450 NFPLQNAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIW 509
           NFPLQ AIR+ Q  QL  ++ FV LP+  L LP +T+LC+  +    T+++ VHDTPEIW
Sbjct: 455 NFPLQKAIRQEQFHQLEKEYGFVTLPVPKLELPEDTVLCSPDVFQESTVIIFVHDTPEIW 514

Query: 510 SERDTQTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEIL 569
           ++RD  TG+IDPS+SI VD+ L  I W++ R+YG+ID+NIPQ+LFE  NY  + +SQE+L
Sbjct: 515 AKRDVITGMIDPSTSITVDSPLDFIKWSLARKYGVIDVNIPQSLFEQDNYSAMITSQEVL 574

Query: 570 IYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPL 629
           IYLWDN++K+F +L KVAF+G+GDAY GIVHLLGHRDTRSVVK  I+F+ +K LK +VPL
Sbjct: 575 IYLWDNFVKYFPSLSKVAFVGVGDAYSGIVHLLGHRDTRSVVKAVINFVGRKQLKPLVPL 634

Query: 630 IDETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEA 689
           +DE+LGDWYFKNSLVF+   + CW    NENKK R+K+GRVL+ + DG+ N  +ERF+EA
Sbjct: 635 VDESLGDWYFKNSLVFSDRNNPCW--VDNENKKPRRKFGRVLRCESDGINNNMEERFDEA 692

Query: 690 TDFILDSFEEWSESE 704
           TDFILDSFEEWS+SE
Sbjct: 693 TDFILDSFEEWSDSE 707

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1039 bits (2686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/667 (70%), Positives = 564/667 (84%), Gaps = 2/667 (0%)

Query: 38  VIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENG 97
           VIVP   P + Y+ LKT +CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENG
Sbjct: 50  VIVPACAPNLHYTPLKTALCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENG 109

Query: 98  LIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKETEGG 157
           LI DPTLSG D IGDLM+K+PVREA +EEIL+VHS+++L+F+ ++ +++RE LLKETE G
Sbjct: 110 LINDPTLSGIDEIGDLMLKIPVREATDEEILEVHSKENLEFVERSSRMKREELLKETEKG 169

Query: 158 DSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNV 217
           DSVYFNNDSY+SAKLSCGG I+ACKAVVEGRVKN++AVVRPPGHHAEPE  GGFCLFSNV
Sbjct: 170 DSVYFNNDSYVSAKLSCGGVIDACKAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNV 229

Query: 218 AVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIH 277
           AVAA N+LK YPESVR+I+I+DWDIHHGNGTQKAFY+D RVLY+SLHR+++GKYYPGTI+
Sbjct: 230 AVAAQNILKQYPESVRRILILDWDIHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTIN 289

Query: 278 GNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAAD 337
           G YDQTGEGKGEGFNCNITWP GGVGDAEYM AFEQ++MPM REF+PDLV+ISSGFDAAD
Sbjct: 290 GRYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAAD 349

Query: 338 GDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDE 397
           GDTIGQCHVTP+CYG MTHML SLA+GNLCV LEGGYNLD+IA SAL V KVL+GEPPDE
Sbjct: 350 GDTIGQCHVTPSCYGQMTHMLKSLARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDE 409

Query: 398 LPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAI 457
           LP P K P  EA +MI+TVI TQSKYW CF+ + GN G NF + +T T+ +++FPLQ AI
Sbjct: 410 LPDPTKDPKLEAIEMIDTVIHTQSKYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAI 469

Query: 458 REYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTG 517
           R+ Q  QLS ++ FV LPI  L +P +++LC+  +    T+V+IVHDTPEIW++RD  TG
Sbjct: 470 RQEQFRQLSKEYGFVTLPISKLEIPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITG 529

Query: 518 IIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYL 577
           +IDPS+SIIVD+ L    W M+R+YG+ID+NIPQ+LFE  NY  + +SQE+L+Y+WDNY+
Sbjct: 530 VIDPSTSIIVDSPLDFTKWCMNRKYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYI 589

Query: 578 KFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDW 637
           K+F +L KVAF+G GDAY GIVHLLGHRDTR+ VK  +SF+ +K LK +VPL+DE+L DW
Sbjct: 590 KYFPSLAKVAFVGFGDAYAGIVHLLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDW 649

Query: 638 YFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSF 697
           YFKNSL+FT   H CW    NE+KK RKK+GRVL+ D DG+ +  +ERFEEATDFILD F
Sbjct: 650 YFKNSLIFTDKNHPCWAD--NESKKPRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLF 707

Query: 698 EEWSESE 704
           EEWS+SE
Sbjct: 708 EEWSDSE 714

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score = 1022 bits (2642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/674 (69%), Positives = 556/674 (82%), Gaps = 6/674 (0%)

Query: 35  QRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILA 94
           +R VIVP  KP++ Y  LKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILA
Sbjct: 31  KRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 90

Query: 95  ENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKET 154
           ENGLI D  LSG D IGD+M+K+PVREA  +EIL+VHSR+HL+F+  T  + RE LLKET
Sbjct: 91  ENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET 150

Query: 155 EGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLF 214
           E GDSVYFNNDSY+SAKLSCGGAIEACKAVVEG+VKN++AVVRPPGHH+EPE +GGFCLF
Sbjct: 151 EKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLF 210

Query: 215 SNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPG 274
           SNVAVAA N+LK+YPESVRKIMI+DWDIHHGNGTQKAFY D+RVLYVSLHR++ GKYYPG
Sbjct: 211 SNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPG 270

Query: 275 TIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFD 334
           T+ G YDQ GEGKGEGFNCNITWPTGGVGDAEYMWAFEQ++MPMGREF+PDLV+ISSGFD
Sbjct: 271 TVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFD 330

Query: 335 AADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEP 394
           AADGD IGQCHVTP+CYGHMTHML SLA+GNL VVLEGGYNLDSIA SAL V K L+GEP
Sbjct: 331 AADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKTLIGEP 390

Query: 395 PDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQ 454
           PDELP P K P PEA +MI  VI+ QSKYW CFK RHGN  INF +  + TL T+ FPLQ
Sbjct: 391 PDELPDPLKDPKPEALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVASDTLATKTFPLQ 450

Query: 455 NAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSERDT 514
            AIR+ Q   L  +++FV+ P  +L LP + +LC+  I  +ET+++IVHDTP+IW E+D 
Sbjct: 451 TAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDI 510

Query: 515 QTGIIDPSSSIIVDNALKMINWAMDRRYGIIDINIPQTLF----EHANYPGVASSQEILI 570
            +  +DP SSII+D+ L  + WA +R+YGIID+NIPQ+L        NY  + ++QEIL+
Sbjct: 511 ISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILL 570

Query: 571 YLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLI 630
           +LWDN++KF   + K+AFIG+GD+  G+VHLLGHRDT+  VK  I+F+  K LK +VPL+
Sbjct: 571 FLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLV 630

Query: 631 DETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEAT 690
           DE+L DWYFKNSLVF++ TH CWG    ENKK RKKYGRVL+ D DG+ +  +ERF+EAT
Sbjct: 631 DESLSDWYFKNSLVFSNRTHPCWGD--KENKKPRKKYGRVLRCDTDGLNSTIEERFDEAT 688

Query: 691 DFILDSFEEWSESE 704
           DFILDSFEEWS+SE
Sbjct: 689 DFILDSFEEWSDSE 702

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score =  990 bits (2559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/656 (67%), Positives = 547/656 (83%), Gaps = 2/656 (0%)

Query: 47  IRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSG 106
           + Y+ LKTG+CYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYR+YKILAENGLI+DP LSG
Sbjct: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64

Query: 107 ADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDS 166
            D IGDLM K+PVREA  EEIL+VH ++ L+++ +T+ L R+ LL +TE GDSVYFNNDS
Sbjct: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124

Query: 167 YLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLK 226
           Y SAKLSCGGAIEACKA+V+G+VKNS+A+VRPPGHH+EPE+AGGFCLFSNVAVA  N+LK
Sbjct: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184

Query: 227 SYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEG 286
           +YP+ V+K+MIVDWDIHHGNGTQKAFY+DDRVLYVSLHR++LGKYYPGTIHG YDQ GEG
Sbjct: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244

Query: 287 KGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHV 346
           KGEGFNCNI W  GG+GDAEY+WAFEQ++MPMGREF PDLV++SSGFDAADGDTIG+CHV
Sbjct: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304

Query: 347 TPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPT 406
           TP+CYGHMTHML SLA G LCVVLEGGYNLD+IA+SAL V KVL+GEPPDELPAP K P 
Sbjct: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364

Query: 407 PEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLS 466
           PEA +MI+ VI  +SKYW CFK +  N    +K  I+ +   + FP+Q+AIR  Q+  L+
Sbjct: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424

Query: 467 SQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSII 526
           + +N V LP+++ NLP +T++C++ I  S   ++ VHDTPEIWS+RD   G+ID S+S+ 
Sbjct: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484

Query: 527 VDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKV 586
           +D +L+  +WA+DR YGIID+NIPQTL+E  NY    ++QE+LI LWDN LK+F N+ K+
Sbjct: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544

Query: 587 AFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFT 646
           A+IG+G+AY G+VHLLGHRDTRSVVK  I F+ KKPLK +VPL++E+L DWYFK SL+F 
Sbjct: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604

Query: 647 SSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSE 702
              HSCWG   N++KK RK+YGRVL+ D DG+ ++ +ERFEEATDFI+DS +EW+E
Sbjct: 605 DKNHSCWGE--NDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score =  973 bits (2516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/701 (64%), Positives = 559/701 (79%), Gaps = 9/701 (1%)

Query: 4   KKPAEEPLERPSIKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMR 63
           K+  ++  E PS+  I +EG    +  K    RPVIVP  KP + Y+ LKTGICYDVRMR
Sbjct: 8   KRKLKDESEFPSVS-IGDEGKVIQVLPK----RPVIVPTQKPNLHYTPLKTGICYDVRMR 62

Query: 64  YHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVREAE 123
           YHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DP+L+G   IGDLM+K+PVREA 
Sbjct: 63  YHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREAT 122

Query: 124 EEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKA 183
           +EEIL VH+ +H+ F+  TE++ RE LL +TE GDSVY NNDSY+SA+LSCGGAIEACKA
Sbjct: 123 KEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKA 182

Query: 184 VVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIH 243
           VVEGRVKN++A+VRPPGHHAEP+ AGGFCLFSNV+VAA ++LK+YPESVRKI+IVDWDIH
Sbjct: 183 VVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIH 242

Query: 244 HGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVG 303
           HGNGTQKAFY+DD VLY+SLHR++LGK+YPG   GNYD+ G+GKG+GFNCNITWP  GVG
Sbjct: 243 HGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVG 302

Query: 304 DAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAK 363
           D EY+WAFEQ+++PM REF PDLV++SSGFDAA GDTIGQCHVTP CYG+MTHML SLA+
Sbjct: 303 DVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLAR 362

Query: 364 GNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKY 423
           GNLCVVLEGGYNLDSI+ SAL V K+L+GEPPDE+P   + P P   +MI  VIR QSKY
Sbjct: 363 GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKY 422

Query: 424 WSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQLPILDLNLPA 483
           W CF+ + GN G  +++AI S +  + FPLQ+AIR  Q+S     F  + L + +LNLP 
Sbjct: 423 WKCFRRKFGNFGGEYENAIESQI-PKMFPLQDAIRNAQLSHYYDDFGMISLSLPNLNLPK 481

Query: 484 NTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDRRYG 543
           N+++C+S    +++L V++HDTPE+W  RD  TGIIDPS+SII D++LK INWA++R   
Sbjct: 482 NSIICSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETA 541

Query: 544 IIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLG 603
           +IDINIP++ FE  NY     SQ+++I LWDN+ K+ ++L+K+ FIGIG+A  GIVHLLG
Sbjct: 542 VIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLG 601

Query: 604 HRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANENKKL 663
            RDTR+V K AI+F+    LK +VP +DE+LGDWYFKNSLVFT   H CW   +  +KK 
Sbjct: 602 KRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCW---SENDKKP 658

Query: 664 RKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704
           RKKYGRVL+ D DG+ NI +ERFEEATDFILD+F+EWS++E
Sbjct: 659 RKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/456 (73%), Positives = 389/456 (85%), Gaps = 2/456 (0%)

Query: 35  QRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILA 94
           ++ +IVP   PKI Y  LKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILA
Sbjct: 40  KKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99

Query: 95  ENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKET 154
           ENGLI DPTLSG D+IGDLM+K+P+REA   EIL+VHS +H  ++ +T    RE LLKET
Sbjct: 100 ENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET 159

Query: 155 EGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLF 214
           E GDSVYFNNDS+ SAKLSCGGAIEACKAVVEGRVKN++AVVRPPGHH+EPE AGGFCLF
Sbjct: 160 ENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLF 219

Query: 215 SNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPG 274
           SNVAVA  N+LK+YPESVRK++I+DWDIHHGNGTQKAFY+DD VLY+SLHR++LGKYYPG
Sbjct: 220 SNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPG 279

Query: 275 TIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFD 334
           TI G YDQTGEGKGEGFNCNITWP G VGDAEYMWAFEQV+MPM REF+PDLV+ISSGFD
Sbjct: 280 TIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFD 339

Query: 335 AADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEP 394
           AADGDTIGQCHV+P+CYGHMTHML SLA+GNLCVVLEGGYNLD+IA+SAL V K+L+GEP
Sbjct: 340 AADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGEP 399

Query: 395 PDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQ 454
           PDELP P K P PE  +MI+ +IR QSKYW CF+ RHGN G NFK++I  +L ++NFPLQ
Sbjct: 400 PDELPDPLKDPKPEVIEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQ 459

Query: 455 NAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTS 490
            AIR +Q  +L  + NF+ LPI   N   N M  ++
Sbjct: 460 TAIRNFQSKKLFDELNFLTLPI--KNFQKNNMSTST 493

 Score =  310 bits (794), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 140/224 (62%), Positives = 177/224 (79%), Gaps = 2/224 (0%)

Query: 481 LPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDR 540
           L  NT+LC+  I  S+TLVV+VHD+P++W++RD  TG++D SS+II+D+ L  I W++DR
Sbjct: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633

Query: 541 RYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVH 600
            YG+IDINIPQTLFE  NY  + ++QE L+  WDNYLK+F  ++K+ FIG GDA+ GIVH
Sbjct: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693

Query: 601 LLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANEN 660
           LLGHRDTRSVVK  I+FL KKPLK +VPL+DETL DWYFKNSLVFT   H  W    NEN
Sbjct: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWAD--NEN 751

Query: 661 KKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704
           KK RKK+GRVL++  DG+ N+ +ERF+EATDFILDSFEEWS+ E
Sbjct: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  509 bits (1311), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 231/316 (73%), Positives = 267/316 (84%)

