Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E08361g2.286ON49149125410.0
Kwal_27.115322.286ON47949217750.0
KLTH0G10362g2.286ON52949317670.0
Ecym_33252.286ON49649217620.0
NDAI0G006602.286ON49649817320.0
ADL215W2.286ON48449117200.0
SAKL0E07678g2.286ON47749217150.0
TPHA0C034002.286ON49449616580.0
Kpol_1003.382.286ON49650016510.0
KAFR0H033102.286ON48849616250.0
CAGL0M06941g2.286ON49249716190.0
TDEL0G021702.286ON48449416060.0
NCAS0G037902.286ON49250216060.0
ZYRO0A01892g2.286ON46549315990.0
TBLA0B069602.286ON50850815860.0
Skud_14.3072.286ON49049615670.0
KNAG0H020002.286ON49849915610.0
Suva_14.3252.286ON49049615590.0
YNL022C2.286ON49049715580.0
Smik_14.3092.286ON49049615210.0
ADL254W2.247ON6032451633e-11
KAFR0B022208.171ON6863031633e-11
Kpol_1003.152.247ON6332701625e-11
SAKL0E08624g2.247ON6112671591e-10
TPHA0C031502.247ON6082401572e-10
NCAS0G030302.247ON4902651572e-10
KLLA0F03399g2.247ON6192451572e-10
NDAI0B018308.171ON6863051572e-10
ZYRO0A01562g2.247ON6172451572e-10
CAGL0J10032g2.247ON6192651572e-10
NDAI0D010502.247ON6252651562e-10
TBLA0E038502.247ON6322701553e-10
Skud_2.818.171ON6813051544e-10
KNAG0I018702.247ON6292401545e-10
Smik_14.2662.247ON6182621535e-10
AFR179C8.171ON7003031545e-10
TDEL0C041502.247ON6142651536e-10
KLTH0G09460g2.247ON6372731536e-10
YNL061W (NOP2)2.247ON6182401526e-10
Suva_14.2802.247ON6202401526e-10
TDEL0B043908.171ON6733051537e-10
Ecym_32842.247ON6062451528e-10
Kpol_1002.1098.171ON6703051511e-09
KAFR0J009702.247ON6102451501e-09
Skud_14.2712.247ON6192621483e-09
NCAS0B043908.171ON6713401464e-09
ZYRO0G08998g8.171ON6833051464e-09
Kwal_23.48412.247ON6272781464e-09
TBLA0A087408.171ON6863411412e-08
TPHA0H001508.171ON6493091402e-08
Suva_2.978.171ON6703031393e-08
SAKL0H19448g8.171ON6913031384e-08
Smik_2.928.171ON6743051375e-08
TPHA0C028708.171ON6743271375e-08
CAGL0K01991g8.171ON6722971366e-08
KNAG0G015108.171ON6663021366e-08
KNAG0D020508.171ON6823031367e-08
YBL024W (NCL1)8.171ON6843081331e-07
KLLA0F12562g8.171ON7043031332e-07
NDAI0B029808.171ON6793051304e-07
KLTH0H08096g8.171ON6883001277e-07
Ecym_23538.171ON6903031214e-06
NCAS0B056408.171ON6593041181e-05
Kwal_14.20818.171ON272130820.15
TPHA0A034303.390ON49791820.21
KLTH0F01826g1.60ON66348780.69
ZYRO0C12430g3.431ON482104751.3
TBLA0F025406.123ON126356723.3
KAFR0B066506.174ON57238704.8
Ecym_30036.1ON31974696.6
TBLA0H018805.370ON170849699.1
Kwal_27.121488.563ON55757689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08361g
         (491 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   983   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   688   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   685   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   683   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   671   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   667   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   665   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   643   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   640   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   630   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   628   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   623   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   623   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   620   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   615   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   608   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   605   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   605   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   604   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   590   0.0  
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    67   3e-11
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    67   3e-11
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    67   5e-11
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    66   1e-10
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    65   2e-10
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    65   2e-10
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    65   2e-10
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    65   2e-10
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    65   2e-10
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    65   2e-10
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    65   2e-10
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    64   3e-10
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    64   4e-10
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    64   5e-10
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    64   5e-10
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    64   5e-10
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    64   6e-10
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    64   6e-10
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    63   6e-10
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    63   6e-10
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    64   7e-10
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    63   8e-10
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    63   1e-09
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    62   1e-09
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    62   3e-09
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    61   4e-09
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    61   4e-09
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    61   4e-09
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    59   2e-08
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    59   2e-08
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    58   3e-08
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    58   4e-08
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    57   5e-08
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    57   5e-08
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    57   6e-08
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    57   6e-08
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    57   7e-08
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    56   1e-07
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    56   2e-07
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    55   4e-07
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    54   7e-07
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    51   4e-06
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    50   1e-05
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    36   0.15 
TPHA0A03430 Chr1 complement(751127..752620) [1494 bp, 497 aa] {O...    36   0.21 
KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} simila...    35   0.69 
ZYRO0C12430g Chr3 (981824..981840,981909..983340) [1449 bp, 482 ...    33   1.3  
TBLA0F02540 Chr6 (615371..619162) [3792 bp, 1263 aa] {ON} Anc_6....    32   3.3  
KAFR0B06650 Chr2 complement(1386066..1387784) [1719 bp, 572 aa] ...    32   4.8  
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    31   6.6  
TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5....    31   9.1  
Kwal_27.12148 s27 (1107013..1108686) [1674 bp, 557 aa] {ON} YPL0...    31   9.9  

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/491 (97%), Positives = 477/491 (97%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDDGEDVTPVRWIRINPILVKERYDDVLAELNKKFPQ 180
           RLKAE              QLIKTDDGEDVTPVRWIRINPILVKERYDDVLAELNKKFPQ
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDDGEDVTPVRWIRINPILVKERYDDVLAELNKKFPQ 180

Query: 181 RVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNS 240
           RVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNS
Sbjct: 181 RVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNS 240

Query: 241 TDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAKG 300
           TDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAKG
Sbjct: 241 TDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAKG 300

Query: 301 VKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTSV 360
           VKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTSV
Sbjct: 301 VKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTSV 360

Query: 361 EPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVVI 420
           EPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVVI
Sbjct: 361 EPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVVI 420

Query: 421 DLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEAKELAEGCIRALPKEDGG 480
           DLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEAKELAEGCIRALPKEDGG
Sbjct: 421 DLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEAKELAEGCIRALPKEDGG 480

Query: 481 IGFFAVCFERD 491
           IGFFAVCFERD
Sbjct: 481 IGFFAVCFERD 491

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/492 (68%), Positives = 400/492 (81%), Gaps = 14/492 (2%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           M FYRDATWVLE+VE+  S   RVAGSLQTLVL SCK+Y LKTNP+H+YA V S W+Y E
Sbjct: 1   MNFYRDATWVLEYVEKAESSG-RVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNE 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           +L+K++KKS IL+DVPKKKGK +FN  TI+LLVHDLL +K+KRIQMGKHP+K F+LKH+T
Sbjct: 60  FLEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKT 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDDGEDVTPVRWIRINPILVKERYDDVLAELNKKFPQ 180
           RL +E              QL+K DD  D+TPVRW RINP+    ++++V+AEL KKFP 
Sbjct: 120 RLNSELVRLKIKLKVTDLHQLLK-DDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPT 178

Query: 181 RVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNS 240
           RV+SWK +VPGSIY+DEYIPNLFG+HPGDKITSHE YK GKIIIQDRASCFPAHILNP+ 
Sbjct: 179 RVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSP 238

Query: 241 TDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAKG 300
           +DV+IDACAAPGNKTTHVAAH+F  ++ +     IHAFEKDPERAKTL+ MV TAGC+KG
Sbjct: 239 SDVIIDACAAPGNKTTHVAAHMF--LNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKG 296

Query: 301 VKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTSV 360
           + IHVGDFTKL KP LF NV+GFIVDPSCSGSGIFGR+ ID  N S+        ++ ++
Sbjct: 297 INIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSR--------EEGAL 348

Query: 361 EPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVVI 420
              E+E++  E  +D+KNRLAKL+SFQ++IVK+A+SFPSAKK+ YSTCSIHAEENER+VI
Sbjct: 349 PTQEEERQEIEG-KDIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVI 407

Query: 421 DLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPK-EEAKELAEGCIRALPKEDG 479
           DLLLDSKVKEWGW+VRKR G IPTWPRRG+  EFE+VF + + AKELAE CIR  PKEDG
Sbjct: 408 DLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDTAKELAEACIRVAPKEDG 467

Query: 480 GIGFFAVCFERD 491
           GIGFFAVCFERD
Sbjct: 468 GIGFFAVCFERD 479

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/493 (67%), Positives = 394/493 (79%), Gaps = 12/493 (2%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           M FYRDATWVLE+VE    K  RVAGSLQTLVL SCK+Y+LKTNP+HIYA V S W+Y E
Sbjct: 47  MNFYRDATWVLEYVESA-EKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNE 105

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           +LDK++K+SGIL+D+PKKKGK +FN  TI+LLVHDLL SK+KRIQMGKHP+K F+LK++ 
Sbjct: 106 FLDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKA 165

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDDGEDVTPVRWIRINPILVKERYDDVLAELNKKFPQ 180
           RL +E              QL+K DD  D+TPVRW R+NPI    + +D+L EL+KKFP 
Sbjct: 166 RLSSELVRLKIKLKVTDLQQLLK-DDRNDMTPVRWFRLNPIRCGAKSEDILQELSKKFPT 224

Query: 181 RVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNS 240
           RVNSW  I PG IY+DEYIP LFG+HP DKITSHE YK GK+IIQDRASCFPAHILN +S
Sbjct: 225 RVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNASS 284

Query: 241 TDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAKG 300
            D++IDACAAPGNKTTHVAAHIF   D  V+SV+IHAFEKDPERAKTL+ M+ TAGC KG
Sbjct: 285 EDLIIDACAAPGNKTTHVAAHIFQ--DQAVESVRIHAFEKDPERAKTLRTMINTAGCTKG 342

Query: 301 VKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKT-GSSNTDEDQTS 359
           +++HVGDFT+L KP  F +VTGFI+DPSCSGSGIFGRK ID  N SK  G+S  +E++  
Sbjct: 343 IEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEEEKE 402

Query: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVV 419
            E  +        ++DLKNRL KL+SFQ++IVKHAMSFPSAKK+ YSTCS+HAEENER+V
Sbjct: 403 EEREDIS------DKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIV 456

Query: 420 IDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEE-AKELAEGCIRALPKED 478
           +DLLLDSKVKEWGW+VRKR GVIPTW RRG+  EFEEVF  E+ AKELAE CIR  PKED
Sbjct: 457 VDLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTAKELAEACIRVAPKED 516

Query: 479 GGIGFFAVCFERD 491
           GGIGFFAVCFERD
Sbjct: 517 GGIGFFAVCFERD 529

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/492 (66%), Positives = 393/492 (79%), Gaps = 10/492 (2%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           MEFYRD++WVLE++EQE SK+ R++GSLQTLVL SCKRYKLKTNP+HIYAIVSS W+Y+ 
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           YL+KIIK SG+L DVP KKG+P+F+K TI LLVHDLLLSK+KRI MGKHPIK F+LK Q 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDDGEDVTPVRWIRINPILVKERYDDVLAELNKKFPQ 180
           RL  E              +L++ +D  D++PVRWIRINP   + + DDVL EL KKFP+
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELVEDNDA-DMSPVRWIRINPFRCQGKVDDVLKELRKKFPK 192

Query: 181 RVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNS 240
           +V+ W QIVPGSIY DEYIPNL+G+HP DKITSHE YKRGKIIIQDRASCFPA+ILNP  
Sbjct: 193 QVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPTP 252

Query: 241 TDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAKG 300
            DVVIDAC+APGNKTTH+AAHIF D +     VKI+AFE+D +RA+ L+ MV +AGC   
Sbjct: 253 HDVVIDACSAPGNKTTHIAAHIFPDGNA--SDVKIYAFERDAKRAEILEKMVTSAGCESC 310

Query: 301 VKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTSV 360
           ++I VGDFT+L KP++F++VTGFI+DPSCSGSGIFGR+++D  N SK      +E     
Sbjct: 311 IQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFEEQ 370

Query: 361 EPVEQEK-ELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVV 419
           +P E E+ EL+      K RLAKLSSFQ+QIVKHAMSFP+AKK+ YSTCSIHAEENERVV
Sbjct: 371 DPKEMEQNELY------KTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVV 424

Query: 420 IDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEAKELAEGCIRALPKEDG 479
           IDLLLD  +K++GWKV KR  VIP W RRG  SEFEEVFP E+A+ELA+GCIRALPKEDG
Sbjct: 425 IDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQAQELADGCIRALPKEDG 484

Query: 480 GIGFFAVCFERD 491
           GIGFFAVCFER+
Sbjct: 485 GIGFFAVCFERE 496

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/498 (64%), Positives = 398/498 (79%), Gaps = 10/498 (2%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           M FYRDATWVLE+VEQ+ +K  R++GSLQTLVL SC +YKLK NP+H+YA++ S W+Y+ 
Sbjct: 1   MNFYRDATWVLEYVEQQEAKG-RISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKP 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           YL+K++KKSGIL+D+PKKKGKP++++ T+ LL HDLL SKSKRIQMGKHPIK ++LKH++
Sbjct: 60  YLEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKS 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDDG-EDVTPVRWIRINPILVKERYD--DVLAELNKK 177
           RL +E              +++  +D  EDVTPVRWIRINP+   +  D   VL EL KK
Sbjct: 120 RLHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKK 179

Query: 178 FPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILN 237
           FP+RV +W  IVPGSIYYDEYIP+L+GIHP DKITSHE YK+GKIIIQDRASCFPAHILN
Sbjct: 180 FPKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILN 239

Query: 238 PNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGC 297
           P+  D++IDACAAPGNKTTHVA+++FGD   +   V+I+AFEKDPERAK L+ M+  AGC
Sbjct: 240 PSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGC 299

Query: 298 AKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQ 357
           +K +++ VGDFTK   P+ F++VTGFIVDPSCSGSGIFGRK +D +N  +   + TD+D+
Sbjct: 300 SKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDT-TDKDK 358

Query: 358 TSVE---PVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEE 414
            S E    V  E+E + K++DLK RLAKLSSFQ+Q++KHAMSFP+AKKI YSTCSIHAEE
Sbjct: 359 KSTEEDDEVPDEQEDYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEE 418

Query: 415 NERVVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEAK--ELAEGCIR 472
           NERVV+DLLLDSKVK+WGWKV  +  VIPTWPRRG   EFEEVF  + AK   LA+GCIR
Sbjct: 419 NERVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIR 478

Query: 473 ALPKEDGGIGFFAVCFER 490
           ALP++DGGIGFFAVCFER
Sbjct: 479 ALPRDDGGIGFFAVCFER 496

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/491 (63%), Positives = 392/491 (79%), Gaps = 7/491 (1%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           MEFYRDA+WVLE++EQE ++  +VAGSL +LVL S K+YKLK++ RH+YAIV+S W+Y+ 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           YLD+II+KSG+L+DVP+KKG+P F + T+ L+VHDLLLSK KRI MGKHP+K F+LKHQT
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDDGEDVTPVRWIRINPILVKERYDDVLAELNKKFPQ 180
           RL+ E               L++ D+ ED TPVRWIR+NP  ++ + ++VL EL KKFP+
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLVQ-DEREDATPVRWIRLNPFRIRGQREEVLQELQKKFPR 179

Query: 181 RVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNS 240
           RV  W+++ PGSIY DEY+  L+G+HP DKITSHE YKRGKIIIQDRASCFPA IL P  
Sbjct: 180 RVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILAPGR 239

Query: 241 TDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAKG 300
           +DV+IDACAAPGNKTTHVAAHIF   +   D  +IHAFE+DP+RAKTL+ M+ATAGC   
Sbjct: 240 SDVIIDACAAPGNKTTHVAAHIFP--EGGADHAQIHAFERDPQRAKTLRKMIATAGCDNA 297

Query: 301 VKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTSV 360
           +++HVGDFT+  +PE+F+NVTGFIVDPSCSGSGIFGR+ +D    ++ G   T+ D ++ 
Sbjct: 298 IEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKG---TETDPSAD 354

Query: 361 EPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVVI 420
            P E+  E  +   +LKNRLAKLSSFQ+QIVKHAMSFPSAKK+ YSTCS+HAEENERVVI
Sbjct: 355 VPEEETFEATKSAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERVVI 414

Query: 421 DLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEAKELAEGCIRALPKEDGG 480
           DLLLDSKV++ GWKV  R+ VIP WPRRG  +EFEEVFP ++A+ELA GCIR LPKEDGG
Sbjct: 415 DLLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFP-DQAEELAGGCIRVLPKEDGG 473

Query: 481 IGFFAVCFERD 491
           IGFFAVCFER+
Sbjct: 474 IGFFAVCFERE 484

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/492 (67%), Positives = 396/492 (80%), Gaps = 16/492 (3%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           M  YRDATWV E+VEQE SK K +AGSLQTLVL SCKRYKLKTNP+H+YAIV S W+Y+ 
Sbjct: 1   MNLYRDATWVFEYVEQEESKGK-IAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKP 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           +L+KI+KKSGIL+D+PKKKG+P F+  TI LLVHDLLLSK+KRIQMGKHPIK F+LKH+ 
Sbjct: 60  FLEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKV 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDDGEDVTPVRWIRINPILVKERYDDVLAELNKKFPQ 180
           RL+AE              QL+K DD  D+TPVRWIRINP+    + DDV  EL KKFP 
Sbjct: 120 RLQAELAKLKVKLRVTNLSQLVK-DDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPT 178

Query: 181 RVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNS 240
           +V++W +IVPG+IY+DE+IPNLFG+HP DKITSHE YKRGKIIIQDRASCFPAHILNP  
Sbjct: 179 KVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTP 238

Query: 241 TDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAKG 300
            DV+ID+C+APGNKTTHVAAH+F D +      +IHAFEKDPERAKTLQ M+  AGC K 
Sbjct: 239 EDVIIDSCSAPGNKTTHVAAHMF-DPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKS 297