Query: 17  KEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYI 76
           KE    G +     K   +R VIVP  +PK+ Y+ LKTG+CYDVRMRYHAKIFTS FEYI
Sbjct: 34  KETIMNGNSKNDHFKKMPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYI 93

Query: 77  DPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHL 136
           DPHPEDPRR+YR+YKILAENGLI+D  LSG D IGD+M+K+PVR A EEEIL VH+R+HL
Sbjct: 94  DPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHL 153

Query: 137 DFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVV 196
           DFI   E   RE L+K TE  DSVY+NNDSY SAKLSCGG IEAC+AVVEGRVKNS+A+V
Sbjct: 154 DFIENIESQSREELIKLTEKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIV 213

Query: 197 RPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDD 256
           RPPGHHAEP+ AGGFCLFSNV+VAA ++L++YPESVRKI+I+DWDIHHGNGTQKAFY+D+
Sbjct: 214 RPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDE 273

Query: 257 RVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIM 316
            VLY+SLHRY+   +YPGTIHG YDQ GEGKGEGFNCNITWP GGVGDAEYMWAFE V+M
Sbjct: 274 NVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVM 333

Query: 317 PMGREFEPDLVLISSG 332
           P+GREF PDLV++SSG
Sbjct: 334 PLGREFRPDLVIVSSG 349

 Score =  257 bits (657), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 162/219 (73%), Gaps = 2/219 (0%)

Query: 486 MLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDRRYGII 545
           +L +  I  +ETLV++VHDTPE+W +RD  TG++DPS+S+++D ++K I WA DR Y I+
Sbjct: 360 VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSIL 419

Query: 546 DINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLGHR 605
           DINIP++  E   +    ++ EI++ LWDN+L++   L K+ FIGIG++Y GIVHL+G R
Sbjct: 420 DINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGER 479

Query: 606 DTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANENKKLRK 665
           D R + K  I+F+   PLK +    DET+ DWYFKNSLVFT+ +H+CW  +  E K+ RK
Sbjct: 480 DLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKES--EEKRPRK 537

Query: 666 KYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704
           K+GRVLK+D DG+ +I +ERF+EATDFILD+FEEWS+ E
Sbjct: 538 KFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  147 bits (371), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 105/367 (28%), Positives = 178/367 (48%), Gaps = 35/367 (9%)

Query: 44  KPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPT 103
           K K    + + G  Y  R+ YH     S + Y   HP  P R      +++  GL     
Sbjct: 11  KTKDSQPMFEFGSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRFMLTDHLVSSYGL----- 65

Query: 104 LSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTE-----QLERESLLKETEGGD 158
                   ++M     REA +EE+LQ HS  +++F+S+       ++ R +  K   G D
Sbjct: 66  -------HNIMDLYETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDD 118

Query: 159 SVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNV 217
              F N  Y   KL  G +++A + ++    ++ IA+    G HHA+     GFC  +++
Sbjct: 119 CPIFQN-IYEYCKLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDI 175

Query: 218 AVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIH 277
            +A  N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  VS H+Y  G+++PGT  
Sbjct: 176 VLATLNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT-- 228

Query: 278 GNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAAD 337
           GNYD+ G  +G+ F  N+     G+ D  Y+  F+ V+ P+   F+P  ++   G D+  
Sbjct: 229 GNYDEIGCAEGKHFAMNVPL-NDGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLG 287

Query: 338 GDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGY---NLDSIAKSALGVCK--VLVG 392
            D +G  ++    +G     + S     + VV  GGY   N+  +     G+    +L  
Sbjct: 288 HDRLGCFNLNIKAHGECVKFIRSFGIP-MVVVGGGGYTPRNVSRLYAYETGILNNVLLQS 346

Query: 393 EPPDELP 399
           E P+++P
Sbjct: 347 ELPEDMP 353

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 103/356 (28%), Positives = 175/356 (49%), Gaps = 35/356 (9%)

Query: 55  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLM 114
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL +            +M
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRLMLTDHLVSSYGLHK------------IM 70

Query: 115 VKVPVREAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLS 169
                REA +EE+ Q HS  +LDF+ +       ++ R +L K   G D   F N  Y  
Sbjct: 71  DLYETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFEN-IYDY 129

Query: 170 AKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSY 228
           + L  G +++A + ++ G  ++ IA+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 130 STLYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYH 187

Query: 229 PESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKG 288
           P    +++ +D D+HHG+G Q+AFY  DRV  +S H+Y  G+++PGT  GNYD+ G   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCSGG 240

Query: 289 EGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTP 348
           + F  N+     G+ D  Y+  F+ +I P+   ++P +++   G D+   D +G  ++  
Sbjct: 241 KHFAMNVPL-NDGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 349 ACYGHMTHMLLSLAKGNLCVVLEGGY---NLDSIAKSALGVCK--VLVGEPPDELP 399
             +G     + S     + VV  GGY   N+  +     G+    +L  E P+ELP
Sbjct: 300 KAHGECVKFVSSFGIP-MLVVGGGGYTPRNVSRLWAYETGILNNVLLPKELPEELP 354

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  141 bits (355), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 95/337 (28%), Positives = 168/337 (49%), Gaps = 30/337 (8%)

Query: 51  LLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSI 110
           L + G  Y  R+ YH     S + Y   HP  P R+     +++  GL +          
Sbjct: 17  LFEFGASYTPRVSYHYNSRVSQYHYGVRHPMKPFRLMLTDHLVSRYGLHK---------- 66

Query: 111 GDLMVKVPVREAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNND 165
             +M     R A +EE+L  H++ ++DF+S        +L R SL K   G D   F   
Sbjct: 67  --VMDLYETRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEKFNIGDDCPIFQG- 123

Query: 166 SYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANM 224
            +  + L  G +++A + ++ G  ++ IA+    G HHA+     GFC  +++ +A  N+
Sbjct: 124 LFEYSMLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNL 181

Query: 225 LKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTG 284
           L+ +P    +++ +D D+HHG+G Q+AFY  DRV  VS H+Y  G+++PGT  G+ D+ G
Sbjct: 182 LRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIG 234

Query: 285 EGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQC 344
             +G+ F+ N+     G+ D  Y+  F+ +I P+   ++P +++   G D+   D +G  
Sbjct: 235 CSRGKHFSLNVPL-NDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCF 293

Query: 345 HVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAK 381
           ++    +G     + S     LCV   GGY   ++++
Sbjct: 294 NLNIRAHGECVKFVKSFGIPMLCVG-GGGYTPRNVSR 329

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  139 bits (351), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 105/368 (28%), Positives = 178/368 (48%), Gaps = 35/368 (9%)

Query: 43  TKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDP 102
            K K    L + G  Y  R+ YH     S + Y   HP  P R+     +++  GL +  
Sbjct: 9   VKTKSEQPLFEFGSAYCPRVSYHFNPKVSNYHYGVRHPMKPFRLLLTDHLVSSYGLHK-- 66

Query: 103 TLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGG 157
                     +M     R A  EEI + H++ ++DF+ +       ++ R +L K   G 
Sbjct: 67  ----------IMDLYETRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGD 116

Query: 158 DSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSN 216
           D   F N  +   KL  G +++A + ++    ++ IA+    G HHA+     GFC  ++
Sbjct: 117 DCPIFQN-LFNYCKLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVND 173

Query: 217 VAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTI 276
           + +A  N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  VS H+Y  G+++PGT 
Sbjct: 174 IVLAILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT- 227

Query: 277 HGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAA 336
            GN+D+ G   G+ F  N+     G+ D  Y+  F+ ++ P+   ++P +++   G D+ 
Sbjct: 228 -GNHDEVGCANGKHFAMNVPL-EDGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSL 285

Query: 337 DGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGY---NLDSIAKSALGVCK--VLV 391
             D IG  ++T   +G     + S     L VV  GGY   N+  +     GV    +L 
Sbjct: 286 GHDRIGCFNLTIKGHGECVKFIRSFGIPML-VVGGGGYTPRNVSRLWAYETGVLNNVLLS 344

Query: 392 GEPPDELP 399
            E P+E+P
Sbjct: 345 KELPEEIP 352

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  139 bits (351), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 101/367 (27%), Positives = 180/367 (49%), Gaps = 38/367 (10%)

Query: 44  KPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPT 103
           +P+  Y     G  Y  R+ YH     S + Y   HP  P R+     +++  GL +   
Sbjct: 15  QPQFEYEF---GSSYTPRVSYHFNPKVSNYHYGVRHPMKPFRLMLTDHLVSSYGLHK--- 68

Query: 104 LSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGD 158
                    +M     REA  EE+ Q HS+ +++F+S+       ++ R +L K   G D
Sbjct: 69  ---------IMDLYETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIGDD 119

Query: 159 SVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNV 217
              F N  Y  + L  G +++A + ++    ++ IA+    G HHA+     GFC  +++
Sbjct: 120 CPIFQN-IYDYSTLYTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVNDI 176

Query: 218 AVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIH 277
            ++  N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  
Sbjct: 177 VLSILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT-- 229

Query: 278 GNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAAD 337
           G++D+ G  KG+ F  N+     G+ D  Y+  F+ +I P+   ++P +++   G D+  
Sbjct: 230 GDFDEIGCAKGKHFAMNVPL-EDGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSLG 288

Query: 338 GDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGY---NLDSIAKSALGVCK--VLVG 392
            D +G  ++    +G     + S     + VV  GGY   N+  +     GV    +L  
Sbjct: 289 HDRLGCFNLNIKAHGECVKFVKSFGIP-MLVVGGGGYTPRNVSRLWTYETGVLNNVLLPS 347

Query: 393 EPPDELP 399
           E P+E+P
Sbjct: 348 EIPEEIP 354

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  139 bits (349), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 116/429 (27%), Positives = 198/429 (46%), Gaps = 42/429 (9%)

Query: 43  TKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDP 102
           +K K    L + G  Y  R+ YH     S++ Y   HP  P R+           ++ D 
Sbjct: 9   SKTKEFQPLYEFGSNYAPRVSYHINPEVSHYHYGVRHPMKPFRL-----------MLTDH 57

Query: 103 TLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGG 157
            +SG   +  +M     R+A  EE+ + HS  +++F+S+       +L R +L K   G 
Sbjct: 58  LVSGY-GLHKIMDLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGD 116

Query: 158 DSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSN 216
           D   F N  +  + L  G +++A + ++    ++ IA+    G HHA+     GFC  ++
Sbjct: 117 DCPIFPN-IFQYSSLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYIND 173

Query: 217 VAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTI 276
           + +A  N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  +S H+Y  G+++PGT 
Sbjct: 174 IVLAILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT- 227

Query: 277 HGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAA 336
            G  D+TG   G+ F  N+     G+ D  Y+  F+ +I P+   F+P ++L   G D+ 
Sbjct: 228 -GKNDETGCADGKHFAMNVPL-EDGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSL 285

Query: 337 DGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGY---NLDSIAKSALGVCK--VLV 391
             D +G  ++    +G     + S     + VV  GGY   N+  +     G+    +L 
Sbjct: 286 GHDRLGCFNLNIKAHGECVKFVRSFGIP-MLVVGGGGYTPRNVSRLWTYETGILNNVLLP 344

Query: 392 GEPPDELP-----APKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTL 446
            E PD LP      P     P    + E   R   K+    + R   +    + A +  +
Sbjct: 345 EELPDNLPFKESFGPDYSLYPVLDNLYEN--RNSKKFLEDIRIRCLENIRFLQGAPSVRM 402

Query: 447 DTRNFPLQN 455
           D  N P Q+
Sbjct: 403 DAENIPTQD 411

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  138 bits (348), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 100/352 (28%), Positives = 175/352 (49%), Gaps = 37/352 (10%)

Query: 58  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKV 117
           Y  R+ YH     S + Y   HP  P R+     +++  GL +            +M   
Sbjct: 28  YTPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDLY 75

Query: 118 PVREAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKL 172
             R A  EE++Q HS  +LDF+S+       ++ R +L K   G D   F N  Y  + L
Sbjct: 76  ETRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQN-LYDYSTL 134

Query: 173 SCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPES 231
             G +++A + ++    ++ IA+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 135 YTGASLDATRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYINDIVLSIVNLLRYHP-- 190

Query: 232 VRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGF 291
             +++ +D D+HHG+G Q+AFY  DRV  +S H++  G+++PGT  G+YD+TG  KG+ F
Sbjct: 191 --RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDYDETGCAKGKHF 245

Query: 292 NCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACY 351
             N+     G+ D  Y+  F+ ++ P+   ++P +++   G D+   D +G  ++    +
Sbjct: 246 AMNVPL-EDGIDDDSYINLFKSIMDPLITSYKPTVIVQQCGADSLGHDRLGCFNLNIKGH 304

Query: 352 GHMTHMLLSLAKGNLCVVLEGGY---NLDSIAKSALGVC-KVLVGEPPDELP 399
           G     + S     + VV  GGY   N+  +     G+   VL+   P+ELP
Sbjct: 305 GECVKFIKSFGIP-MLVVGGGGYTPRNVSRLWTYETGILNNVLL---PNELP 352

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  138 bits (347), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 101/367 (27%), Positives = 181/367 (49%), Gaps = 38/367 (10%)

Query: 43  TKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDP 102
            +P+  Y     G  Y  R+ YH     S + +   HP  P R+           ++ D 
Sbjct: 14  NQPQFNYEF---GSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRL-----------MLTDH 59

Query: 103 TLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTE-----QLERESLLKETEGG 157
            +SG   +  +M     R+A ++E+L+ H+  +++F+ +       ++ R +L K   G 
Sbjct: 60  LVSGY-GLHKIMDLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGD 118

Query: 158 DSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSN 216
           D   F+N  Y  + L  G +++A + ++ G  ++ IA+    G HHA+     GFC  ++
Sbjct: 119 DCPIFHN-LYEYSSLYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYIND 175

Query: 217 VAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTI 276
           + ++  N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  VS H+Y  G+++PGT 
Sbjct: 176 IVLSILNLLRFHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT- 229

Query: 277 HGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAA 336
            GNYD+TG   G+ F  N+     G+ D  Y+  F+ +I P+   + P +++   G D+ 
Sbjct: 230 -GNYDETGCSNGKHFALNVPL-KDGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSL 287

Query: 337 DGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGY---NLDSIAKSALGVCKVLVGE 393
             D +G  ++    +G     + S     L VV  GGY   N+  +     G+   ++  
Sbjct: 288 GHDRLGCFNLNIKAHGECVKFVKSFGIPML-VVGGGGYTPKNVSRLWTYETGILNNVLLS 346

Query: 394 PPDELPA 400
           P  ELP+
Sbjct: 347 P--ELPS 351

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  137 bits (345), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 101/367 (27%), Positives = 177/367 (48%), Gaps = 35/367 (9%)