Query: 301 VKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTSV 360
           +++HVGDFTKL KP+ F  VTGFIVDPSCSGSGIFGRK ID  N           ++  V
Sbjct: 298 IEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTN-----------NKNEV 346

Query: 361 EPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVVI 420
            P E++++  E +QDLK RL KLSSFQ+QI+KHAMSFP+AKK+ YSTCSIHAEENERVVI
Sbjct: 347 LPEEEQEKE-EMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVI 405

Query: 421 DLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFP-KEEAKELAEGCIRALPKEDG 479
           DLLLD KV++WGW+VRKR GVIPTW RRG+  EF++V+  K++A+ELA+GCIRALPKEDG
Sbjct: 406 DLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDG 465

Query: 480 GIGFFAVCFERD 491
           GIGFFAVCFERD
Sbjct: 466 GIGFFAVCFERD 477

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/496 (62%), Positives = 390/496 (78%), Gaps = 8/496 (1%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           M FYRDATWVLEF+E+E +K K ++GS+Q++VL SCK YK+++NP+HIYA+++S W+Y+ 
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGK-ISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKP 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           YL+ I+KKSGIL ++PKK GKP F + TI LL HDLL SKSKRIQMGKHP+K ++LK++T
Sbjct: 60  YLETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKT 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKT-DDGEDVTPVRWIRINPIL--VKERYDDVLAELNKK 177
            L++E               LI + DD  D+TPVRW RINPI   + +  + +L EL KK
Sbjct: 120 SLRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKK 179

Query: 178 FPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILN 237
           FP RV+ W +I  G+IY+DE+IPNLFG+H  DKITSHE YK+GKIIIQDRASCFPAH+LN
Sbjct: 180 FPTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLN 239

Query: 238 PNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGC 297
           P   D+VID+CAAPGNKTTH AA+I G   +K   ++IHAFEKDPERAK LQ MV TAGC
Sbjct: 240 PGKDDIVIDSCAAPGNKTTHTAAYILGG-PSKDQKIQIHAFEKDPERAKVLQKMVRTAGC 298

Query: 298 AKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQ 357
           A+ ++++VGDFTK+  PE F+NVTGFIVDPSCSGSGIFGRK ID +N  K G    ++D+
Sbjct: 299 ARTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDE 358

Query: 358 TSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENER 417
           +   PVEQ++E F K+ DLK RL+KL+SFQ+Q+VKHAM+FP A+K+ YSTCSIHAEENER
Sbjct: 359 SESIPVEQDEE-FSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENER 417

Query: 418 VVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVF--PKEEAKELAEGCIRALP 475
           VVIDLLLD  +K+ GW+V  R  VIPTWPRRGW  EF+EVF   +E+ KE+A GCIRALP
Sbjct: 418 VVIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALP 477

Query: 476 KEDGGIGFFAVCFERD 491
           KEDGGIGFFAVCFERD
Sbjct: 478 KEDGGIGFFAVCFERD 493

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/500 (64%), Positives = 394/500 (78%), Gaps = 13/500 (2%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           M+FYRD+TWVLE++E+E +KDK ++GSLQ LVL SCK+YK+K+NPRH+YA VSS W+ + 
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDK-ISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKP 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           YL+K++K+SGIL+D+P KKGKP F + T+ LL HDLLLSKSKRIQMGKHPIKT+ILK++T
Sbjct: 60  YLEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKT 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDD-GEDVTPVRWIRINPILVKERYDD----VLAELN 175
           RL +E              +LI+ ++  +D+TPVRWIRINPI  + +YD     ++ ELN
Sbjct: 120 RLHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPI--RAQYDKGLEPIMNELN 177

Query: 176 KKFPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHI 235
           KKFP RVN W  IVPG+IY+D+YIPNLFG+H  DKITSHE YK GK+IIQDRASCFPAHI
Sbjct: 178 KKFPTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHI 237

Query: 236 LNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATA 295
           LNP   D+VIDACAAPGNKTTH A++I G    K  + +I+AFEKDPERAK LQ M+  A
Sbjct: 238 LNPGKNDIVIDACAAPGNKTTHTASYILGG-PKKDQTTQIYAFEKDPERAKILQHMIKVA 296

Query: 296 GCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSS--NT 353
           GC+  ++++VGDFTK+  PE F+NVTGFIVDPSCSGSGIFGRK +D +N  K  SS  N 
Sbjct: 297 GCSNTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNG 356

Query: 354 DEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAE 413
           ++D     P EQE+E   K  DLK RL+KL+SFQ+Q+VKHAMSFP AKKI YSTCSIHAE
Sbjct: 357 NQDDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAE 416

Query: 414 ENERVVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEAK--ELAEGCI 471
           ENE VVIDLLLD KV+EWGWKV  R+ VIPTWPRRG+ +EF +VF  E+ K  ELA+GCI
Sbjct: 417 ENEGVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCI 476

Query: 472 RALPKEDGGIGFFAVCFERD 491
           R LPKEDGGIGFFAVCFER+
Sbjct: 477 RVLPKEDGGIGFFAVCFERN 496

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/496 (63%), Positives = 388/496 (78%), Gaps = 14/496 (2%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           MEFYRDATWVLE++EQ+ SK  R++GSLQ+LVL SC++YKLKTNP+HIYA++ S W+Y+ 
Sbjct: 1   MEFYRDATWVLEYIEQQDSKG-RISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKP 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           +L+K++ KSGIL+D+PKKKGKP++ + T+ LL+HDLLLSK KRIQMGKHPIK F+L++++
Sbjct: 60  FLEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKS 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKT-DDGEDVTPVRWIRINPILVKERYDDVLAELNKKFP 179
           RL +E              +L+ T D   D+TPVRW RINP+   +    V+ EL KKFP
Sbjct: 120 RLHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPDA-SAVMKELEKKFP 178

Query: 180 QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPN 239
           QRV SW+ IVPGSIY+DE+IP LFGIHP DKITSHE YK+G+IIIQDRASCFPAHILNP 
Sbjct: 179 QRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPT 238

Query: 240 STDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299
             D +IDAC+APGNKTTHVA+++FG  +  VD V+I AFEKDPERAK LQ M+  AGC+K
Sbjct: 239 LEDKIIDACSAPGNKTTHVASYMFG--NGLVDDVRIFAFEKDPERAKVLQKMIKVAGCSK 296

Query: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359
            + ++VGDFTKL  P  F +VTGFIVDPSCSGSGIFGRK ID +N  K      D     
Sbjct: 297 QISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGV-- 354

Query: 360 VEPVEQEKELFEKEQ-DLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERV 418
             P EQE E+ EKE  +L+ RL+KLSSFQ+Q+VKHAMSFP AK+I YSTCSIHAEENERV
Sbjct: 355 --PDEQE-EMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERV 411

Query: 419 VIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVF---PKEEAKELAEGCIRALP 475
            +DLLLD KVK+WGWK+ KR  VIP WPRRG+ SEF+E+F      E +E+A+GCIRALP
Sbjct: 412 ALDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALP 471

Query: 476 KEDGGIGFFAVCFERD 491
           +EDGGIGFFA+CFERD
Sbjct: 472 REDGGIGFFAICFERD 487

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/497 (63%), Positives = 391/497 (78%), Gaps = 11/497 (2%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           MEFYRD+TWVLE++E ++ K  RV+GSLQT+VL  CK+Y++KTNP+HIYAIVSS W+Y+ 
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           YLDKI+KKSG+L+ +P+KKGKP F+K T+ LL HDLLLSK+KRIQMGKHPIK ++LK++ 
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 121 RLKAEXXXXXXXXXXXXXXQ-LIKTDDGEDVTPVRWIRINPILVKER-YDDVLAELNKKF 178
            L AE              Q + K D  +D+TPVRWIRINP+ +     D VL EL KKF
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180

Query: 179 PQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNP 238
           P RVN+WK I+PGSIYYDE+IPNL+GIH  DKITSHE YK+GKIIIQDRASCFPAHILNP
Sbjct: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 239 NSTDVVIDACAAPGNKTTHVAAHIFGDVDT-KVDSVKIHAFEKDPERAKTLQMMVATAGC 297
           ++ DVVIDAC+APGNKTTHVAAHIFGD +  + D+V+I+AFEKDPERA+ LQ M+ TAGC
Sbjct: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300

Query: 298 AKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQ 357
            K + ++VGDFT++  P  + +VTGFI+DPSCSGSGIFGRK++D +N     S++   D+
Sbjct: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPDE 360

Query: 358 TSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENER 417
              E          K + LK RL+KL+SFQ+QIV+HAMSFP+AKKI YSTCSIHAEENER
Sbjct: 361 NDAEETTD-----SKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENER 415

Query: 418 VVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVF---PKEEAKELAEGCIRAL 474
           VVIDLLLD KV+ WGW+V K+  V+PTW RRG+  EF+EVF    ++E +ELA+GC+RAL
Sbjct: 416 VVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRAL 475

Query: 475 PKEDGGIGFFAVCFERD 491
           PKEDGGIGFFAVCF RD
Sbjct: 476 PKEDGGIGFFAVCFVRD 492

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/494 (61%), Positives = 378/494 (76%), Gaps = 14/494 (2%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           M FYRDATWVLE+VEQE  K  R++GS+QTLVL SC+RYKLK++P+H+YA+V S W+Y+ 
Sbjct: 1   MNFYRDATWVLEYVEQEDEKG-RLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKA 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
            L+KI+K+S I +D+PKKKGKP++++ T+ L+ HDLL+SK KRIQMGK PIK ++LKH+T
Sbjct: 60  LLEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKT 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLI-KTDDGEDVTPVRWIRINPILV-KERYDDVLAELNKKF 178
           RL +E              +++ K D   DVTPVRWIRINP+   K   + VL EL KKF
Sbjct: 120 RLNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRCPKNDVEPVLKELIKKF 179

Query: 179 PQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNP 238
           PQRV+ W  I  G++YYDE++PNLFG+HP DKITSHE Y++GKIIIQDR+SCFPAHILNP
Sbjct: 180 PQRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNP 239

Query: 239 NSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCA 298
              DVVIDACAAPGNKTTHVAAHI  +  T+  + KI+AFEKDP RA  L+ M + AGC 
Sbjct: 240 GKNDVVIDACAAPGNKTTHVAAHILPEY-TREQTPKIYAFEKDPARANILKKMTSVAGCG 298

Query: 299 KGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQT 358
           + V+IHVGDFTKL  P  F++VTG IVDPSCSGSGIFGRK++D  N++K  +    E   
Sbjct: 299 QTVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTETDSEI-- 356

Query: 359 SVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERV 418
              P E+EK + +   D+ NRL+KL+SFQ+Q+VKHAMS P+AKKI YSTCSIHAEENERV
Sbjct: 357 ---PDEEEKMVGD---DVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERV 410

Query: 419 VIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEAK--ELAEGCIRALPK 476
           VIDLLLD  +KEWGWKV  R  VIP WPRRG   EFE+VF  +  K  ELA+GCIRALP+
Sbjct: 411 VIDLLLDRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDDPVKCNELADGCIRALPQ 470

Query: 477 EDGGIGFFAVCFER 490
           EDGGIGFFAVCF+R
Sbjct: 471 EDGGIGFFAVCFKR 484

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/502 (63%), Positives = 390/502 (77%), Gaps = 22/502 (4%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           MEFYRDATWVLEFVEQE +K  R++GSLQTLV  SCKRYKLK NP+H+YA++ S W+Y+ 
Sbjct: 1   MEFYRDATWVLEFVEQEDAKG-RISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKP 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           YL+K++KKSGIL+++PK+KGKP++++ T+ L+ HDLL SK+KRIQMGK PIKT++LKH++
Sbjct: 60  YLEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKS 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDDGE-DVTPVRWIRINPILVKERYDDVLA---ELNK 176
           RL +E              +L+   D E D+TPVRWIRINP+       DV A   E+ K
Sbjct: 120 RLHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRC-----DVEATKLEIQK 174

Query: 177 KFPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHIL 236
           KFP RV +W  IVPGSIYYDEYIPNLFGIHP DKITSH  YK+GKIIIQDRASCFPAHIL
Sbjct: 175 KFPTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHIL 234

Query: 237 NPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAG 296
           +P+  DVVID CAAPGNKTTH A+++  +  +K   ++I+AFEK+PERAK L  M+  AG
Sbjct: 235 HPDENDVVIDGCAAPGNKTTHTASYMIKE-PSKDPKIQIYAFEKNPERAKILDKMIKVAG 293

Query: 297 CAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDE- 355
           C+K +KI+VGDFTK+  PE +++VTGFIVDPSCSGSGIFGRK ID +N  K    N DE 
Sbjct: 294 CSKNIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKM---NKDEA 350

Query: 356 ---DQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHA 412
              +    E V  E+E + K +DLK RL+KLSSFQ+Q+VKHAMSFP+AKKI YSTCSIHA
Sbjct: 351 DKKEGDEEEEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHA 410

Query: 413 EENERVVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKE----EAKELAE 468
           EENERVVIDL+LDSKVK+WGWKV  R+ VIPTWPRRG   EFEEVF ++    + +ELA 
Sbjct: 411 EENERVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAG 470

Query: 469 GCIRALPKEDGGIGFFAVCFER 490
           GCIRALP+ DGGIGFFAVCFER
Sbjct: 471 GCIRALPRSDGGIGFFAVCFER 492

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/493 (60%), Positives = 372/493 (75%), Gaps = 31/493 (6%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           M+FYRD+TW+LE++E E  K K ++GSLQ+ VL +C +YK+K NP+HIYA+V+S W+YR 
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGK-LSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRM 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           YL++I+ KSGIL+ +P+KKGKP F++ TI LL HDLL+SK KRIQMGKHPIK ++LK++T
Sbjct: 60  YLERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKT 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDDGEDVTPVRWIRINPILVKERYDDVLAELNKKFPQ 180
           RL AE              +L+  DDG+D TPVRWIRINP+  K     V+ +LNKKFP 
Sbjct: 120 RLHAELVKLKVKLKVKELSELVDQDDGDDATPVRWIRINPL--KCDIPVVVEQLNKKFPH 177

Query: 181 RVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNS 240
           RV+ W Q+ PGSIYYDEY+PNLFGIHP +KITSH+ YK+GK+IIQDRASC PAHILNP  
Sbjct: 178 RVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGK 237

Query: 241 TDVVIDACAAPGNKTTHVAAHIFGDV-DTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299
            DVV+DACAAPGNKTTH+AAHI     D+     +IHAFEK+P RAK LQ M + AGC  
Sbjct: 238 EDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGS 297

Query: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359
            VKIHVGDFT+L  P+ F++VT  +VDPSCSGSGIFGRK+++        SSN  +DQ  
Sbjct: 298 LVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLE--------SSNDSQDQK- 348

Query: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVV 419
                           L++RL+KLSSFQ+Q+VKHAMS P+A+KI YSTCS+HAEENERVV
Sbjct: 349 ----------------LQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVV 392

Query: 420 IDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVF--PKEEAKELAEGCIRALPKE 477
           IDLLLDSKVKEWGW++  R+ V+PTWPRRG   EFEEVF   K + + LAE CIRALP+E
Sbjct: 393 IDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPRE 452

Query: 478 DGGIGFFAVCFER 490
           DGGIGFFAVCF+R
Sbjct: 453 DGGIGFFAVCFQR 465

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/508 (60%), Positives = 378/508 (74%), Gaps = 18/508 (3%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           M FYRDATWVLE +E +  K  RV+GSL +LV+ SCK++K+++NP+H+YA+V S W+++ 
Sbjct: 1   MNFYRDATWVLEHLEAQ-DKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKP 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           ++++I+ KSGIL+D+PKKKGKP++ + T+ LL+HDL+ SKS+RIQMGKHPIKTF+L ++T
Sbjct: 60  FIERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKT 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLIK-----TDDGEDVTPVRWIRINPILV--KERYDDVLAE 173
           RL +E               +I       D  +D+TPVRWIRINPI +  ++  DD++ E
Sbjct: 120 RLHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILE 179

Query: 174 LNKKFPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPA 233
           L KKF  +V+ W +I PG IYYDEYIPNLFGI P DKITSHE YK GKIIIQDRASCFPA
Sbjct: 180 LRKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPA 239

Query: 234 HILNPNSTDVVIDACAAPGNKTTHVAAHIF---GDVDTKVDSVKIHAFEKDPERAKTLQM 290
           HILN    D +IDACAAPGNKTTHVA++I     D     D  ++ AFEKDPER+K L  
Sbjct: 240 HILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDK 299

Query: 291 MVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGS 350
           MV  AGC K V+I+ GDFTK+  PE + NVTGFIVDPSCSGSGIFGRK ID +N +K  +
Sbjct: 300 MVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLT 359

Query: 351 S---NTDEDQTSVEPVEQEKELFEKEQ-DLKNRLAKLSSFQYQIVKHAMSFPSAKKICYS 406
               +  ED     P+EQE     K + DL+ RL+KLSSFQ+Q+VKHAMSFPSAKKI YS
Sbjct: 360 EKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYS 419

Query: 407 TCSIHAEENERVVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVF---PKEEA 463
           TCSIHAEENERVVIDLLLD KVKEWGWKV  R+  IPTW RRG  SEFE+VF   P  + 
Sbjct: 420 TCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDP 479

Query: 464 KELAEGCIRALPKEDGGIGFFAVCFERD 491
           K+LAEGCIR LPKEDGGIGFFAVCFER+
Sbjct: 480 KQLAEGCIRTLPKEDGGIGFFAVCFERN 507

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/496 (63%), Positives = 379/496 (76%), Gaps = 13/496 (2%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           M FYRDATWVLE +E+E +K+ R++GS+QTLVL SCK+YKLK+NP+HIYA++ S W+Y+ 
Sbjct: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKP 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           YL+K++KK+ ILED+PKKKGKPLF++ T+ LL HDLLLSK KRIQMGKHPIK ++LK ++
Sbjct: 60  YLEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKS 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDD-GEDVTPVRWIRINPILVKERYDD--VLAELNKK 177
            L +E              +++ ++D   D+ PVRWIRINP+      D   VLAEL KK
Sbjct: 120 PLHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKK 179