Query: 44  KPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPT 103
           K K    + + G  Y  R+ YH     S + Y   HP  P R+     +++  GL +   
Sbjct: 14  KTKNAQPMFEFGSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGLHK--- 70

Query: 104 LSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGD 158
                    +M     R A ++E+L  HS  ++ F+ +       ++ R +L K   G D
Sbjct: 71  ---------IMDLYETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDD 121

Query: 159 SVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNV 217
              F N  Y  + L  G +++A + ++    ++ IA+    G HHA+     GFC  +++
Sbjct: 122 CPIFQN-LYDYSALYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDI 178

Query: 218 AVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIH 277
            +A  N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  +S H+Y  G+++PGT  
Sbjct: 179 VLAILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT-- 231

Query: 278 GNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAAD 337
           GNYD+ G  +G+ F  N+     G+ D  Y+  F+ +I P+   ++P +++   G D+  
Sbjct: 232 GNYDEIGCAQGKHFAMNVPL-EDGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLG 290

Query: 338 GDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGY---NLDSIAKSALGVCK--VLVG 392
            D +G  ++    +G     + S     L VV  GGY   N+  +     GV    +L  
Sbjct: 291 HDRLGCFNLNIKAHGECVKFIRSFGIPML-VVGGGGYTPRNVSRLWTYETGVLNNVLLPA 349

Query: 393 EPPDELP 399
           E P+++P
Sbjct: 350 ELPEDIP 356

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  136 bits (342), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 99/363 (27%), Positives = 176/363 (48%), Gaps = 36/363 (9%)

Query: 44  KPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPT 103
           KP+  +     G  Y+  + YH     S F Y   HP  P R+     +++  GL +   
Sbjct: 15  KPRFEF-----GAPYEPNVSYHFNSDVSQFHYGVRHPMKPFRLMLTDHLVSSYGLHK--- 66

Query: 104 LSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTE-----QLERESLLKETEGGD 158
                    +M     R A  EE+ + H+  +++F+++       +L R +L K   G D
Sbjct: 67  ---------IMDLYETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDD 117

Query: 159 SVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNV 217
              F    Y  + L  G +++A + ++ G  ++ IA+    G HHA+     GFC  +++
Sbjct: 118 CPIFQG-LYQYSTLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDI 174

Query: 218 AVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIH 277
            ++  N+L+ +P    +++ +D D+HHG+G Q+AFY  DRV  VS H+Y  G+++PGT  
Sbjct: 175 VLSVLNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT-- 227

Query: 278 GNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAAD 337
           GN D+TG  +G+ F  N+     G+ D  Y+  F+ +I P+   F+P +++   G D+  
Sbjct: 228 GNLDETGCSRGKHFALNVPL-EDGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLG 286

Query: 338 GDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVG-EPPD 396
            D +G  ++    +G     + S     L V+  GGY   ++++       +L G   P 
Sbjct: 287 HDRLGCFNLNVKAHGECVRFVKSFGIPML-VLGGGGYTPRNVSRLWTYETALLNGVSVPQ 345

Query: 397 ELP 399
           E+P
Sbjct: 346 EIP 348

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  134 bits (338), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 95/345 (27%), Positives = 170/345 (49%), Gaps = 30/345 (8%)

Query: 43  TKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDP 102
            K K  Y   + G  Y   + YH     S + Y   HP  P R+     +++  GL +  
Sbjct: 8   VKTKETYLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRLMLTDHLVSSYGLHK-- 65

Query: 103 TLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTE-----QLERESLLKETEGG 157
                     +M     REA  +E+L+ HS  +++F+S+       ++ R SL K   G 
Sbjct: 66  ----------IMDLYETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGD 115

Query: 158 DSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSN 216
           D   F    +  + L  G +++A + ++ G  ++ IA+    G HHA+     GFC  ++
Sbjct: 116 DCPIFQG-IFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVND 172

Query: 217 VAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTI 276
           + +A  N+L+ +P    +++ VD D+HHG+G Q+AFY  DRV  VS H+Y  G+++PGT 
Sbjct: 173 IVLAILNLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT- 226

Query: 277 HGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAA 336
            G++D+ G  +G+ F  N+     G+ D  Y+  F+ ++ P+   ++P +++   G D+ 
Sbjct: 227 -GDFDEIGCSRGKHFALNVPL-DDGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSL 284

Query: 337 DGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAK 381
             D +G  ++    +G     + S     L VV  GGY   ++++
Sbjct: 285 GHDRLGCFNLNIRAHGECVKFVKSFGIPML-VVGGGGYTPRNVSR 328

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  134 bits (336), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 164/333 (49%), Gaps = 30/333 (9%)

Query: 55  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLM 114
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL +            +M
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKPFRLMLTDHLVSAYGLHK------------VM 71

Query: 115 VKVPVREAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLS 169
                R A ++E+ + HS  +++F+++       +L R SL K   G D   F    +  
Sbjct: 72  DLYETRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQG-MFDY 130

Query: 170 AKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSY 228
           A L  G +++A + ++ G  ++ IA+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 131 AALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYH 188

Query: 229 PESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKG 288
           P    +++ +D D+HHG+G Q+AFY  DRV  VS H+Y  G+++PGT  G+ D+ G  +G
Sbjct: 189 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRG 241

Query: 289 EGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTP 348
           + F  N+     G+ D  Y+  F+ +I P+   F P +++   G D+   D +G  ++  
Sbjct: 242 KHFALNVPL-QDGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNI 300

Query: 349 ACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAK 381
             +G     + S     L VV  GGY   ++++
Sbjct: 301 KAHGECVRFVKSFGVPML-VVGGGGYTPRNVSR 332

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  133 bits (335), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 95/345 (27%), Positives = 166/345 (48%), Gaps = 30/345 (8%)

Query: 43  TKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDP 102
            K K    L +    Y  R+ YH     S++ Y   HP  P R+     +++  GL +  
Sbjct: 9   VKTKENEPLFEFNSAYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK-- 66

Query: 103 TLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGG 157
                     +M     R A  +E+LQ HS  +++F+S+       +L R +L     G 
Sbjct: 67  ----------IMDLYETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGD 116

Query: 158 DSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSN 216
           D   F N  Y    L  G +++A + ++    ++ IA+    G HHA+     GFC  ++
Sbjct: 117 DCPIFQN-LYDYTTLYTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVND 173

Query: 217 VAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTI 276
           + ++  N+L+ +P    +I+ +D D+HHG+G Q+AFY  DRV  +S H+Y  G+++PGT 
Sbjct: 174 IVLSILNLLRYHP----RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT- 227

Query: 277 HGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAA 336
            G+  + G  KG+ F  N+     G+ D  Y+  F+ ++ P+   F+P L++   G D+ 
Sbjct: 228 -GDLTEIGCDKGKHFALNVPL-EDGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSL 285

Query: 337 DGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAK 381
             D +G  ++    +G     + S     L VV  GGY   ++++
Sbjct: 286 GHDRLGCFNLNIKAHGECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  133 bits (335), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 94/336 (27%), Positives = 166/336 (49%), Gaps = 30/336 (8%)

Query: 52  LKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIG 111
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL +           
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKPFRLMLTDHLVSSYGLHK----------- 65

Query: 112 DLMVKVPVREAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDS 166
            +M     R A  EE+   HS +++DF+ +       +L R +L K   G D   F N  
Sbjct: 66  -IMDLYETRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPN-L 123

Query: 167 YLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANML 225
           Y  + L  G +++A + ++    ++ IA+    G HHA+     GFC  +++ +A  N+L
Sbjct: 124 YDYSSLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLL 181

Query: 226 KSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGE 285
           + +P    +++ +D D+HHG+G Q+AFY  DRV  VS H+Y  G+++PGT  GN+D+ G 
Sbjct: 182 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGC 234

Query: 286 GKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCH 345
            +G+ F  N+     G+ D  Y+  F+ +I P+   ++P +++   G D+   D +G  +
Sbjct: 235 ARGKHFALNVPL-QDGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFN 293

Query: 346 VTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAK 381
           +    +G   + + S     L VV  GGY   ++++
Sbjct: 294 LNVKAHGECVNFVRSFGLPML-VVGGGGYTPRNVSR 328

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 163/333 (48%), Gaps = 30/333 (9%)

Query: 55  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLM 114
           G  +   + YH     S F Y   HP  P R+     +++  GL +            +M
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IM 68

Query: 115 VKVPVREAEEEEILQVHSRQHLDFISQTE-----QLERESLLKETEGGDSVYFNNDSYLS 169
                R A  EE+ + HS  +++F+++       +L R SL K   G D   F    Y  
Sbjct: 69  DLYETRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQG-LYQY 127

Query: 170 AKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSY 228
           + L  G +++A + ++ G  ++ IA+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 128 STLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYH 185

Query: 229 PESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKG 288
           P    +++ +D D+HHG+G Q+AFY  DRV  VS H+Y  G+++PGT  GN D+ G  +G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCSRG 238

Query: 289 EGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTP 348
           + F  N+     G+ D  Y+  F+ +I P+   F+P +++   G D+   D +G  ++  
Sbjct: 239 KHFALNVPL-DDGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNV 297

Query: 349 ACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAK 381
             +G     + S     L VV  GGY   ++++
Sbjct: 298 KAHGECVKYVKSFGLPML-VVGGGGYTPRNVSR 329

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  132 bits (332), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 92/331 (27%), Positives = 162/331 (48%), Gaps = 30/331 (9%)

Query: 57  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVK 116
            Y  R+ YH     S++ Y   HP  P R+     +++  GL +            +M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDL 70

Query: 117 VPVREAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAK 171
              R A  +E+LQ HS  +++F+S+       +L R +L     G D   F N  Y    
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQN-LYDYTT 129

Query: 172 LSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPE 230
           L  G +++A + ++    ++ IA+    G HHA+     GFC  +++ ++  N+L+ +P 
Sbjct: 130 LYTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP- 186

Query: 231 SVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEG 290
              +I+ +D D+HHG+G Q+AFY  DRV  +S H+Y  G+++PGT  G+  + G  KG+ 
Sbjct: 187 ---RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKH 240

Query: 291 FNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPAC 350
           F  N+     G+ D  Y+  F+ ++ P+   F+P L++   G D+   D +G  ++    
Sbjct: 241 FALNVPL-EDGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKA 299

Query: 351 YGHMTHMLLSLAKGNLCVVLEGGYNLDSIAK 381
           +G     + S     L VV  GGY   ++++
Sbjct: 300 HGECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  132 bits (332), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 94/345 (27%), Positives = 167/345 (48%), Gaps = 30/345 (8%)

Query: 43  TKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDP 102
            K K   S  +    Y  R+ YH     S++ Y   HP  P R+     +++  GL +  
Sbjct: 9   VKTKENQSSFEFNSAYSPRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK-- 66

Query: 103 TLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQ-----TEQLERESLLKETEGG 157
                     +M     R A  +E+L+ HS  +++F+S+     + +L R +L     G 
Sbjct: 67  ----------IMDLYETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGD 116

Query: 158 DSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSN 216
           D   F N  Y    L  G +++A + ++    ++ IA+    G HHA+     GFC  ++
Sbjct: 117 DCPIFQN-LYDYTTLYTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVND 173

Query: 217 VAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTI 276
           + ++  N+L+ +P    +I+ +D D+HHG+G Q+AFY  DRV  +S H+Y  G+++PGT 
Sbjct: 174 IVLSILNLLRYHP----RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT- 227

Query: 277 HGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAA 336
            G+  + G  KG+ F  N+     G+ D  Y+  F+ ++ P+   F+P L++   G D+ 
Sbjct: 228 -GDLTEIGCDKGKHFALNVPL-EDGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSL 285

Query: 337 DGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAK 381
             D +G  ++    +G     + S     L VV  GGY   ++++
Sbjct: 286 GHDRLGCFNLNIKAHGECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  132 bits (331), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 92/333 (27%), Positives = 166/333 (49%), Gaps = 30/333 (9%)

Query: 55  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLM 114
           G  Y  ++ YH     S + Y   HP  P R+     +++  GL +            +M
Sbjct: 57  GSSYSPQVSYHFNPKVSQYHYGVRHPMKPFRLMLTDHLVSCYGLHK------------IM 104

Query: 115 VKVPVREAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLS 169
                REA +EE+L+ H+  +++F+S        +L R SL K   G D   F    +  
Sbjct: 105 DLYETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEKFNIGDDCPIFQG-MFDY 163

Query: 170 AKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSY 228
           + L  G +++A + ++    ++ IA+    G HHA+     GFC  +++ +A  ++L+ +
Sbjct: 164 SILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIISLLRYH 221

Query: 229 PESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKG 288
           P    +++ +D D+HHG+G Q+AFY  DRV  VS H+Y  G+++PGT  G+ D+ G  KG
Sbjct: 222 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSKG 274

Query: 289 EGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTP 348
           + F+ N+     G+ D  Y+  F+ +I P+   ++P +++   G D+   D +G  ++  
Sbjct: 275 KKFSLNVPL-QDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLNI 333

Query: 349 ACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAK 381
             +G     + S     LCV   GGY   ++++
Sbjct: 334 KAHGECVKFVKSFGIPILCVG-GGGYTPRNVSR 365

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  130 bits (327), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 93/336 (27%), Positives = 164/336 (48%), Gaps = 30/336 (8%)

Query: 52  LKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIG 111
            + G    +R+ YH     S++ Y   HP  P R+           ++ D  +SG   + 
Sbjct: 19  FELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDHLVSGY-GMH 66

Query: 112 DLMVKVPVREAEEEEILQVHSRQHLDFISQTE-----QLERESLLKETEGGDSVYFNNDS 166
            +M     R A  +E+ + H+  ++ F+ +       +L R +L K   G D   F N  
Sbjct: 67  KVMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQN-L 125

Query: 167 YLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANML 225
           Y  A L  G +++A + ++ G  ++ IA+    G HHA+     GFC  +++ ++  N+L
Sbjct: 126 YDYATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLL 183

Query: 226 KSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGE 285
           + +P    +++ +D D+HHG+G Q+AFY  DRV  +S H+Y  G ++PGT  G+ D+TG 
Sbjct: 184 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETGC 236

Query: 286 GKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCH 345
             GE F  N+     G+ D  Y+  F+ VI P+   + P +++   G D+   D +G  +
Sbjct: 237 DAGERFALNVPLED-GIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFN 295

Query: 346 VTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAK 381
           +    +G     + S     L VV  GGY   ++++
Sbjct: 296 LNIKAHGECVKFVKSFGIPML-VVGGGGYTPRNVSR 330

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  129 bits (325), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 94/352 (26%), Positives = 169/352 (48%), Gaps = 46/352 (13%)