Query: 178 FPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILN 237
           F  +VN W  +VPGSIYYDEYIPNLFGIHP DKIT+HE YK GKIIIQDRASCFPAHIL+
Sbjct: 180 FTLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILH 239

Query: 238 PNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGC 297
           P + D+VIDAC+APGNKTTH A++I      K + ++I+AFEKDPERAK LQ MV  AGC
Sbjct: 240 PGADDIVIDACSAPGNKTTHTASYICSG-PPKDNIIRIYAFEKDPERAKILQKMVKVAGC 298

Query: 298 AKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQ 357
           +  + + VGDFTKL  P+  +  TGFIVDPSCSGSGIFGRK  D +N  K    + D D 
Sbjct: 299 SSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDND- 357

Query: 358 TSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENER 417
             V P EQE+  F  +++L+ RLAKLSSFQ+Q+VKHAMSFP+AKKI YSTCSIHAEENER
Sbjct: 358 --VIPDEQEE--FMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENER 413

Query: 418 VVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEA---KELAEGCIRAL 474
           VVIDLLLD  V+EWGWKV  RT VIP+WPRRG   EF EVF    A   ++LAEGCIRAL
Sbjct: 414 VVIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRAL 473

Query: 475 PKEDGGIGFFAVCFER 490
           PKEDGGIGFFAVCFER
Sbjct: 474 PKEDGGIGFFAVCFER 489

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/499 (62%), Positives = 386/499 (77%), Gaps = 12/499 (2%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           M+FYRDATWVLE +E + +K K ++GSLQTLVL SCKR+K+KTNP+HIYA+VSS W+Y+ 
Sbjct: 1   MDFYRDATWVLESIENQDAKGK-LSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKP 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           +L+K++KKS IL++VP+KKG P+F + T+ LL HDLLLSKSKRIQMGKHPIK F+LK++T
Sbjct: 60  FLEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKT 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDD-GEDVTPVRWIRINPI--LVKERYDDVLAELNKK 177
           RL AE              QL  +DD   D+TPVRW R+NP+    ++    V+ EL KK
Sbjct: 120 RLNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKK 179

Query: 178 FPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILN 237
           F ++V+SWK +VPGSIYYDEYIPNLF +HP DKITSHE YK+GKIIIQDRASCFPAHILN
Sbjct: 180 FTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILN 239

Query: 238 PNSTDVVIDACAAPGNKTTHVAAHIFGD--VDTKVDSVKIHAFEKDPERAKTLQMMVATA 295
           P S D+VIDACAAPGNKTTH+AAH+F D   D K   V+I+AFEKDPERA+ L  M+  A
Sbjct: 240 PKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEK-PKVQIYAFEKDPERAQVLNKMIKIA 298

Query: 296 GCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDE 355
           GC+K +++ VGDFTKL  P+   NV G IVDPSCSGSGIFGRK ID +N  KT      E
Sbjct: 299 GCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKE-E 357

Query: 356 DQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEEN 415
           ++  ++ V +E+E  E + +LK RL+KLSSFQ+QIVK+A+SFP A K+ YSTCSIHAEEN
Sbjct: 358 EERELDAVPEEQEEQELDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEEN 417

Query: 416 ERVVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKE----EAKELAEGCI 471
           ERVVIDLLLD KVKE GW+V  R+ VIPTW RRG   EF++VF ++      +E+A+GCI
Sbjct: 418 ERVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCI 477

Query: 472 RALPKEDGGIGFFAVCFER 490
           RALP+EDGGIGFFAVCFER
Sbjct: 478 RALPREDGGIGFFAVCFER 496

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/496 (62%), Positives = 379/496 (76%), Gaps = 13/496 (2%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           M FYRDATWVLE +E+E +K  R++GS+QTLVL SCKRYKLK+NP+HIYA++ S W+Y+ 
Sbjct: 1   MNFYRDATWVLEDIEKEAAK-VRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKP 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           YL+K++KK+ ILE++PKKKGKPLF + T+ LL HDLLLSK KRIQMGKHPIK ++LK ++
Sbjct: 60  YLEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKS 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDD-GEDVTPVRWIRINPILVKE--RYDDVLAELNKK 177
            L +E              +L+ ++D   D+ PVRWIRINP+        + VLAEL KK
Sbjct: 120 PLHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKK 179

Query: 178 FPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILN 237
           F Q+V++W ++VPGSIY+DEYIPNLFGIHP DKIT+HE YK GKIIIQDRASCFPAHIL+
Sbjct: 180 FTQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILH 239

Query: 238 PNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGC 297
           P S D+VIDAC+APGNKTTH A++IF +   K   ++I+AFEKDPERAK LQ M+  AGC
Sbjct: 240 PGSNDIVIDACSAPGNKTTHTASYIFSE-PPKDKKIQIYAFEKDPERAKILQKMIKVAGC 298

Query: 298 AKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQ 357
           +  + ++VGDFTKL  PE  + VTGFIVDPSCSGSGIFGRK  D +N         DE  
Sbjct: 299 SANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLN-----RRKIDEKD 353

Query: 358 TSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENER 417
              + V  E+E F  +++L+ RLAKLSSFQ+Q+VKHAMSFP AKKI YSTCSIHAEENER
Sbjct: 354 DEDDAVPDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENER 413

Query: 418 VVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVF---PKEEAKELAEGCIRAL 474
           VVIDLLLD  V+EWGWKV  RT V+P+WPRRG   EFEEVF      + ++LAEGCIRAL
Sbjct: 414 VVIDLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRAL 473

Query: 475 PKEDGGIGFFAVCFER 490
           PKEDGGIGFFAVCF R
Sbjct: 474 PKEDGGIGFFAVCFVR 489

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/497 (61%), Positives = 381/497 (76%), Gaps = 13/497 (2%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           M FYRDATWVLE +E+E +K+ R++GS+QTLVL SCKRYKLK+NP+HIYA++ S W+Y+ 
Sbjct: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKP 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           YL+K++KK+ ILED+PKKKGKPLF++ T+ LL HDLLLSK KRIQMGKHPIK ++LK ++
Sbjct: 60  YLEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKS 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDD-GEDVTPVRWIRINPILVKER--YDDVLAELNKK 177
            L +E              +L+ ++D   D+ PVRWIRINP+        + VLAEL KK
Sbjct: 120 PLHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKK 179

Query: 178 FPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILN 237
           F  +V+ W ++VPGSIYYDE+IPNLFGIHP DKIT+HE YK GKIIIQDRASCFPAHILN
Sbjct: 180 FTLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILN 239

Query: 238 PNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGC 297
           P  +D+VID+C+APGNKTTH A++I+ +   K ++ +I+AFEKDPERAK LQ M+  AGC
Sbjct: 240 PGPSDIVIDSCSAPGNKTTHTASYIYPE-PPKDNNTRIYAFEKDPERAKVLQKMIKIAGC 298

Query: 298 AKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQ 357
           +  + ++VGDFTKL  PE +++VT FIVDPSCSGSGIFGRK  D  N  K    + D   
Sbjct: 299 SPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGGI 358

Query: 358 TSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENER 417
                V  E+E F  +++L+ RLAKLSSFQ+Q+VKHAMSFP+AKKI YSTCSIHAEENER
Sbjct: 359 -----VPDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENER 413

Query: 418 VVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFP---KEEAKELAEGCIRAL 474
           VVIDLLLD  V+EWGWKV  +  VIP+WPRRG   EFEEVF      + ++LAEGCIRAL
Sbjct: 414 VVIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRAL 473

Query: 475 PKEDGGIGFFAVCFERD 491
           PK DGGIGFFAVCFERD
Sbjct: 474 PKSDGGIGFFAVCFERD 490

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/496 (62%), Positives = 377/496 (76%), Gaps = 13/496 (2%)

Query: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60
           M FYRDATWVLE +E+E +K+ R++GS+QTLVL SCKRYKLK+NP+H+YA++ S W+Y+ 
Sbjct: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKP 59

Query: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120
           YL+K++KK+ ILED+PKKKGKPLF++ T+ LL HDLL+SK KRIQMGKHPIK ++LK ++
Sbjct: 60  YLEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKS 119

Query: 121 RLKAEXXXXXXXXXXXXXXQLIKTDD-GEDVTPVRWIRINPI--LVKERYDDVLAELNKK 177
            L +E              +L+ ++D   D+ PVRWIRINP+      + + VLAEL KK
Sbjct: 120 PLHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKK 179

Query: 178 FPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILN 237
           F  +V  W ++VP SIYYDEYIPNLFGIHP DKIT+HE YK GKIIIQDRASCFPAHILN
Sbjct: 180 FTLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILN 239

Query: 238 PNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGC 297
           P   D+VIDAC+APGNKTTH A++I  +   K    +I+AFEKDPERAK LQ M+  AGC
Sbjct: 240 PGPNDIVIDACSAPGNKTTHTASYICSE-PPKDSRTRIYAFEKDPERAKILQKMIKIAGC 298

Query: 298 AKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQ 357
           +  + + VGDFTKL  PE F++ TGFIVDPSCSGSGIFGRK  D +N  K    +     
Sbjct: 299 SSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDKDD---D 355

Query: 358 TSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENER 417
             + P EQE+  F  +++L+ RLAKLSSFQ+Q+VKHAMSFP AKKI YSTCSIHAEENER
Sbjct: 356 NDIVPDEQEE--FMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENER 413

Query: 418 VVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEA---KELAEGCIRAL 474
           VVIDLLLD  V+EWGW+V  R+ VIP WPRRG   EFEEVF +  A   +ELAEGCIRAL
Sbjct: 414 VVIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRAL 473

Query: 475 PKEDGGIGFFAVCFER 490
           PK+DGGIGFFAVCFER
Sbjct: 474 PKDDGGIGFFAVCFER 489

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 104/245 (42%), Gaps = 57/245 (23%)

Query: 180 QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPN 239
           Q + SW ++  G   +D  +P   G  P        +Y  G  I+Q  +S  P   L+P+
Sbjct: 284 QPIGSWTKV--GLQIFDSQVP--VGATP--------EYLAGHYILQAASSFLPVIALDPH 331

Query: 240 STDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299
             + ++D  AAPG KTT+++A +        ++  + A + +  R K+L   +   GC  
Sbjct: 332 ENERILDMAAAPGGKTTYISAMM-------KNTGCVFANDANKARTKSLIANIHRLGCTN 384

Query: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359
            +   V ++     P++       ++D  CSG+G+ G+    KVN +             
Sbjct: 385 TI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVNRT------------- 428

Query: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAM-SFPSAKK----ICYSTCSIHAEE 414
                 EK+  +           +   Q Q++  A+ S  S  K    I YSTCS+  EE
Sbjct: 429 ------EKDFMQ-----------IPHLQKQLILSAIDSVDSNSKHGGVIVYSTCSVAVEE 471

Query: 415 NERVV 419
           NE VV
Sbjct: 472 NEAVV 476

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 110/303 (36%), Gaps = 69/303 (22%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVD--------TKVD 271
           G I  Q+  S  P  +L       V+D CAAPG+KT  +   +  D D           D
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMDTDEPTGFVVANDAD 205

Query: 272 SVKIHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSG 331
           S + H      +R  +  +MV         +I + + +   K  L       + D  CSG
Sbjct: 206 SRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLL--KFDRILCDVPCSG 263

Query: 332 SGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIV 391
            G   +     VN+ K  ++ +                             L + QY I+
Sbjct: 264 DGTMRKN----VNVWKDWNTQSG--------------------------LGLHTVQYNIL 293

Query: 392 KHAMSF-PSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVRK-----------RT 439
              ++   S  ++ YSTCS++  ENE VV   L     + WG K++            R+
Sbjct: 294 NRGLNLLKSGGRLVYSTCSLNPIENEAVVAQAL-----RTWGDKIKLVNCGDKLPGLVRS 348

Query: 440 GVIPTWP---------RRGWTSEFEEVFP--KEEAKEL-AEGCIRALPKEDGGIGFFAVC 487
             I  WP          +G     E  FP  +EEAK    E CIR  P +    GFF   
Sbjct: 349 QGISQWPVIDRNMTEKNKGDEGTIESWFPPSEEEAKNFHLENCIRVYPHQQNTGGFFITV 408

Query: 488 FER 490
            E+
Sbjct: 409 IEK 411

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 114/270 (42%), Gaps = 59/270 (21%)

Query: 156 IRINPILVKERYDDVLAELNKKFP-QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSH 214
           IR N +  + R D   A +NK    Q + +W ++  G   +D  +P          I + 
Sbjct: 288 IRTNTLKTRRR-DLAQALVNKGVNLQPIGAWTKV--GLQIFDSQVP----------IGAT 334

Query: 215 EQYKRGKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVK 274
            +Y  G+ I+Q  +S  P   L+P   + V+D  AAPG KTT+++A +        ++  
Sbjct: 335 SEYLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALM-------KNTGC 387

Query: 275 IHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGI 334
           + A + +  R K+L   +   GC   +   V ++     P++       ++D  CSG+G+
Sbjct: 388 VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGV 444

Query: 335 FGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHA 394
            G+                  DQ SV+    EK+  +           +   Q Q++  A
Sbjct: 445 IGK------------------DQ-SVKSSRTEKDFIQ-----------IPHLQKQLLLSA 474

Query: 395 MSFPSAKK-----ICYSTCSIHAEENERVV 419
           +    A       I YSTCS+  EE+E VV
Sbjct: 475 IDSVDANSKTGGVIVYSTCSVAVEEDEAVV 504

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 107/267 (40%), Gaps = 69/267 (25%)

Query: 180 QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPN 239
           Q + SW ++  G   +D  +P          I +  +Y  G  I+Q  +S  P   L+P 
Sbjct: 291 QPIGSWTKV--GLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVIALDPQ 338

Query: 240 STDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299
             + ++D  AAPG KTT+++A +        ++  + A + +  R K+L   +   GC  
Sbjct: 339 ENERILDMAAAPGGKTTYISALM-------KNTGCVFANDANKARTKSLIANIHRLGCHN 391

Query: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359
            +   V ++     P++       ++D  CSG+G+ G+    KV       S T++D   
Sbjct: 392 TI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKV-------SRTEKD--- 438

Query: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKK-----ICYSTCSIHAEE 414
                                 ++   Q Q++  A+    A       I YSTCS+  EE
Sbjct: 439 --------------------FMQIPHLQKQLILSAIDSVDAHSKTGGVIVYSTCSVAVEE 478

Query: 415 NERVVIDLLLDSKVKEWGWKVRKRTGV 441
           NE VV             + +RKR  V
Sbjct: 479 NEAVV------------NYALRKRPNV 493

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 104/240 (43%), Gaps = 47/240 (19%)

Query: 180 QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPN 239
           Q + +W ++  G   +D  +P          I +  +Y  G+ I+Q  +S  P   L+P 
Sbjct: 292 QPIGTWTKV--GLQIFDSQVP----------IGATSEYLAGQYILQAASSFLPVVALDPQ 339

Query: 240 STDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299
             + V+D  AAPG KTT+++A +        ++  + A + +  R K+L   +   GC  
Sbjct: 340 LNERVLDMAAAPGGKTTYISALM-------KNTGCVFANDANKARTKSLIANIHRLGCTN 392

Query: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359
            +   V ++     P++       ++D  CSG+G+ G+    KV       S T++D   
Sbjct: 393 TI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKV-------SRTEKDFIQ 442

Query: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVV 419
           +  +  +K+L     D  +  +K   F                I YSTCS+  EE+E VV
Sbjct: 443 IPHL--QKQLLLSAIDSVDANSKTGGF----------------IVYSTCSVAVEEDEAVV 484

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 116/265 (43%), Gaps = 49/265 (18%)

Query: 156 IRINPILVKERYDDVLAELNKKFP-QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSH 214
           IR N +  + R D   A +N+    Q + SW ++  G   +D  +P          I + 
Sbjct: 145 IRTNTLKTRRR-DLAQALVNRGVNLQPIGSWTKV--GLQIFDSQVP----------IGAT 191

Query: 215 EQYKRGKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVK 274
            +Y  G  I+Q  +S  P   L+P+  + ++D  AAPG KTT+++A +        ++  
Sbjct: 192 PEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-------KNTGC 244

Query: 275 IHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGI 334
           + A + +  R K+L   +   GC   +   V ++     P++       ++D  CSG+G+
Sbjct: 245 VFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGV 301

Query: 335 FGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHA 394
            G+    KV       S T++D   +  ++  K+L          L+ + S      KH 
Sbjct: 302 IGKDQSVKV-------SRTEKDFIQIPHLQ--KQLL---------LSAIDSVDCN-SKHG 342

Query: 395 MSFPSAKKICYSTCSIHAEENERVV 419
                   I YSTCS+  EE+E VV
Sbjct: 343 GV------IVYSTCSVAVEEDEAVV 361

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 103/245 (42%), Gaps = 57/245 (23%)

Query: 180 QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPN 239
           Q + SW ++  G   +D  +P          I +  +Y  G  I+Q  +S  P   L+P 
Sbjct: 294 QPIGSWTKV--GLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVIALDPQ 341

Query: 240 STDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299
             + ++D  AAPG KTT+++A +        ++  + A + +  R K+L   +   GC  
Sbjct: 342 ENERILDMAAAPGGKTTYISAMM-------KNTGCVFANDANKARTKSLIANIHRLGCTN 394

Query: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359
            +   V ++     P++       ++D  CSG+G+ G+    KV       S T++D   
Sbjct: 395 TI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKV-------SRTEKD--- 441

Query: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAM-SFPSAKK----ICYSTCSIHAEE 414
                                 ++   Q Q++  A+ S  S  K    I YSTCS+  +E
Sbjct: 442 --------------------FMQIPHLQKQLLLSAIDSVDSNSKTGGVIVYSTCSVAVDE 481

Query: 415 NERVV 419
           NE VV
Sbjct: 482 NEAVV 486

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 112/305 (36%), Gaps = 73/305 (23%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVD--------TKVD 271
           G I  Q+  S  P  +L       V+D CAAPG+KT  +   +  D D           D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVVANDAD 204

Query: 272 SVKIHAFEKDPERAKTLQMMVAT--AGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSC 329
           + + H      +R  +  +MV    A     +K+H    T   K +        + D  C
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLH----TDAEKKKEMLKFDRILCDVPC 260