Query: 37  PVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAEN 96
           P++V P   K              R+ Y        + Y   HP  P RI   + ++   
Sbjct: 10  PIVVKPNDKK--------------RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNY 55

Query: 97  GLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQT-----EQLERESLL 151
           GL +   +  A            + A ++E+ Q H+ +++DF+S+      +  ++ES+ 
Sbjct: 56  GLYKKMEIYRA------------KPATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV- 102

Query: 152 KETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGG 210
           K   G D   F+   Y    +S GG++E    +  G+    +A+    G HHA+   A G
Sbjct: 103 KFNVGDDCPVFDG-LYEYCSISGGGSMEGAARLNRGKC--DVAINYAGGLHHAKKSEASG 159

Query: 211 FCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGK 270
           FC  +++ +    +L+ +P    +++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+
Sbjct: 160 FCYLNDIVLGIIELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GE 213

Query: 271 YYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLIS 330
           ++PGT  G    TG GKG+ +  N+     G+ DA Y   FE VI  +   ++P  V++ 
Sbjct: 214 FFPGT--GELRDTGVGKGKNYAVNVPL-RDGIDDATYRAVFESVISKIMEWYQPSAVVLQ 270

Query: 331 SGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            G D+  GD +G  +++   + +  + + S     L VV  GGY + ++A++
Sbjct: 271 CGGDSLSGDRLGCFNLSMRGHANCVNFVKSFGI-PLMVVGGGGYTMRNVART 321

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 92/328 (28%), Positives = 164/328 (50%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+      E  +RES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ VD D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G     G GKG+ ++ N
Sbjct: 180 VLYVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ DA Y   FE V+  +   ++P  V++ +G D+  GD +G  +++   + + 
Sbjct: 236 VPL-RDGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     + VV  GGY + ++A++
Sbjct: 295 VNYVKSFGI-PMMVVGGGGYTMRNVART 321

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  129 bits (323), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 93/328 (28%), Positives = 164/328 (50%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y      S + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q HS +++DF+S+      E  ++ES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G    TG GKG+ ++ N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ D  Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + + 
Sbjct: 236 VPL-RDGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     L VV  GGY + ++A++
Sbjct: 295 VNYVKSFGIPML-VVGGGGYTMRNVART 321

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  128 bits (322), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 92/328 (28%), Positives = 162/328 (49%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+      E  +RES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G     G G G+ +  N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ DA Y   FE VI  +   ++P  V++  G D+  GD +G  +++   +G+ 
Sbjct: 236 VPL-RDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     + VV  GGY + ++A++
Sbjct: 295 VNYVKSFGI-PMMVVGGGGYTMRNVART 321

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  127 bits (320), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 91/328 (27%), Positives = 164/328 (50%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y      S + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+      E  ++ES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G    TG GKG+ +  N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ D+ Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + + 
Sbjct: 236 VPL-RDGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     L VV  GGY + ++A++
Sbjct: 295 VNYVKSFGIPML-VVGGGGYTMRNVART 321

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  127 bits (319), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 88/328 (26%), Positives = 163/328 (49%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL ++  +  A            +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKNMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+      +  ++ES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G    TG G G+ +  N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ DA Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + + 
Sbjct: 236 VPL-RDGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     + VV  GGY + ++A++
Sbjct: 295 VNFVKSFNI-PMMVVGGGGYTMRNVART 321

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  127 bits (319), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 90/328 (27%), Positives = 163/328 (49%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKKMEIYRA------------K 68

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+      E  ++ES+ K   G D   F+   Y    +S G
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESV-KFNVGDDCPVFDG-LYEYCSISGG 126

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 127 GSMEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----R 180

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G    TG GKG+ +  N
Sbjct: 181 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVN 236

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ DA Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + + 
Sbjct: 237 VPL-RDGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANC 295

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     + VV  GGY + ++A++
Sbjct: 296 VNYVKSFGI-PMMVVGGGGYTMRNVART 322

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  127 bits (318), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 90/328 (27%), Positives = 163/328 (49%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+      +  ++ES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G    TG GKG+ +  N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ DA Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + + 
Sbjct: 236 VPL-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     L +V  GGY + ++A++
Sbjct: 295 VNYMKSFGV-PLMIVGGGGYTMRNVART 321

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  127 bits (318), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 90/328 (27%), Positives = 164/328 (50%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+      +  ++ES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G    TG GKG+ ++ N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ DA Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + + 
Sbjct: 236 VPL-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     + VV  GGY + ++A++
Sbjct: 295 VNYVKSFGI-PMMVVGGGGYTMRNVART 321

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  127 bits (319), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 87/330 (26%), Positives = 161/330 (48%), Gaps = 30/330 (9%)

Query: 58  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKV 117
           Y  R+ YH     S++ Y   HP  P R+     +++  GL +            +M   
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGLHK------------IMDLY 71

Query: 118 PVREAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKL 172
             R A ++E+ + H+  +++F+S+       +L R +L     G D   F N  Y    L
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQN-LYDYTTL 130

Query: 173 SCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPES 231
             G  ++A + ++    ++ IA+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 232 VRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGF 291
             +++ +D D+HHG+G Q+AFY  DRV  +S H+Y  G+++PGT  G+  + G  KG+ F
Sbjct: 187 --RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 292 NCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACY 351
             N+     G+ D  Y+  F+ ++ P+   F+P +++   G D+   D +G  ++    +
Sbjct: 242 ALNVPL-EDGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 352 GHMTHMLLSLAKGNLCVVLEGGYNLDSIAK 381
           G     + S     L VV  GGY   ++++
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGYTPKNVSR 329

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  127 bits (318), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/328 (27%), Positives = 163/328 (49%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+         ++ES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G    TG GKG+ ++ N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ DA Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + + 
Sbjct: 236 VPL-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     + VV  GGY + ++A++
Sbjct: 295 VNYVKSFGI-PMMVVGGGGYTMRNVART 321

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  127 bits (318), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 90/328 (27%), Positives = 164/328 (50%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+      +  ++ES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRG--KCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G    TG GKG+ ++ N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ DA Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + + 
Sbjct: 236 VPL-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     + VV  GGY + ++A++
Sbjct: 295 VNYVKSFGI-PMMVVGGGGYTMRNVART 321

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  126 bits (317), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 91/328 (27%), Positives = 161/328 (49%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+      E  +RES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G     G G G+ +  N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ DA Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + + 
Sbjct: 236 VPL-RDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     + VV  GGY + ++A++
Sbjct: 295 VNYVKSFGI-PMMVVGGGGYTMRNVART 321

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  126 bits (316), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 91/328 (27%), Positives = 161/328 (49%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+      E  +RES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G  K  +AV    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRG--KCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G     G G G+ +  N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ DA Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + + 
Sbjct: 236 VPL-RDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     + VV  GGY + ++A++
Sbjct: 295 VNYVKSFGI-PMMVVGGGGYTMRNVART 321

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  125 bits (315), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 88/328 (26%), Positives = 163/328 (49%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+      +  ++ES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRG--KCDVAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G    TG GKG+ +  N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + + 
Sbjct: 236 VPL-RDGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     + +V  GGY + ++A++
Sbjct: 295 VNFVKSFGL-PMMIVGGGGYTMRNVART 321

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  125 bits (314), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 89/328 (27%), Positives = 162/328 (49%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+      E  ++ES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E+   +  G+    IA+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMESAARLNRGKC--DIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G     G GKG+ +  N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   +   
Sbjct: 236 VPL-RDGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     + VV  GGY + ++A++
Sbjct: 295 VNYVKSFNI-PMMVVGGGGYTMRNVART 321

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  125 bits (314), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 89/328 (27%), Positives = 162/328 (49%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+      +  ++ES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G+    IA+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRGKC--DIAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G     G GKG+ +  N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ DA Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + + 
Sbjct: 236 VPL-RDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     + VV  GGY + ++A++
Sbjct: 295 VNYVKSFNI-PMMVVGGGGYTMRNVART 321

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  125 bits (314), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 86/326 (26%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQTEQLERESLLKET---EGGDSVYFNNDSYLSAKLSCGGA 177
            A ++E+ Q H+ +++DF+S+      E   KE+     GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 178 IEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIM 236
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 237 IVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNIT 296
            +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G     G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVP 237

Query: 297 WPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTH 356
               G+ DA Y   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 357 MLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + S     + VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  125 bits (313), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 89/328 (27%), Positives = 162/328 (49%), Gaps = 32/328 (9%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        + Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQT-----EQLERESLLKETEGGDSVYFNNDSYLSAKLSCG 175
            A ++E+ Q H+ +++DF+S+      E  ++ES+ K   G D   F+   Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESV-KFNVGDDCPVFDG-LYEYCSISGG 125

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           G++E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRGKC--DVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           ++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G     G GKG+ +  N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVN 235

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHM 354
           +     G+ DA Y   FE VI  +   ++P  V++  G D+  GD +G  +++   + + 
Sbjct: 236 VPL-RDGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANC 294

Query: 355 THMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + + S     + VV  GGY + ++A++
Sbjct: 295 VNYVKSFGI-PMMVVGGGGYTMRNVART 321

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  124 bits (311), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 92/352 (26%), Positives = 168/352 (47%), Gaps = 46/352 (13%)

Query: 37  PVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAEN 96
           P++V P   K              R+ Y        + Y   HP  P RI   + ++   
Sbjct: 10  PIVVNPNNKK--------------RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNY 55

Query: 97  GLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQT-----EQLERESLL 151
           GL +   +  A            + A ++E+ Q H+ +++DF+S+      +  ++ES+ 
Sbjct: 56  GLYKKMEIYRA------------KPATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV- 102

Query: 152 KETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGG 210
           K   G D   F+   +    +S GG++E    +  G  K  +A+    G HHA+   A G
Sbjct: 103 KFNVGDDCPVFDG-LFEYCSISGGGSMEGAARLNRG--KCDVAINYAGGLHHAKKSEASG 159

Query: 211 FCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGK 270
           FC  +++ +    +L+ +P    +++ +D D+HHG+G ++AFY  DRV+  S H+Y  G+
Sbjct: 160 FCYLNDIVLGIIELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GE 213

Query: 271 YYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLIS 330
           ++PGT  G     G GKG+ +  N+     G+ DA Y   FE VI  +   ++P  V++ 
Sbjct: 214 FFPGT--GELRDVGIGKGKNYAVNVPL-RDGMDDATYRSVFESVISKIMEWYQPSAVVLQ 270

Query: 331 SGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKS 382
            G D+  GD +G  +++   + +  + + S     + VV  GGY + ++A++
Sbjct: 271 CGGDSLSGDRLGCFNLSMRGHANCVNFVKSFNI-PMMVVGGGGYTMRNVART 321

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  121 bits (304), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 86/326 (26%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 61  RMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVR 120
           R+ Y        F Y   HP  P RI   + ++   GL +   +  A            +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKKMEIYRA------------K 67

Query: 121 EAEEEEILQVHSRQHLDFISQTEQLERESLLKET---EGGDSVYFNNDSYLSAKLSCGGA 177
            A ++E+ Q H+ +++DF+S+      E   KE+     GD     +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 178 IEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIM 236
           +E    +  G  K  +A+    G HHA+   A GFC  +++ +    +L+ +P    +++
Sbjct: 128 MEGAARLNRG--KCDVAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 237 IVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNIT 296
            +D D+HHG+G ++AFY  DRV+  S H+Y  G+++PGT  G     G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 297 WPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTH 356
               G+ DA +   FE V+  +   ++P  V++  G D+  GD +G  +++   + +  +
Sbjct: 238 L-RDGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 357 MLLSLAKGNLCVVLEGGYNLDSIAKS 382
            + S     + VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 103/209 (49%), Gaps = 14/209 (6%)

Query: 175 GGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVR 233
           G  +     V++G  + SI +    G HHA  + A GFC  +++ +    + +   +  +
Sbjct: 181 GATLMLADKVIKG--ERSIGINWDGGRHHAFKQKASGFCYVNDIVLLIQKLRR---KGFQ 235

Query: 234 KIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNC 293
           KI  +D+D+HHG+G +KAF     V  +SLH +++G ++PGT  GN  ++ + +      
Sbjct: 236 KISYIDFDLHHGDGVEKAFQFSSNVQTISLHLFEVG-FFPGT--GNLSESDKRRNV---V 289

Query: 294 NITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGH 353
           NI     G+ D       EQ++ P+    EPD+++I  G D   GD   +  ++      
Sbjct: 290 NIPL-LHGLDDTSLEQLIEQIVKPVIERHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAK 348

Query: 354 MTHMLLSLAKGNLCVVL-EGGYNLDSIAK 381
               L++  K    ++L  GGYN+  +++
Sbjct: 349 CITELINNTKDCPVILLGGGGYNVTLMSR 377

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 102/209 (48%), Gaps = 12/209 (5%)

Query: 168 LSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLK 226
           L   +S G  +   + ++EG  + +IA+    G HH+    A GFC  +++A+    + +
Sbjct: 170 LYCYVSTGATLSLAQYILEGS-ERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRR 228

Query: 227 SYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEG 286
                V +I  VD+D+HHG+G +KAF    +V  +SLH Y+ G ++P +  G+ +    G
Sbjct: 229 G---GVDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFPCS--GSLEDNSSG 282

Query: 287 KGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHV 346
           K      NI     G+ D+      +++I+P   + +P++++I  G D   GD   +  +
Sbjct: 283 KSI---VNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQL 338

Query: 347 TPACYGHMTHMLLSLAKGNLCVVLEGGYN 375
           +          L+     ++ ++  GGYN
Sbjct: 339 SIKGLTSTITSLIEQFNCHIVLLGGGGYN 367

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 104/229 (45%), Gaps = 16/229 (6%)

Query: 201 HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLY 260
           HH+    A GFC  +++ +A   + +++      I  VD+D+HHG+G ++AF     V  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFS----NISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 261 VSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGR 320
           +SLH ++ G ++PGT  G+ + + +G       NI    G   D   M   E V++P  +
Sbjct: 298 ISLHNHEPG-FFPGT--GSMESSQDGHSI---INIPLRHGADDDC-LMKITESVVIPCIQ 350

Query: 321 EFEPDLVLISSGFDAADGDTIGQCHVT-PACYGHMTHMLLSLAKGNLCVVLEGGYNLDSI 379
           +  P +++I  G D   GD   +  +T       +  +L SL   ++ ++  GGYN   +
Sbjct: 351 KHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYNDRVM 410

Query: 380 AKS----ALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYW 424
           ++        VC      PP++ P    +      + ++       K+W
Sbjct: 411 SRFYTYLTWKVCDQFSKSPPEDPPFIDDEDLIPDHEFLDLYTDEHYKFW 459

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 88/177 (49%), Gaps = 13/177 (7%)

Query: 201 HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLY 260
           HHA  + A GFC  ++V +    + K     + K+  +D+D+HHG+G +KAF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRKL---KLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 261 VSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYM-WAFEQVIMPMG 319
           +S+H Y+ G ++PGT   N  Q G+         +  P     D  Y+     ++I P+ 
Sbjct: 269 ISVHLYEPG-FFPGTGSLNDSQNGKNI-------VNIPLKHGCDDNYLNLVASKIIHPLI 320

Query: 320 REFEPDLVLISSGFDAADGDTIGQCHVTPACYGH-MTHMLLSLAKGNLCVVLEGGYN 375
           +  +P+++++  G D   GD   +  +T       + +++ S  + ++ ++  GGYN
Sbjct: 321 KRHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYN 377

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 88/176 (50%), Gaps = 11/176 (6%)

Query: 201 HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLY 260
           HHA  + A GFC  ++V +    + K     + KI  VD+D+HHG+G ++AF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRKM---KLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 261 VSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGR 320
           +S+H Y+ G ++PGT  G+ +   +GK      NI     G  D+       ++I P+ +
Sbjct: 269 ISIHLYEPG-FFPGT--GSLNDARKGKSV---VNIPLKH-GCDDSYLDLVASKIISPLIK 321

Query: 321 EFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSL-AKGNLCVVLEGGYN 375
             +PD+++I  G D   GD   +  +T          ++ L  + ++ ++  GGYN
Sbjct: 322 RHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYN 377

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 106/222 (47%), Gaps = 19/222 (8%)

Query: 162 FNNDSYLSAKLS--CGGAIEACKAVVEG---RVKNSIAVVRPPG-HHAEPEIAGGFCLFS 215
            ++D YL A L   C     A  ++V     R + +I++    G HHA    A GFC  +
Sbjct: 176 LSHDCYLFAYLPLYCQVIAGATLSLVRAACLRHERAISINWDGGRHHASRSRASGFCYIN 235

Query: 216 NVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGT 275
           ++A+    + +     +R+I  +D+D+HH +G ++AF     V  +S+H ++ G ++PGT
Sbjct: 236 DIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQTISVHLHEPG-FFPGT 291

Query: 276 IHGNYDQTGEGKGEGFNCNITWPTG-GVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFD 334
             G+  +   GK       +  P   G+ D       ++VIMP  R   P++++I  G D
Sbjct: 292 --GSLKEASVGKNV-----VNIPVQHGMDDTFLNQIVQRVIMPCIRSHNPEVLVIQCGGD 344

Query: 335 AADGDTIGQCHVT-PACYGHMTHMLLSLAKGNLCVVLEGGYN 375
              GD   +  +T      ++ +++      N+ ++  GGYN
Sbjct: 345 GLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYN 386

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 94/179 (52%), Gaps = 17/179 (9%)

Query: 201 HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLY 260
           HH+  + A GFC  +++ +    + +   +  RKI  +D+D+HHG+G +K+F     +  
Sbjct: 299 HHSRKKKASGFCYVNDIVLCIQKLGE---KGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 261 VSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPT-GGVGDAEYMWAFEQVIMPMG 319
           +S+H ++ G ++P T  G+ ++T      GFN  +  PT  G+ D    +   +VI+P+ 
Sbjct: 356 ISVHLFEPG-FFPCT--GSLEET----KHGFNI-VNIPTLHGLDDNYLTYLLNRVIIPLI 407

Query: 320 REFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVL---EGGYN 375
           ++ +P+ +++  G D   GD   +  +T +  G   +++L L     C V+    GGYN
Sbjct: 408 KKHKPECLVVQCGGDGLIGDRYKEWQMTIS--GLTKNIMLVLQNFPECSVVLLGGGGYN 464

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 96/427 (22%), Positives = 173/427 (40%), Gaps = 92/427 (21%)

Query: 157 GDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIA-----VVRPPGHHAEPEIAGGF 211
           GD +Y +  +  + + S G       ++ +G  +  IA      VRPPGHH+      GF
Sbjct: 146 GD-IYLSQQTIAALEGSIGALETGIDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGF 204

Query: 212 CLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQ---------------------- 249
           CL +N  +A      ++  +V   +++D+D+HHG+GTQ                      
Sbjct: 205 CLLNNAHIAIEYAADTF--NVTHAVVLDFDLHHGDGTQDICWKRAGFNPDEQDDDPAYDE 262

Query: 250 --KAFYDDDRVLYVSLHRY-----QLGKYYPGTI------------------HGNYDQTG 284
             K F +  +V Y S+H       +LG      I                  H ++ +T 
Sbjct: 263 FGKKFAEFPKVGYFSMHDINSFPTELGYATKENIKNASTCIMNAHDLNIWNVHLSHYETE 322

Query: 285 EGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIG-Q 343
           E   + +     + +      E+    ++ +   G++F+  LV+IS+GFDA++ +    Q
Sbjct: 323 EDFVKLYQSK--YRSLFAKADEFFKNAKKEMASQGKKFK-GLVVISAGFDASEYEQPSMQ 379

Query: 344 CH--VTPACYGHM-THMLLSLAK----GNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPD 396
            H    P C+ +M T   L LA+    G +  V+EGGY+  +I+    GV   L+G    
Sbjct: 380 RHGVNVPTCFYNMFTKDALKLAQMHTSGKVLSVMEGGYSDGAISS---GVFSHLIG---- 432

Query: 397 ELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGIN----------------FKD 440
            L          + ++++ +IR     W  +K +   D I                 F+D
Sbjct: 433 -LQNQNWINEWGSAQVVKEIIRGCKPQWKPYKTKKARDVIRIWAEEVIKLGRSMIPEFED 491

Query: 441 AITSTLDTRNFP-LQNAIREYQVSQLSSQFNFVQLPILDLNLPANTMLCTSGIQDSETLV 499
            +   ++ +  P ++   R  + S + ++ N V LP  D   P +  L  +  + SE + 
Sbjct: 492 LLFGMVEAQIVPDVKRVTRSQKASNVVAKVNNVALPRSDTPTPEDRRLARNN-KPSEAVP 550

Query: 500 VIVHDTP 506
            +  D P
Sbjct: 551 FLQQDLP 557

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 99/210 (47%), Gaps = 12/210 (5%)

Query: 168 LSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLK 226
           L  ++  G ++     + +   + +IA+    G HHA    A GFC  +++ +    + K
Sbjct: 189 LYCEVISGASLMLSDFIEKSSSQRTIAINWDGGRHHAIKNKASGFCYINDIVILIQKLRK 248

Query: 227 SYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEG 286
              + + K+  +D+D+HHG+G +KAF     +  +S+H Y+ G ++P T  G+ + T  G
Sbjct: 249 ---KGISKVSYIDFDLHHGDGVEKAFRYSSNIQTISMHMYEPG-FFPCT--GSLEDTLNG 302

Query: 287 KGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHV 346
           K    N        GV D        ++I P+     P++++I  G D   GD   +  +
Sbjct: 303 K----NIVNVPLYHGVDDNYMTEIVNELIKPLIERHSPEVLVIQCGGDGLIGDKFEEWQL 358

Query: 347 T-PACYGHMTHMLLSLAKGNLCVVLEGGYN 375
           T      ++ +++    K ++ ++  GGYN
Sbjct: 359 TISGLTRNIQNLIEWFPKSDIILLGGGGYN 388

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 90/332 (27%), Positives = 134/332 (40%), Gaps = 73/332 (21%)

Query: 127 ILQVHSRQHLDFISQTEQLERESLLK-ETEGGDSVYFNNDSYLSAKL------SCGGAIE 179
           +L+VH R     + +  +   E L K E E  DS + + D YLS+K       S G    
Sbjct: 108 VLKVHGRDWPPTLLRLCKHADEKLAKGEIEVPDS-WNSGDIYLSSKTIEALQGSIGALET 166

Query: 180 ACKAVVEG----RVKN-SIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
              ++ EG     V N +  V+RPPGHH       GFCL +N  V+      +Y   +  
Sbjct: 167 GVDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--GITH 224

Query: 235 IMIVDWDIHHGNGTQ-------------------------KAFYDDDRVLYVSLHRYQLG 269
            +++D+D+HHG+GTQ                         K F +  RV Y S+H     
Sbjct: 225 AVVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSMHDINSF 284

Query: 270 KYYPG-TIHGNYDQTGEGKGEGFNCNI------TWPT----GGVGDAEYMWAFEQV---- 314
               G     N          G + NI       W T      +  ++Y   F +     
Sbjct: 285 PTESGYATKDNIKSASTCIMNGHDLNIWNVHLSAWETEEDFNKLYQSKYRTLFAKADEFF 344

Query: 315 ------IMPMGREFEPDLVLISSGFDAADGDTIG-QCH---VTPACYGHMTHMLLSLAK- 363
                 +   G++F+  LV+IS+GFDA++ + +  Q H   V    Y   T   L LA+ 
Sbjct: 345 KNAKIEMSAKGKKFK-GLVVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDALKLAQM 403

Query: 364 ---GNLCVVLEGGYNLDSIAKSALGVCKVLVG 392
              G +  VLEGGY+  +I     GV   L+G
Sbjct: 404 HSEGKVLSVLEGGYSDKAITS---GVFAHLIG 432

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 88/177 (49%), Gaps = 13/177 (7%)

Query: 201 HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLY 260
           HHA  + A GFC  ++V +    + K+    + KI  VD+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRKA---KLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 261 VSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAF-EQVIMPMG 319
           +S+H Y+ G ++PGT  G+   + + K       +  P     D  Y+     +++ P+ 
Sbjct: 267 ISVHLYEPG-FFPGT--GSLSDSRKDKNV-----VNIPLKHGCDDNYLELIASKIVNPLI 318

Query: 320 REFEPDLVLISSGFDAADGDTIGQCHVTPACYGH-MTHMLLSLAKGNLCVVLEGGYN 375
              EP+ ++I  G D   GD   +  +T       + +++ S  + ++ ++  GGYN
Sbjct: 319 ERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYN 375

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 111/237 (46%), Gaps = 17/237 (7%)

Query: 143 EQLERESLLKETEGGDSVYFNNDSYLSA--KLSCGGAIEACKAVVEGRVKNSIAVVRPPG 200
           +++ RE L      GD   F   SYL    ++  G  +   K +     + +IAV    G
Sbjct: 175 KEMIREKLKGYNLEGDCPIF---SYLPVYCQVIVGATLSLAKHITAVANERTIAVNWDGG 231

Query: 201 -HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVL 259
            HHA    A GFC  +++ V     L+S     ++I  +D+D+HHG+G Q++F     V 
Sbjct: 232 RHHALRNKASGFCYINDI-VLLIQQLRS--NGYKRITYIDFDLHHGDGVQRSFQYSTSVQ 288

Query: 260 YVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMG 319
            +S H ++ G ++P T  G+  ++  GK      NI     GV D       E+V++P  
Sbjct: 289 TISAHMFEPG-FFPCT--GSLKESKMGKNI---VNIPL-LHGVDDMLMNEIVEKVMIPCV 341

Query: 320 REFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVL-EGGYN 375
           + ++P++++I  G D   GD   +  +T     +    LL +  G   V+L  GGYN
Sbjct: 342 KRYDPEILVIQCGGDGLIGDGYAEWQLTIHGLVNNILKLLRIFPGCPVVLLGGGGYN 398

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 109/251 (43%), Gaps = 23/251 (9%)

Query: 192 SIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQK 250
           SIA+    G HHA    A GFC  +++ +   ++ +   +  +++  +D+D+H+G+G  K
Sbjct: 183 SIAINWDGGRHHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAK 239

Query: 251 AFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPT-GGVGDAEYMW 309
           AF   + V  +S+H Y+ G ++PGT  G+ ++T   K       +  P   G+ D   + 
Sbjct: 240 AFRFSENVQTISVHLYEPG-FFPGT--GSLEETRNSKQM-----VNLPVLHGMDDKYLLE 291

Query: 310 AFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVV 369
               VI P+   F  + ++I  G D   GD   +  ++     H    ++ + +     +
Sbjct: 292 LISSVITPLIETFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFL 351

Query: 370 L-EGGYNLDSIAKS----ALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYW 424
           L  GGYN   +++        V ++        +P    +      + IE       +YW
Sbjct: 352 LGGGGYNELLVSRFYTYLTSKVLELYGNNISSSIPEDDSEVLLRDHEFIELYKDENYRYW 411

Query: 425 SCFKNRHGNDG 435
           S     + NDG
Sbjct: 412 S-----YDNDG 417

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/301 (25%), Positives = 114/301 (37%), Gaps = 69/301 (22%)

Query: 192 SIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQ-- 249
           +   +RPPGHH+      GFCL +N  +A       Y   V    I+D+D+HHG+GTQ  
Sbjct: 184 AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQDI 241

Query: 250 ---------------KAFYDD--------DRVLYVSLHRYQLGKYYPGTIHG-------- 278
                           A YDD         +V Y SLH         G  H         
Sbjct: 242 CWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDINSFPTEQGYAHKTSIKDASV 301

Query: 279 -----------NYDQTGEGKGEGFN--CNITWPTGGVGDAEYMWAFEQVIMPMGREFEPD 325
                      N   T     E FN      +        E++   ++ +   G+ ++  
Sbjct: 302 CIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKADEFLRVSQKRMASEGKNYK-G 360

Query: 326 LVLISSGFDAADGDTIGQ----CHVTPACYGHMTHMLLSLA----KGNLCVVLEGGYNLD 377
           L++IS+GFDA++ + +       HV  + Y   T   L LA    +G L  +LEGGY   
Sbjct: 361 LIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKLAQMHTQGKLLSLLEGGY--- 417

Query: 378 SIAKSALGVCKVLVGEPPDELPAPKKQPTPE--AKKMIETVIRTQSKYWSCFKNRHGNDG 435
           S A    GV   L+G          +   PE  + ++I+ V R     W  +K +   D 
Sbjct: 418 SDAALVSGVFSHLIG-------MQNQNWIPEWGSAQVIKEVCRGCRPNWKAYKTKRSRDV 470

Query: 436 I 436
           I
Sbjct: 471 I 471

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 90/203 (44%), Gaps = 14/203 (6%)

Query: 176 GAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
           GA          R + +I+V    G HHA    A GFC  +++A+    + +     + K
Sbjct: 198 GATIKLARYASSRQQRTISVNWDGGRHHAFKSKASGFCYVNDIAILIQKLRR---RGIHK 254

Query: 235 IMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCN 294
           I  +D+D+HHG+G ++AF     V  +S+H Y+ G ++PGT  G       G+       
Sbjct: 255 ISYLDFDLHHGDGVERAFQHSANVQTISIHMYEEG-FFPGT--GTLKDASSGRNI----- 306