Query: 330 SGSGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQ 389
           SG G   +     VN+ K  ++                               L + Q  
Sbjct: 261 SGDGTMRKN----VNVWKDWNTQGG--------------------------LGLHTVQLN 290

Query: 390 IVKHAMSF-PSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVRK----------- 437
           I+   ++   S  ++ YSTCS++  ENE VV + L     ++WG K++            
Sbjct: 291 ILNRGLNLLKSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGSKIKLVNCDDKLVGLV 345

Query: 438 RTGVIPTWP---------RRGWTSEFEEVF-PKEEAKEL--AEGCIRALPKEDGGIGFFA 485
           R+  I  WP          +G     E  F P EE +E+   + CIR  P +    GFF 
Sbjct: 346 RSKGISNWPVLDRNMAVKNKGDEGTIESWFPPTEEEREIFHLDSCIRVYPHQQNTGGFFI 405

Query: 486 VCFER 490
             FE+
Sbjct: 406 TVFEK 410

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 103/245 (42%), Gaps = 57/245 (23%)

Query: 180 QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPN 239
           Q + SW ++  G   +D  +P          I +  +Y  G  I+Q  +S  P   L+P 
Sbjct: 298 QPIGSWTKV--GLQIFDSQVP----------IGATPEYLAGNYILQAASSFLPVIALDPQ 345

Query: 240 STDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299
             + ++D  AAPG KTT+++A +        ++  + A + +  R K+L   +   GC  
Sbjct: 346 ENERILDMAAAPGGKTTYISALM-------KNTGCVFANDANKSRTKSLVANIHRLGCTN 398

Query: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359
            +   V ++     P +       ++D  CSG+G+ G+    KV       S T++D   
Sbjct: 399 TI---VCNYDAREFPRVIGGFDRILLDAPCSGTGVIGKDQSVKV-------SRTEKD--- 445

Query: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAM-SFPSAKK----ICYSTCSIHAEE 414
                                 ++   Q Q++  A+ S  S  K    I YSTCS+  EE
Sbjct: 446 --------------------FMQIPHLQKQLLLSAIDSVDSHSKTGGIIVYSTCSVAVEE 485

Query: 415 NERVV 419
           +E+VV
Sbjct: 486 DEQVV 490

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 115/265 (43%), Gaps = 49/265 (18%)

Query: 156 IRINPILVKERYDDVLAELNKKFP-QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSH 214
           IR N  L   R D   A +N+    Q + SW ++  G   +D  +P          I + 
Sbjct: 276 IRTN-TLKTSRRDLAQALVNRGVNLQPIGSWTKV--GLQIFDSQVP----------IGAT 322

Query: 215 EQYKRGKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVK 274
            +Y  G  I+Q  +S  P   L+P   + V+D  +APG KTT+++A +        ++  
Sbjct: 323 PEYLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKTTYISALM-------KNTGC 375

Query: 275 IHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGI 334
           + A + + +R K+L   +   GC   +   V ++     P++       ++D  CSG+G+
Sbjct: 376 VFANDANKKRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRVLLDAPCSGTGV 432

Query: 335 FGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHA 394
            G+    KV       S T++D   +  +  +K+L          L+ + S      K  
Sbjct: 433 IGKDQSVKV-------SRTEKDFIQIPHL--QKQLL---------LSAIDSVDANSKKGG 474

Query: 395 MSFPSAKKICYSTCSIHAEENERVV 419
           +       I YSTCS+  EE+E VV
Sbjct: 475 V-------IVYSTCSVAVEEDEAVV 492

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 116/265 (43%), Gaps = 49/265 (18%)

Query: 156 IRINPILVKERYDDVLAELNKKFP-QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSH 214
           IR N +  + R D   A +N+    Q + SW ++  G   +D  +P   G  P       
Sbjct: 280 IRTNTLKTRRR-DLAQALVNRGVNLQPIGSWTKV--GLQIFDSQVP--IGATP------- 327

Query: 215 EQYKRGKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVK 274
            +Y  G  I+Q  +S  P   L+P+  + ++D  AAPG KTT+++A +        ++  
Sbjct: 328 -EYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM-------KNTGT 379

Query: 275 IHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGI 334
           + A + +  R K+L   +   GC   +   V ++     P++       ++D  CSG+G+
Sbjct: 380 VFANDANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGV 436

Query: 335 FGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHA 394
            G+    KV       S T++D   +  ++  K+L          L+ + S      KH 
Sbjct: 437 IGKDQSVKV-------SRTEKDFIQIPHLQ--KQLL---------LSAIDSVDCN-SKHG 477

Query: 395 MSFPSAKKICYSTCSIHAEENERVV 419
                   I YSTCS+  EE+E VV
Sbjct: 478 ------GIIVYSTCSVAVEEDEAVV 496

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 114/270 (42%), Gaps = 59/270 (21%)

Query: 156 IRINPILVKERYDDVLAELNKKFP-QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSH 214
           IR N +  + R D   A +N+    Q + +W ++  G   +D  +P   G  P       
Sbjct: 287 IRTNTLKTRRR-DLAQALVNRGVNLQPIGAWTKV--GLQIFDSQVP--IGATP------- 334

Query: 215 EQYKRGKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVK 274
            +Y  G  I+Q  +S  P   L+P   + V+D  +APG KTT+++A +        ++  
Sbjct: 335 -EYLAGNYILQAASSFLPVIALDPQENERVLDMASAPGGKTTYISALM-------KNTGC 386

Query: 275 IHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGI 334
           I A + +  R K+L   +   GC   +   V ++     P++       ++D  CSG+G+
Sbjct: 387 IFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGV 443

Query: 335 FGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHA 394
            G+    KV       S T++D                         ++   Q Q++  A
Sbjct: 444 IGKDQSVKV-------SRTEKD-----------------------FIQIPHLQKQLILSA 473

Query: 395 M-SFPSAKK----ICYSTCSIHAEENERVV 419
           + S  S  K    + YSTCS+  EE+E VV
Sbjct: 474 IDSLDSNSKNGGVLVYSTCSVAVEEDEAVV 503

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 116/305 (38%), Gaps = 73/305 (23%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVD--------TKVD 271
           G I  Q+  S  P  +L       V+D CAAPG+KT  +   +  D D           D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 272 SVKIHAFEKDPERAKTLQMMVAT--AGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSC 329
           + + H      +R  +  +MV    A     +++H G+  K      F  +   + D  C
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLH-GNSNKKNDILKFDRI---LCDVPC 260

Query: 330 SGSGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQ 389
           SG G   +     VN+ K  ++                               L + Q  
Sbjct: 261 SGDGTMRKN----VNVWKDWNTQAG--------------------------LGLHTVQLN 290

Query: 390 IVKHAMSF-PSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVR------KRTGVI 442
           I+   +    S  ++ YSTCS++  ENE V+ + L     ++WG K+R      K TG+I
Sbjct: 291 ILNRGLHLLKSNGRLVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDDKLTGLI 345

Query: 443 PT-----WP---------RRGWTSEFEEVFP--KEEAKELA-EGCIRALPKEDGGIGFFA 485
            +     WP          +G     E  FP  +EEA +   + C+R  P +    GFF 
Sbjct: 346 RSKGVSKWPVYDRNLTEKNKGDEGTLESFFPPSEEEASKFNLKNCMRVYPHQQNTGGFFI 405

Query: 486 VCFER 490
             FE+
Sbjct: 406 SVFEK 410

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 104/240 (43%), Gaps = 47/240 (19%)

Query: 180 QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPN 239
           Q + +W ++  G   +D  +P          I +  +Y  G  I+Q  +S  P   L+P 
Sbjct: 309 QPIGNWTKV--GLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVIALDPQ 356

Query: 240 STDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299
             + ++D  AAPG KTT+++A +        ++  + A + +  R K+L   +   GC  
Sbjct: 357 ENERILDMAAAPGGKTTYISAMM-------KNTGCVFANDANKNRTKSLIANIHRLGCTN 409

Query: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359
            +   V ++     P++       ++D  CSG+G+ G+    KV       S T++D   
Sbjct: 410 TI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKV-------SRTEKDFIQ 459

Query: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVV 419
           +  +  +K+L          L+ + S      K  +       I YSTCS+  EE+E VV
Sbjct: 460 IPHL--QKQLL---------LSAIDSVDANSKKGGI-------IVYSTCSVAVEEDEAVV 501

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 114/262 (43%), Gaps = 52/262 (19%)

Query: 180 QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPN 239
           Q + SW ++  G   +D  +P          I +  +Y  G  I+Q  +S  P   L+P+
Sbjct: 297 QPIGSWTKV--GLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVIALDPH 344

Query: 240 STDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299
             + ++D  AAPG KTT+++A +        ++  + A + +  R K+L   +   GC  
Sbjct: 345 ENERILDMAAAPGGKTTYISAMM-------KNTGCVFANDANKSRTKSLIANIHRLGCTN 397

Query: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359
            +   V ++     P++       ++D  CSG+G+ G+    KV       S T++D   
Sbjct: 398 TI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKV-------SRTEKDFIQ 447