Query: 295 ITWPT-GGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVT-PACYG 352
           +  P   G+ D        +V++P      P++V+I  G D   GD   +  +T      
Sbjct: 307 VNIPVLHGMDDTFLNEVVNRVVIPCLHNHNPEVVIIQCGGDGLIGDKYKEWQLTLKGLTD 366

Query: 353 HMTHMLLSLAKGNLCVVLEGGYN 375
            +  ++      N+ ++  GGYN
Sbjct: 367 TIMKVVEDFPSSNIVLLGGGGYN 389

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 89/176 (50%), Gaps = 11/176 (6%)

Query: 201 HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLY 260
           HHA  + A GFC  ++V +    + K     + KI  +D+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRKI---KLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 261 VSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGR 320
           +S+H Y+ G ++PGT  G+ D +  GK      NI     G  D+       ++I P+  
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV---VNIPLKH-GCDDSYLNLIASKIINPLID 319

Query: 321 EFEPDLVLISSGFDAADGDTIGQCHVTPACYGH-MTHMLLSLAKGNLCVVLEGGYN 375
           + +P++++I  G D   GD   +  +T       + + +   ++ ++ ++  GGYN
Sbjct: 320 KHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYN 375

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 112/247 (45%), Gaps = 24/247 (9%)

Query: 139 ISQTEQLE-----RESLLKETE-GGDSVYFNNDSYLSAKLSC-GGAIEACKAVVEGRVKN 191
           + Q E LE     + +L+KE    GD   F   SY+        GA  +    ++   + 
Sbjct: 148 VQQNETLEGNAEIKATLMKEHNLEGDCPLF---SYIPMYTQVVTGATLSLSKFLQPNSER 204

Query: 192 SIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQK 250
           SIA+    G HHA    A GFC  +++ +    + K+     + I  VD+D+HHG+G QK
Sbjct: 205 SIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKNISYVDFDLHHGDGVQK 261

Query: 251 AFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWA 310
           AF     V  VSLH ++ G ++P T         E K      NI    G   D  ++  
Sbjct: 262 AFQFSKNVQTVSLHMFEPG-FFPCT-----GSLQEAKAGSSIVNIPLLHG--LDGTFLKQ 313

Query: 311 FEQ-VIMPMGREFEPDLVLISSGFDAADGDTIGQCHVT-PACYGHMTHMLLSLAKGNLCV 368
             + +I+P+  + EP++++I  G D   GD   +  +T     G +  ++ +    ++ +
Sbjct: 314 LTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSGAIMKLINTFPSCSVVL 373

Query: 369 VLEGGYN 375
           +  GGYN
Sbjct: 374 LGGGGYN 380

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 96/210 (45%), Gaps = 19/210 (9%)

Query: 171 KLSCGGAIEACKAVVEGRVKNSIAVVRPPG-HHAEPEIAGGFCLFSNVAVAAANMLKSYP 229
           +++ G  +   K +V      +I +    G HHA  + A GFC  +++ +    M K+  
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 230 ESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGE 289
              +KI  +D+D+HHG+G +KAF     +  +SLH ++ G ++PG        TG    +
Sbjct: 246 -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPG--------TGGLSNK 295

Query: 290 GFNCNITWP-TGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTP 348
           G    I  P + G+ D       +Q+I+P       + +++  G D   GD   +  +T 
Sbjct: 296 GSRDLIDIPLSHGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTI 355

Query: 349 ACYGHMTHMLLSLAKGNLCVVL---EGGYN 375
              G    ++  + K + C ++    GGYN
Sbjct: 356 K--GLTQCIIDVIGKFSDCQIVLLGGGGYN 383

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 78/338 (23%), Positives = 133/338 (39%), Gaps = 74/338 (21%)

Query: 160 VYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIA-----VVRPPGHHAEPEIAGGFCLF 214
           +Y   ++  + + S G       ++ +G V    A      +RPPGHH+      GFCL 
Sbjct: 147 IYLCEETVYALRGSIGAVEYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGFCLL 206

Query: 215 SNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQ------------------------- 249
           +N  +A      +Y   V   +I+D+D+HHG+GTQ                         
Sbjct: 207 NNAHIAVEYAADTY--GVTHAVILDFDLHHGDGTQDICWKRAGFKADDIQDAKGEYNEFD 264

Query: 250 KAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKG--------------------- 288
           K F +  +V Y S+H   +  +     + + D+  +                        
Sbjct: 265 KKFAEFPKVGYFSMH--DINSFPTELNYASKDKVKDASTCIMDAHDVNIWNIHLLPYETE 322

Query: 289 EGFN--CNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIG-QCH 345
           E FN      + T      E+  A +  +   G+ F+  LV++S+GFDA++ + +  Q H
Sbjct: 323 EEFNKLYQTRYRTLFAKADEFFKAAKLSMAKDGKPFK-GLVVMSAGFDASEYEQVSMQRH 381

Query: 346 ---VTPACYGHMTHMLLSLAK----GNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDEL 398
              V  + Y   T   L LA+    G +  +LEGGY+  +IA    GV   L+G     L
Sbjct: 382 GVNVPTSFYSTFTKDALKLAQMHTNGKIISLLEGGYSDAAIAS---GVFSHLIG-----L 433

Query: 399 PAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGI 436
                     + ++++ ++R     W  +K R   D I
Sbjct: 434 QNQNWITEWGSAQVVKEIVRGCKPRWKPYKTRKAGDVI 471

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 108/236 (45%), Gaps = 30/236 (12%)

Query: 201 HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLY 260
           HHA    A GFC  +++ +    + K   +   K+  +D+D+HHG+G ++AF    +V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 261 VSLHRYQLGKYYP--GTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPM 318
           +SLH Y+ G ++P  G++ G+          GF+        G+ D+      +QV+ P+
Sbjct: 263 ISLHLYEPG-FFPCTGSLEGS---------SGFDTVNLPLQHGLTDSFLQGLVDQVVNPL 312

Query: 319 GREFEPDLVLISSGFDAADGDTIGQCH-----VTPACYGHMTHMLLSLAKGNLCVVLEGG 373
            +   P++++I  G D   GDT  +       +T      M+H      + ++ ++  GG
Sbjct: 313 IQRHGPEVIVIQCGGDGLLGDTFHEWQLSIRGLTKCILDVMSHS----TQAHVILLGGGG 368

Query: 374 YNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKN 429
           YN   +++    +   ++ +  +  P P      E     E++IR   KY  C+ +
Sbjct: 369 YNPTLMSRFYTYLTGRILHQFKNTDPFPGMNGAQE-----ESLIRDH-KYIECYGD 418

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 91/374 (24%), Positives = 144/374 (38%), Gaps = 75/374 (20%)

Query: 127 ILQVHSRQHLDFISQTEQLERESLLK-ETEGGDSVYFNNDSYLSAKL--SCGGAIEACKA 183
           +L+VH       + +  Q+    LLK E E  D+ + + D YLS+K   +  G I A + 
Sbjct: 110 VLKVHGSHWPTELIELCQMADAKLLKGEIEVPDT-WNSGDIYLSSKTIQALQGTIGAIET 168

Query: 184 VVEGRVK---------NSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
            V+   K          +   +RPPGHH       GFCL +N  VA      +Y   V  
Sbjct: 169 GVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DVTH 226

Query: 235 IMIVDWDIHHGNGTQ------------------------KAFYDDDRVLYVSLHRYQLGK 270
           ++++D+D+HHG+GTQ                        K F +  +V Y S+H      
Sbjct: 227 VVVLDFDLHHGDGTQDICWKRAGFKPEEESENSSYDNFGKKFAEFPKVGYFSMHDINSFP 286

Query: 271 YYPG-TIHGNYDQTGEGKGEGFNCNI------TWPTGGVGDAEYMWAFEQVIMPMGREFE 323
              G     N            + NI       W T    +  Y   +  +       F+
Sbjct: 287 TESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEDFNILYRTKYRTLFAKADEFFK 346

Query: 324 -------------PDLVLISSGFDAADGD-TIGQCH---VTPACYGHMTHMLLSLAK--- 363
                          LV+IS+GFDA++ + T  Q H   V  + Y   T   L LA+   
Sbjct: 347 TAKLEMNQQEKTFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHC 406

Query: 364 -GNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSK 422
            G +  ++EGGY+  +I     GV   L+G     L          ++++++ ++R    
Sbjct: 407 HGKVLSLMEGGYSDKAICS---GVFAHLIG-----LQNQDWVKEWGSEQVVKEIVRGCKS 458

Query: 423 YWSCFKNRHGNDGI 436
            W  +K R   D I
Sbjct: 459 TWKPYKTRRAKDVI 472

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 96/374 (25%), Positives = 150/374 (40%), Gaps = 75/374 (20%)

Query: 127 ILQVHSRQHLDFISQTEQLERESLLK-ETEGGDSVYFNNDSYLSAKL-----SCGGAIE- 179
           +L+VH       + +  Q+    LLK E E  D+ + + D YLS+K         GAIE 
Sbjct: 110 VLKVHGSHWPAELIELCQMADAKLLKGEIEVPDT-WNSGDIYLSSKTIKALQGTIGAIET 168

Query: 180 ACKAVVEGRVKNSIA-----VVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
              ++ EG     I+      +RPPGHH       GFCL +N  VA      +Y  +V  
Sbjct: 169 GVDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NVTH 226

Query: 235 IMIVDWDIHHGNGTQ------------------------KAFYDDDRVLYVSLHRYQLGK 270
           ++++D+D+HHG+GTQ                        K F +  +V Y S+H      
Sbjct: 227 VVVLDFDLHHGDGTQDICWKRAGFKPEEEPENSSYDEFDKKFAEFPKVGYFSMHDINSFP 286

Query: 271 YYPG-TIHGNYDQTGEGKGEGFNCNI------TWPTGGVGDAEY------MWA-----FE 312
              G     N            + NI       W T    +  Y      ++A     F 
Sbjct: 287 TESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADEFFR 346

Query: 313 QVIMPMGREFEP--DLVLISSGFDAADGD-TIGQCH---VTPACYGHMTHMLLSLAK--- 363
                M +  +P   LV+IS+GFDA++ + T  Q H   V  + Y   T   L LA+   
Sbjct: 347 SAKQEMNQNEKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHC 406

Query: 364 -GNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSK 422
            G +  ++EGGY+  +I     GV   L+G     L          ++++++ ++R    
Sbjct: 407 HGKVLSLMEGGYSDKAICS---GVFAHLIG-----LQNQDWVKEWGSEQVVKEIVRGCKP 458

Query: 423 YWSCFKNRHGNDGI 436
            W  +K R   D I
Sbjct: 459 AWKPYKTRRAKDVI 472

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 108/239 (45%), Gaps = 38/239 (15%)

Query: 201 HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLY 260
           HHA    A GFC  +++A+    + +   +   ++  VD+D+HHG+G + AF     V  
Sbjct: 193 HHALKARASGFCYVNDIALLIQTLRR---QGFLRVSYVDFDLHHGDGVENAFRYSKNVQT 249

Query: 261 VSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWP-TGGVGDAEYMWAFEQVIMPMG 319
            SLH ++ G ++PG        TG  K    N  +  P   GV D+      + ++ P  
Sbjct: 250 CSLHLFEPG-FFPG--------TGACKNCTDNSVLNVPLLHGVDDSTLDHVVDHIVTPAV 300

Query: 320 REFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGN----LCVVLEGGYN 375
           +  +P++++I  G D   GD  G+  ++   +G +T  +L L + +    + ++  GGYN
Sbjct: 301 QRHDPEVLIIQCGGDGLSGDKYGEWQLS--IHG-LTRNILKLVQAHKFKKIALLGGGGYN 357

Query: 376 --LDS-----IAKSALGVCKVL---VGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYW 424
             L S     +    L  CK +   +G+  DEL            ++IE   +   K+W
Sbjct: 358 GRLQSRFYAYLTSMLLAQCKGIPTEIGDDEDEL--------IRDHELIEMYEQEDYKFW 408

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 103/262 (39%), Gaps = 60/262 (22%)

Query: 185 VEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHH 244
           VE     +   +RPPGHH+      GFCL +N  +A      +Y   V   +++D+D+HH
Sbjct: 178 VEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GVTHAVVLDFDLHH 235

Query: 245 GNGTQ-------------------------KAFYDDDRVLYVSLHRY-----QLGKYYPG 274
           G+GTQ                         K F +  +V Y SLH       +LG     
Sbjct: 236 GDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDINSFPTELGYATKE 295

Query: 275 TIHG--------------NYDQTGEGKGEGFN--CNITWPTGGVGDAEYMWAFEQVIMPM 318
            +                N         E F       + T      EY    +Q +  +
Sbjct: 296 NVRNAATCIMDAHDVNIWNVHLQSYDSDEAFTKLYQTKYRTLFAKADEYFRTAKQNMRAL 355

Query: 319 GREFEPDLVLISSGFDAADGDTIG-QCH---VTPACYGHMTHMLLSLAK----GNLCVVL 370
           G+ F+  LV+IS+GFDA++ +    Q H   V    Y   T   L LA+    G L  VL
Sbjct: 356 GKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKLAQMHSHGKLLSVL 414

Query: 371 EGGYNLDSIAKSALGVCKVLVG 392
           EGGY+  +I+    GV   L+G
Sbjct: 415 EGGYSDGAISS---GVFAHLIG 433

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 120/303 (39%), Gaps = 69/303 (22%)

Query: 192 SIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQ-- 249
           +   +RPPGHH       GFCL +N  +A     + Y   V   +I+D+D+HHG+GTQ  
Sbjct: 186 AFVAIRPPGHHCHVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQDI 243

Query: 250 -------------------KAFYDD--------DRVLYVSLHRYQLGKYYPG-TIHGNYD 281
                              K  YDD         +V Y S+H         G     N  
Sbjct: 244 CWKRAGFKPDDGNVQDDEDKNEYDDFGKKMADFPKVGYFSMHDINSFPTESGYATKDNIK 303

Query: 282 QTGEGKGEGFNCNI------TWPT----GGVGDAEYMWAFEQV----------IMPMGRE 321
                  +  + NI      TW T      +   +Y   F +           +  M + 
Sbjct: 304 NASTCVMDAHDLNIWNVHLQTWATEEDFNKLYQTKYRTLFAKADEFFKNAKNQMQEMNKP 363

Query: 322 FEPDLVLISSGFDAADGD-TIGQCH---VTPACYGHMTHMLLSLAK----GNLCVVLEGG 373
           F+  LV+IS+GFDA++ + T  Q H   V  + Y   T   L LA+    G +  VLEGG
Sbjct: 364 FK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSVLEGG 422

Query: 374 YNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGN 433
           Y+  +IA    GV   L+G     L          ++++I+ ++R     W+ +K +   
Sbjct: 423 YSDKAIAS---GVFSHLIG-----LQNQNWIKEWGSEQVIKEIVRGCKPSWTPYKTKKSR 474

Query: 434 DGI 436
           D I
Sbjct: 475 DVI 477

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 93/374 (24%), Positives = 150/374 (40%), Gaps = 75/374 (20%)

Query: 127 ILQVHSRQHLDFISQTEQLERESLLK-ETEGGDSVYFNNDSYLSAKL--SCGGAIEACKA 183
           +L+VH       + +  Q+    LLK E E  D+ + + D YLS+K   +  G I A + 
Sbjct: 110 VLKVHGSSWPAELIELCQMADAKLLKGEIEVPDT-WNSGDIYLSSKTIKALQGTIGAIET 168

Query: 184 VVEGRVK---------NSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
            V+   K          +   +RPPGHH       GFCL +N  VA      +Y  +V  
Sbjct: 169 GVDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NVTH 226

Query: 235 IMIVDWDIHHGNGTQ------------------------KAFYDDDRVLYVSLHRYQLGK 270
           ++++D+D+HHG+GTQ                        K F +  +V Y S+H      
Sbjct: 227 VVVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSMHDINSFP 286

Query: 271 YYPG-TIHGNYDQTGEGKGEGFNCNI------TWPTGGVGDAEY------MWA-----FE 312
              G     N            + NI       W T    +  Y      ++A     F 
Sbjct: 287 TESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADEFFR 346

Query: 313 QVIMPMGREFEP--DLVLISSGFDAADGD-TIGQCH---VTPACYGHMTHMLLSLAK--- 363
              + M ++  P   LV+IS+GFDA++ + T  Q H   V  + Y   T   L LA+   
Sbjct: 347 SAKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHC 406

Query: 364 -GNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSK 422
            G +  ++EGGY+  +I     GV   L+G     L          ++++++ ++R    
Sbjct: 407 HGKVLSLMEGGYSDKAICS---GVFAHLIG-----LQNQDWVKEWGSEQVVKEIVRGCKP 458

Query: 423 YWSCFKNRHGNDGI 436
            W  +K +   D I
Sbjct: 459 AWKPYKTKRAKDVI 472

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 91/375 (24%), Positives = 147/375 (39%), Gaps = 77/375 (20%)

Query: 127 ILQVH-SRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKL--SCGGAIEACKA 183
           + +VH S    + I   ++ + + L  E E  D+ + + D YLS+K   +  G I A + 
Sbjct: 110 VFKVHGSHWPAELIKLCQEADSKLLKGEIEVPDT-WNSGDIYLSSKTIKALQGTIGAIET 168

Query: 184 VVEGRVK---------NSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRK 234
            V+   K          +   +RPPGHH       GFCL +N  VA      +Y  +V  
Sbjct: 169 GVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NVTH 226

Query: 235 IMIVDWDIHHGNGTQ------------------------KAFYDDDRVLYVSLHRYQLGK 270
           ++++D+D+HHG+GTQ                        K F +  +V Y S+H      
Sbjct: 227 VVVLDFDLHHGDGTQDICWKRAGFKPEEEAKDTSYDDFGKKFAEFPKVGYFSMHDINSFP 286

Query: 271 YYPG-TIHGNYDQTGEGKGEGFNCNI------TWPTGGVGDAEYMWAFEQV--------- 314
              G     N            + NI       W T    +  Y   +  +         
Sbjct: 287 TESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADEFFK 346

Query: 315 -----IMPMGREFEPDLVLISSGFDAADGD-TIGQCH---VTPACYGHMTHMLLSLAK-- 363
                +   G+ FE  LV+IS+GFDA++ + T  Q H   V    Y   T   L LA+  
Sbjct: 347 SAKVEMKQQGKSFE-GLVVISAGFDASEFEQTSMQRHSVNVPTYFYTTFTKDALKLAQMH 405

Query: 364 --GNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQS 421
             G +  ++EGGY+  +I     GV   L+G     L          ++++++ ++R   
Sbjct: 406 CHGKVLSLMEGGYSDKAICS---GVFAHLIG-----LQNQDWVNEWGSEQVVKEIVRGCK 457

Query: 422 KYWSCFKNRHGNDGI 436
             W  +K R   D I
Sbjct: 458 PAWKPYKTRRAKDVI 472

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 123/298 (41%), Gaps = 41/298 (13%)

Query: 201 HHAEPEIAGGFCLFSNVAVAAANMLKSYPESV---RKIMIVDWDIHHGNGTQKAFYDDDR 257
           HHA    A GFC  +++ V+  N L+  P      RK+  +D D+HHG+G + AF     
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 258 VLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTG-GVGDAEYMWAFEQVIM 316
           +  +S+H ++ G +YP T    +     GK +  N  I  P   G+ ++        +I+
Sbjct: 265 IQIISIHLFEPG-FYPCTGGLKF-----GKPKSNNI-INLPVKHGLSNSNMFELVTNIII 317

Query: 317 PMGREFEPDLVLISSGFDAADGDTIGQCHVT----PACYGHMTHMLLSLAKGNLC--VVL 370
           P+    + D ++I  G D  + D   +  +T      C   +    +   +   C  VVL
Sbjct: 318 PLIELHQSDDIVILCGGDGLNNDYYNEWQLTIIGLTRCIIKIIAAFVGPHQPGSCKNVVL 377

Query: 371 EGG----------------YNLDSIAKSALGVCKVLVGE-PPDELPAPKKQPTPEAKKMI 413
            GG                Y +  +A         L  E P   +    K+   +  + I
Sbjct: 378 LGGGGYNELLASRFYTYLTYKVLQLAGRIPPAATTLAAEVPHGTIDDKDKELLIKDHEHI 437

Query: 414 ETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIRE----YQVSQLSS 467
           +   +   KYW C++  +G DG++FK  I    DT+  P    I E    Y +S++ S
Sbjct: 438 DEYEKEYYKYW-CYEIENGLDGLSFKRQINYN-DTKQKPFTKYIAELRAHYGISRILS 493

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 84/176 (47%), Gaps = 11/176 (6%)

Query: 201 HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLY 260
           HHA  + A GFC + N  V     L+S  +  +++  +D+D+HHG+G ++AF     V  
Sbjct: 195 HHAMKKRASGFC-YVNDIVLLIQKLRS--KGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 261 VSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGR 320
           +S+H ++ G ++P +  G+ +   +GK      NI     G+ D        QV++P+  
Sbjct: 252 ISMHLFECG-FFPTS--GSLEDNKKGKNIA---NIPL-AHGLNDEYLNEIVTQVVIPLTD 304

Query: 321 EFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVL-EGGYN 375
              P +++I  G D   GD   +  +T          +++  K    V+L  GGYN
Sbjct: 305 RHSPQVIIIQCGGDGLMGDEYNEWQLTIKGLCENILKIVNRYKNCSIVLLGGGGYN 360

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 9/110 (8%)

Query: 147 RESLLK--ETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGR-----VKNSIAVVRPP 199
           RE  L+  E+     +Y N+D+ ++ K S G       ++  G         +   +RPP
Sbjct: 133 REGKLEVPESWNAGDIYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRAFVAIRPP 192

Query: 200 GHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQ 249
           GHH    +  GFCL +N  +       +Y   V  ++++D+D+HHG+GTQ
Sbjct: 193 GHHCHVGMPSGFCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQ 240

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 65/139 (46%), Gaps = 17/139 (12%)

Query: 306 EYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIG----QCHVTPACYGHMTHMLLSL 361
           E+  A +  +  MG+ ++  LVLISSGFDA++ + +       +V    Y   T   L L
Sbjct: 346 EFFKAAKLEMASMGKPYK-GLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKL 404

Query: 362 AK----GNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVI 417
           A+    G +  ++EGGY+  +I     GV   L+G     L          ++++++ ++
Sbjct: 405 AQMHCHGKVISIMEGGYSDKAITS---GVFAHLIG-----LQNQDWIKEWGSEQVVKEIV 456

Query: 418 RTQSKYWSCFKNRHGNDGI 436
           R     W  +K +  +D I
Sbjct: 457 RGCKPTWKPYKTKRNDDVI 475

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 78/342 (22%), Positives = 133/342 (38%), Gaps = 75/342 (21%)

Query: 156 GGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIA-----VVRPPGHHAEPEIAGG 210
            GD +Y ++ +  + + S G       ++  G   + I+      +RPPGHH   +   G
Sbjct: 145 AGD-IYLSSRTIEALQGSIGALETGVDSIFSGPSPDHISNRAFVAIRPPGHHCHVDTPSG 203

Query: 211 FCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQ--------------------- 249
           FCL +N  +A      +Y   +   +I+D+D+HHG+GTQ                     
Sbjct: 204 FCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDICWKRAGFRTEAEPETTEGY 261

Query: 250 ----KAFYDDDRVLYVSLH---RYQLGKYYPGTIHGNYDQTGEGKGEGFNCNI------T 296
               K F +  +V Y S+H    +     Y      N            + NI       
Sbjct: 262 DEFGKKFAEFPKVGYFSMHDINSFPTESQY--ATKENIRNASTCVMNAHDVNIWNIHLSP 319

Query: 297 WPTGGVGDAEYMWAFEQVIM--------------PMGREFEPDLVLISSGFDAADGD-TI 341
           W T    D  Y   +  +                 +G+ F+  LV+IS+GFDA++ + T 
Sbjct: 320 WETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQ-GLVVISAGFDASEFEQTS 378

Query: 342 GQCH---VTPACYGHMTHMLLSLAK----GNLCVVLEGGYNLDSIAKSALGVCKVLVGEP 394
            Q H   V    Y   T   L L++    G +  ++EGGY+  +IA    GV   L+G  
Sbjct: 379 MQRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYSDKAIAS---GVFSHLIG-- 433

Query: 395 PDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGI 436
              L          ++++++ ++R    +W  +K +   D I
Sbjct: 434 ---LQNQNWIKEWGSEQVVKEIVRGCKPHWKPYKTKKSRDVI 472

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 101/254 (39%), Gaps = 59/254 (23%)

Query: 192 SIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQ-- 249
           +   +RPPGHH+      GFCL +N  +A      +Y  +V   +++D+D+HHG+GTQ  
Sbjct: 187 AFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NVTHAVVLDFDLHHGDGTQDI 244

Query: 250 ----------------------KAFYDDDRVLYVSLHRY-----QLGKYYPGTIHG---- 278
                                 K F +  +V Y S+H       +LG      I      
Sbjct: 245 CWKRAGFKPDECADSGEFDEFGKKFAEYPKVGYFSVHDINSFPTELGYATKENIRNAATC 304

Query: 279 ----------NYDQTGEGKGEGFN--CNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDL 326
                     N         E F       + T      E+    +Q +  +G+ F+  L
Sbjct: 305 IMDAHDVNIWNVHLQPYDSEEAFTKLYQTKYRTLFAKADEFFRISKQTMKALGKPFK-GL 363

Query: 327 VLISSGFDAADGDTIG-QCH---VTPACYGHMTHMLLSLAK----GNLCVVLEGGYNLDS 378
           V+IS+GFDA++ +    Q H   V    Y   T   L LA+    G +  V+EGGY+  +
Sbjct: 364 VVISAGFDASEYEQPSMQRHAVNVPTFFYNTFTKDALKLAQMHSHGKVLSVMEGGYSDGA 423

Query: 379 IAKSALGVCKVLVG 392
           I     GV   L+G
Sbjct: 424 ITS---GVFAHLIG 434

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 115/292 (39%), Gaps = 70/292 (23%)

Query: 165 DSYLSAKL--SCGGAIEACKAVVEG--------RVKNSIAV-VRPPGHHAEPEIAGGFCL 213
           D YL+++   +  G I A +  V+          + N + V +RPPGHH       GFCL
Sbjct: 144 DIYLTSRTIEALQGTIGAVETGVDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSGFCL 203

Query: 214 FSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQ------------------------ 249
            +N  +        Y   V   +I+D+D+HHG+GTQ                        
Sbjct: 204 LNNAHIGIEYAADKY--GVTHAVILDFDLHHGDGTQDLCWKRAGFKPDEHTEEDGYDEFG 261

Query: 250 KAFYDDDRVLYVSLHRYQLGKYYPG-TIHGNYDQTGEGKGEGFNCNI------TWPT--- 299
           K F +  +V Y S+H         G     N            + NI       W T   
Sbjct: 262 KKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTCIMNSHDLNIWNVHLSRWSTEEE 321

Query: 300 -GGVGDAEYMWAFEQV----------IMPMGREFEPDLVLISSGFDAADGD-TIGQCH-- 345
              +  ++Y   F +           +  +G+ F+  LV+IS+GFDA++ + T  Q H  
Sbjct: 322 FAKIYKSKYRTLFAKADEFFKNSKNEMNELGKPFK-GLVVISAGFDASEFEQTSMQRHSV 380

Query: 346 -VTPACYGHMTHMLLSLA----KGNLCVVLEGGYNLDSIAKSALGVCKVLVG 392
            V  + Y   T   L LA    +G +  +LEGGY+  +I     GV   L+G
Sbjct: 381 NVPTSFYTMFTKDALKLAQMHCQGKVLSLLEGGYSDKAITS---GVFSHLIG 429

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 86/334 (25%), Positives = 131/334 (39%), Gaps = 77/334 (23%)

Query: 127 ILQVHSRQHLDFISQTEQLERES----LLKETE------GGDSVYFNNDSYLSAKLSCGG 176
           +L+VH +   D+  Q  +L +E+      KE E       GD +Y ++ +  + + S G 
Sbjct: 106 VLKVHGK---DWPPQLLRLCKEADAKLAAKEVEVPASWNAGD-IYLSSKTVEALQGSIGA 161

Query: 177 AIEACKAVVEGRVKNSIA-----VVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPES 231
              A  ++ +G     I+      +RPPGHH       GFCL +N  VA       +   
Sbjct: 162 LETAVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGFCLLNNAHVAIEYAKDRF--G 219

Query: 232 VRKIMIVDWDIHHGNGTQ-------------------------KAFYDDDRVLYVSLHRY 266
           V    I+D+D+HHG+GTQ                         K F +  RV Y S+H  
Sbjct: 220 VTHAAILDFDLHHGDGTQDICWKRAGFRPDEEDEDSPGYDSFGKKFAEYPRVGYFSMHDI 279

Query: 267 QLGKYYPG-TIHGNYDQTGEGKGEGFNCNI------TWPT----GGVGDAEYMWA----- 310
                  G     N            + NI       W T      +   +Y        
Sbjct: 280 NSFPTESGYATKENVKNASTCIMNAHDVNIWNIHLSPWETEEDFAKLYHTKYRSLFVKAD 339

Query: 311 --FEQVIMPMGREFEP--DLVLISSGFDAADGD-TIGQCH---VTPACYGHMTHMLLSLA 362
             F+Q  + M  + +P   LV+ISSGFDA++ + T  Q H   V    Y   T   L L+
Sbjct: 340 EFFKQGKIEMAAQNKPFKGLVVISSGFDASEFEQTSMQRHGTNVPTYFYTAFTKDALKLS 399

Query: 363 K----GNLCVVLEGGYNLDSIAKSALGVCKVLVG 392
           +    G +  ++EGGY+  +I     GV   L+G
Sbjct: 400 QMHCHGKVLSIMEGGYSDKAIVS---GVFAHLIG 430

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 114/293 (38%), Gaps = 71/293 (24%)

Query: 165 DSYLSAKL--SCGGAIEACKAVV---------EGRVKNSIAVVRPPGHHAEPEIAGGFCL 213
           D YLS+K   +  G+I A +  +         E     +   +RPPGHH +     GFCL
Sbjct: 149 DIYLSSKTIEALEGSIAAIETGIDSIFNGPSPEHICNRAFVAIRPPGHHCKVATPSGFCL 208

Query: 214 FSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQ------------------------ 249
            +N  ++       Y   +   +I+D+D+HHG+GTQ                        
Sbjct: 209 LNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDICWKRAGFRSEDEPEGSEGYDDF 266

Query: 250 -KAFYDDDRVLYVSLHRYQLGKYYPG-TIHGNYDQTGEGKGEGFNCNITW-----PTGGV 302
            K F +  +V Y S+H         G     N         +G + NI W     P    
Sbjct: 267 GKKFAEFPKVGYFSMHDINSFPTETGYATKVNIRNASTCIMDGHDLNI-WNIHLSPWNTE 325

Query: 303 GDAEYMWA-------------FEQVIMPMGREFEP--DLVLISSGFDAADGD-TIGQCH- 345
            D + ++              F      M +E +P   LV+IS+GFDA++ + T  Q H 
Sbjct: 326 EDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFKGLVVISAGFDASEYEQTSMQRHN 385

Query: 346 --VTPACYGHMTHMLLSLA----KGNLCVVLEGGYNLDSIAKSALGVCKVLVG 392
             V    Y   T   L LA    +G +  +LEGGY+  ++     GV   L+G
Sbjct: 386 VNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYSDKALTS---GVFAHLIG 435

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 95/232 (40%), Gaps = 24/232 (10%)

Query: 201 HHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLY 260
           HHA    A GFC  +++ +    + K+      ++  VD+D+HHG+  + AF     V  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 261 VSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTG-----GVGDAEYMWAFEQVI 315
            SLH ++ G ++PGT            G   NC  T         G+ D       + ++
Sbjct: 252 CSLHLFEAG-FFPGT------------GSFKNCRETNVVNIPLFHGLDDESLDEIVDNIL 298

Query: 316 MPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVL-EGGY 374
           +P   + +P++++I  G D   GD   +  +T          L+ +      V+L  GGY
Sbjct: 299 IPCVNKHDPEVLVIQCGADGLSGDKYKEWQLTIHGLTRNILKLVDIHSYKKVVLLGGGGY 358

Query: 375 N--LDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKYW 424
           N  L S   + + VC +   +    L +  +        +I+   +   K+W
Sbjct: 359 NPTLQSRFYTYVTVCLLKYHKGIPSLISDSEDEHIIEHHLIDFYRKEAYKFW 410

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 185 VEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHH 244
           VE     +   +RPPGHH+      GFCL +N  +A     + Y   V   +I+D+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 245 GNGTQ 249
           G+GTQ
Sbjct: 234 GDGTQ 238

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 13/96 (13%)

Query: 165 DSYLSAKL--SCGGAIEACKAVVEGRVK---------NSIAVVRPPGHHAEPEIAGGFCL 213
           D YLS+K   +  G+I A +  V+   K          +   +RPPGHH       GFC+
Sbjct: 146 DIYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSGFCV 205

Query: 214 FSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQ 249
            +N  VA      SY   V  + ++D+D+HHG+GTQ
Sbjct: 206 LNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQ 239

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 47/96 (48%), Gaps = 13/96 (13%)

Query: 165 DSYLSAKL--SCGGAIEACKAVVEGRVK---------NSIAVVRPPGHHAEPEIAGGFCL 213
           D YLS+K   +  G I A +  V+   K          +   +RPPGHH       GFCL
Sbjct: 146 DIYLSSKTIQALQGTIGALETGVDSIFKGPSADHISNRAFVAIRPPGHHCHFATPSGFCL 205

Query: 214 FSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQ 249
            +N  VA      +Y   V  + ++D+D+HHG+GTQ
Sbjct: 206 LNNAHVAIEYAADTY--GVTHVAVLDFDLHHGDGTQ 239

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 48/95 (50%), Gaps = 12/95 (12%)

Query: 306 EYMWAFEQVIMPMGREFEPDLVLISSGFDAADGD-TIGQCH---VTPACYGHMTHMLLSL 361
           EY    +  +  +GR F+  +VLIS+GFDA++ + T  Q H   V    Y   T   L L
Sbjct: 343 EYFKTAKLEMAALGRPFK-GMVLISAGFDASEFEQTTMQRHGSNVPTEFYTMFTKDALKL 401

Query: 362 A----KGNLCVVLEGGYNLDSIAKSALGVCKVLVG 392
           A    +G +  ++EGGY+  +I     GV   L+G
Sbjct: 402 AQMHCQGKVLSLMEGGYSDKAITS---GVFAHLIG 433

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 49/103 (47%), Gaps = 8/103 (7%)

Query: 152 KETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIA-----VVRPPGHHAEPE 206
           KE   GD +Y ++ +  + + + G        +  G     I+     VVRPPGHH    
Sbjct: 139 KEWNAGD-IYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVVVRPPGHHCHVT 197

Query: 207 IAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQ 249
              GFCL +N  ++      +Y   V    I+D+D+HHG+GTQ
Sbjct: 198 GPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQ 238

>Smik_16.223 Chr16 (406804..410484) [3681 bp, 1226 aa] {ON} YPL012W
           (REAL)
          Length = 1226

 Score = 38.5 bits (88), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 55/137 (40%), Gaps = 30/137 (21%)

Query: 295 ITWPTGGVGDAEYMWAFEQVIMPMGREF-EPDLVLISS---GFDAADGDTIGQCH----- 345
           +   T  V +     AF+ +I  MGR+  EP+ ++  S   G+D A  D +         
Sbjct: 830 VILSTKDVNEKSRETAFDTLI-NMGRKMNEPNSIIKLSQIPGYDPATPDQLSSISEFFKI 888

Query: 346 VTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDS--------------------IAKSALG 385
           ++    G   HM+ S   G  C+V E    +DS                    I KSA+G
Sbjct: 889 ISAGLIGESQHMVSSSITGYACLVFEFKNEIDSGILMDIYDTIELYLTSNSREIVKSAIG 948

Query: 386 VCKVLVGEPPDELPAPK 402
             KV V   P+EL  PK
Sbjct: 949 FTKVCVLGLPEELMRPK 965

>TBLA0B01060 Chr2 (231926..235579) [3654 bp, 1217 aa] {ON} Anc_2.113
           YHR131C Can't fix the STOP. Huge compared with the rest
           of the pillar.
          Length = 1217

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 6/48 (12%)

Query: 37  PVIVPPTKPKIRYSLLK-TGICYDVRMRYHAKIFTSYFEYIDPHPEDP 83
           P I PPT P+IR +  K TG        Y A    ++F+YID  P DP
Sbjct: 264 PDICPPTSPRIRTTPRKSTGGTV-----YFADEENTFFKYIDSRPSDP 306

>NCAS0A14380 Chr1 complement(2832482..2833459) [978 bp, 325 aa] {ON}
           Anc_7.391
          Length = 325

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 72/169 (42%), Gaps = 24/169 (14%)

Query: 31  KDESQRPVIVPPTKPKIRYSLLKTGICYDV-RMRYHAKIFTSYFEY-IDPHPEDPRRI-Y 87
           KD+S+ P+       K+  +LL+T  C +V  M  HA     +F   +D    +P  + Y
Sbjct: 111 KDKSRAPI-----TAKLIANLLETAGCDNVITMDLHASQIQGFFHIPVDNLYGEPSVLNY 165

Query: 88  RVYKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLER 147
              KI  +N ++  P   GA  +  L  K+ +  A       +H  +      +  ++ R
Sbjct: 166 VRTKIDLKNAILVSPDAGGAKRVASLADKLDLNFA------LIHKERQ-----KANEVSR 214

Query: 148 ESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVV 196
             L+ +  G   +  ++ +      +CG  ++AC  ++    K  IA+V
Sbjct: 215 MVLVGDVTGKSCLLIDDMAD-----TCGTLVKACDTLLNHGAKEVIAIV 258

>YPL095C Chr16 complement(368071..369441) [1371 bp, 456 aa] {ON}
           EEB1Acyl-coenzymeA:ethanol O-acyltransferase responsible
           for the major part of medium-chain fatty acid ethyl
           ester biosynthesis during fermentation; possesses
           short-chain esterase activity; may be involved in lipid
           metabolism and detoxification
          Length = 456

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 10/87 (11%)

Query: 596 GGIVHLLGHRDTRSVVKCAISFLDKK---PLKVMVPLIDETLGDW--YFKNSLVFTSSTH 650
           G + H+LG + T+S     ++F D K   PL   V     TL D   +  NSL+FT    
Sbjct: 19  GTVKHVLGEKGTKS-----LAFRDSKRQIPLHEFVTKHVPTLKDGANFRLNSLLFTGYLQ 73

Query: 651 SCWGSTANENKKLRKKYGRVLKADCDG 677
           + + S  + +KK +  YGR +    DG
Sbjct: 74  TLYLSAGDFSKKFQVFYGREIIKFSDG 100

>Smik_16.142 Chr16 complement(251287..252657) [1371 bp, 456 aa] {ON}
           YPL095C (REAL)
          Length = 456

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 10/87 (11%)

Query: 596 GGIVHLLGHRDTRSVVKCAISFLDKK---PLKVMVPLIDETLGDW--YFKNSLVFTSSTH 650
           G + H+LG + T+     A++F D K   PL   V     TL D   +  NSL+FT    
Sbjct: 19  GTVKHVLGEKGTK-----ALAFRDSKCQIPLHEFVTKHVPTLKDGANFRLNSLLFTGYLQ 73

Query: 651 SCWGSTANENKKLRKKYGRVLKADCDG 677
           + + S  + +KK +  YGR +    DG
Sbjct: 74  TLYMSGGDFSKKFQVFYGREIVKFSDG 100

>SAKL0F12452g Chr6 complement(971802..972758) [957 bp, 318 aa] {ON}
           highly similar to uniprot|P38620 Saccharomyces
           cerevisiae YER099C PRS2 5-phospho-ribosyl-1(alpha)-
           pyrophosphate synthetase involved in nucleotide
           histidine and tryptophan biosynthesis one of a five
           related enzymes which are active as heteromultimeric
           complexes
          Length = 318

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 73/169 (43%), Gaps = 24/169 (14%)

Query: 31  KDESQRPVIVPPTKPKIRYSLLKTGIC-YDVRMRYHAKIFTSYFEY-IDPHPEDPRRI-Y 87
           KD+S+ P+       K+  +LL+T  C + + M  HA     +F   +D    +P  + Y
Sbjct: 104 KDKSRAPI-----TAKLIANLLQTAGCDHVITMDLHASQIQGFFHIPVDNLYAEPSVLNY 158

Query: 88  RVYKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLER 147
              K   +N ++  P   GA  +  +  K+ +  A       +H  +      +  ++ R
Sbjct: 159 IRTKTDFDNAILVSPDAGGAKRVASIADKLDLNFA------LIHKERQ-----KANEVSR 207

Query: 148 ESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVV 196
             L+ + +G   +  ++ +      +CG  ++AC  ++E   K  IA++
Sbjct: 208 MVLVGDVKGKSCLLVDDMAD-----TCGTLVKACDTLLENGAKEVIAII 251

>CAGL0I05500g Chr9 (520414..521373) [960 bp, 319 aa] {ON} highly
           similar to uniprot|P38620 Saccharomyces cerevisiae
           YER099c PRS2 ribose-phosphate pyrophosphokinase
          Length = 319

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 72/169 (42%), Gaps = 24/169 (14%)

Query: 31  KDESQRPVIVPPTKPKIRYSLLKTGIC-YDVRMRYHAKIFTSYFEY-IDPHPEDPRRI-Y 87
           KD+S+ P+       K+   +L+T  C + + M  HA     +F   +D    +P  + Y
Sbjct: 104 KDKSRAPI-----TAKLIAKMLETAGCDHVITMDLHASQIQGFFHIPVDNLYAEPSVLNY 158

Query: 88  RVYKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLER 147
              K   +N ++  P   GA  +  L  K+ +  A       +H  +      +  ++ R
Sbjct: 159 IRTKTDLKNTILVSPDAGGAKRVASLADKLDLNFA------LIHKERQ-----KANEVSR 207

Query: 148 ESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVV 196
             L+ + +G   +  ++ +      +CG  ++AC  ++E   K  IA+V
Sbjct: 208 MVLVGDVQGKSCLLIDDMAD-----TCGTLVKACDTLLEHGAKEVIAIV 251

>ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
          Length = 494

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 88  RVYKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFIS--QTEQL 145
           R+YK+LA   ++ +   S  DS G  ++K     AE ++  Q +S      IS  + + L
Sbjct: 34  RIYKLLAPTRIVSEIKTSADDSTGSTLLKYNRSGAETKKSAQCNSLTFRPNISLLKRDPL 93

Query: 146 ERESLLKETEGGDS 159
            R  +++ T GG S
Sbjct: 94  SRVHIIQATFGGVS 107

>KNAG0F00840 Chr6 complement(152366..153616) [1251 bp, 416 aa] {ON}
           Anc_2.13 YNL230C
          Length = 416

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 12/110 (10%)

Query: 87  YRVYKILAENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLE 146
           YRVY+IL +  L++D TL G  ++   M+    ++ E+ +  QV  R  +    Q +  +
Sbjct: 113 YRVYRILLKRWLVRDATL-GKYNVPYRMLYFKYQQDEKRKQEQVVERLRI----QVQMAK 167

Query: 147 RESLLKETEG-GDSVYFNN------DSYLSAKLSCGGAIEACKAVVEGRV 189
           +E  LK T    +S Y NN          S KL     +   K VV   V
Sbjct: 168 KERELKSTVAVNESFYINNIKNKTRKGPSSVKLQSQFGVSKPKTVVRRNV 217

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 80,105,513
Number of extensions: 3682972
Number of successful extensions: 10095
Number of sequences better than 10.0: 114
Number of HSP's gapped: 10155
Number of HSP's successfully gapped: 132
Length of query: 704
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 587
Effective length of database: 40,065,477
Effective search space: 23518434999
Effective search space used: 23518434999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)