Query: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVV 419
           +  ++  K+L          L+ + S      KH         I YSTCS+  EE+E  V
Sbjct: 448 IPHLQ--KQLL---------LSAIDSVDCN-SKHGGV------IVYSTCSVAVEEDE-AV 488

Query: 420 IDLLL----DSKVKEWGWKVRK 437
           ID  L    + K+ E G  + K
Sbjct: 489 IDYALRKRPNVKLVETGLAIGK 510

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 112/303 (36%), Gaps = 72/303 (23%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHV--AAHIFGD------VDTKVD 271
           G I  Q+  S  P ++L       V+D CAAPG+KT  +  A H  G       V    D
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPEPSGFVVANDAD 205

Query: 272 SVKIHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSG 331
             + H      +R  +  ++V         +I   + +K      F      + D  CSG
Sbjct: 206 YRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTAEGSKD-----FLKFDRVLCDVPCSG 260

Query: 332 SGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIV 391
            G   RK I+      TGS                                L + Q  I+
Sbjct: 261 DGTM-RKNINVWKDWGTGSG-----------------------------LGLHTVQLNIL 290

Query: 392 KHAMSF-PSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVR-----------KRT 439
              ++   +  ++ YSTCS++  ENE VV      + +++WG K++            R+
Sbjct: 291 NRGLTLLKNGGRLVYSTCSLNPIENEAVVA-----AALRKWGAKIKLVNCDDQLLGLVRS 345

Query: 440 GVIPTWP---------RRGWTSEFEEVFP--KEEAKELA-EGCIRALPKEDGGIGFFAVC 487
             I +WP          +G        FP  +EEAKE   E CIR  P +    GFF   
Sbjct: 346 TGISSWPVLDKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISV 405

Query: 488 FER 490
           FE+
Sbjct: 406 FEK 408

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 114/265 (43%), Gaps = 49/265 (18%)

Query: 156 IRINPILVKERYDDVLAELNKKFP-QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSH 214
           IR N +  + R D   A +N+    Q + SW ++  G   +D  +P          I + 
Sbjct: 270 IRTNTLKTRRR-DLAQALVNRGVNLQPIGSWTKV--GLQIFDSQVP----------IGAT 316

Query: 215 EQYKRGKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVK 274
            +Y  G  I+Q  +S  P   L+P+  + ++D  AAPG KTT+++A +        ++  
Sbjct: 317 PEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALM-------KNTGC 369

Query: 275 IHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGI 334
           + A + +  R K+L   +   GC   +   V ++     P++       ++D  C+G+G+
Sbjct: 370 VFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCTGTGV 426

Query: 335 FGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHA 394
            G+    KV       S T++D   V  +  +K+L     D  +  +K            
Sbjct: 427 IGKDQSVKV-------SRTEKDFIQVPHL--QKQLLLSAIDSVDSNSKTGGI-------- 469

Query: 395 MSFPSAKKICYSTCSIHAEENERVV 419
                   I YSTCS+  EE+E VV
Sbjct: 470 --------IVYSTCSVAVEEDEMVV 486

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 109/273 (39%), Gaps = 65/273 (23%)

Query: 156 IRINPILVKERYDDVLAELNKKFPQRVNSWKQIVP----GSIYYDEYIPNLFGIHPGDKI 211
           IR N +  + R      +L +    R  + K I P    G   +D  +P          I
Sbjct: 284 IRTNSLKTRRR------DLAQTLVNRGVNLKPIGPWTKVGLQIFDSQVP----------I 327

Query: 212 TSHEQYKRGKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVD 271
            +  +Y  G  I+Q  +S  P   L+P+  + ++D  AAPG KTT+++A +        +
Sbjct: 328 GATPEYLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMM-------KN 380

Query: 272 SVKIHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSG 331
           +  + A + +  R K+L   +   GC   +   V ++     P++       ++D  CSG
Sbjct: 381 TGCVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 437

Query: 332 SGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIV 391
           +G+  +    KV       S TD+D                         ++   Q Q++
Sbjct: 438 TGVIAKDQSVKV-------SRTDKD-----------------------FMQIPHLQKQLL 467

Query: 392 KHAMSFPSAKK-----ICYSTCSIHAEENERVV 419
             A+    A       I YSTCS+  EENE VV
Sbjct: 468 LSAIDSVDANSKTGGVIVYSTCSVAVEENEAVV 500

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 105/240 (43%), Gaps = 47/240 (19%)

Query: 180 QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPN 239
           Q + SW ++  G   +D  +P          I +  +Y  G  I+Q  +S  P   L+P+
Sbjct: 297 QPIGSWTKV--GLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVIALDPH 344

Query: 240 STDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299
             + ++D  AAPG KTT+++A +        ++  + A + +  R K+L   +   GC  
Sbjct: 345 ENERILDMAAAPGGKTTYISAMM-------KNTGCVFANDANKSRTKSLIANIHRLGCTN 397

Query: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359
            +   V ++     P++       ++D  CSG+G+ G+    KV       S T++D   
Sbjct: 398 TI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKV-------SRTEKDFIQ 447

Query: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVV 419
           +  ++  K+L          L+ + S      KH         I YSTCS+  EE+E V+
Sbjct: 448 IPHLQ--KQLL---------LSAIDSVDCN-SKHGGV------IVYSTCSVAVEEDEAVI 489

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 105/240 (43%), Gaps = 47/240 (19%)

Query: 180 QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPN 239
           Q + SW ++  G   +D  +P          I +  +Y  G  I+Q  +S  P   L+P+
Sbjct: 299 QPIGSWTKV--GLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVIALDPH 346

Query: 240 STDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299
             + ++D  AAPG KTT+++A +        ++  + A + +  R K+L   +   GC  
Sbjct: 347 ENERILDMAAAPGGKTTYISAMM-------KNTGCVFANDANKSRTKSLIANIHRLGCTN 399

Query: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359
            +   V ++     P++       ++D  CSG+G+ G+    KV       S T++D   
Sbjct: 400 TI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKV-------SRTEKDFIQ 449

Query: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVV 419
           +  ++  K+L          L+ + S      KH         I YSTCS+  EE+E VV
Sbjct: 450 IPHLQ--KQLL---------LSAIDSVDCN-SKHGGV------IVYSTCSVAVEEDEAVV 491

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 110/305 (36%), Gaps = 72/305 (23%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVD--------TKVD 271
           G I  Q+  S  P  +L       V+D CAAPG+KT  +   +  D D           D
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDTDEPTGFVVANDAD 202

Query: 272 SVKIHAFEKDPERAKTLQMMVAT--AGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSC 329
           S + H      +R  +  +MV    A     +K    D +       F  V   + D  C
Sbjct: 203 SKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRV---LCDVPC 259

Query: 330 SGSGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQ 389
           SG G   RK +           N   D T    +                   L + Q+ 
Sbjct: 260 SGDGTM-RKNV-----------NVWRDWTPQGGL------------------GLHTVQFN 289

Query: 390 IVKHAMSFPSAK-KICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVRK----------- 437
           I+   +     K ++ YSTCS++  ENE VV + L     ++WG K+R            
Sbjct: 290 ILNRGLHLLKNKGRLVYSTCSMNPIENEAVVAEAL-----RKWGDKIRLVSCEDKLPGLV 344

Query: 438 RTGVIPTWP---------RRGWTSEFEEVFP---KEEAKELAEGCIRALPKEDGGIGFFA 485
           R+  +  WP          +G     +  FP   +E AK   E CIR  P +    GFF 
Sbjct: 345 RSKGVSQWPVIDRNMTPREKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGFFI 404

Query: 486 VCFER 490
             FE+
Sbjct: 405 TVFEK 409

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 102/245 (41%), Gaps = 57/245 (23%)

Query: 180 QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPN 239
           Q + +W ++  G   +D  +P   G  P        +Y  G  I+Q  +S  P   L+P 
Sbjct: 286 QPIGTWTKV--GLQIFDSQVP--IGATP--------EYLAGHYILQAASSFLPVIALDPQ 333

Query: 240 STDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299
             + ++D  AAPG KTT+++A +        ++  + A + +  R K+L   +   GC  
Sbjct: 334 ENERILDMAAAPGGKTTYISALM-------KNTGCVFANDANKARTKSLIANIHRLGCTN 386

Query: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359
            +   V ++     P++       ++D  CSG+G+  +    KV       S T++D   
Sbjct: 387 TI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIAKDQSVKV-------SRTEKD--- 433

Query: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAM-SFPSAKK----ICYSTCSIHAEE 414
                                 ++   Q Q++  A+ S  S  K    I YSTCS+  EE
Sbjct: 434 --------------------FMQIPHLQKQLILSAIDSVDSNSKTGGIIVYSTCSVAVEE 473

Query: 415 NERVV 419
           NE VV
Sbjct: 474 NEAVV 478

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 116/305 (38%), Gaps = 73/305 (23%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHV--AAHIFGD------VDTKVD 271
           G I  Q+  S  P  +L       V+D CAAPG+KT  +  A H+  D      V    D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHMEDDEPSGFVVANDAD 204

Query: 272 SVKIHAFEKDPERAKTLQMMVAT--AGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSC 329
           + + H      +R  +  +MV    A     +K+H  D T+      F  V   + D  C
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLH-EDATQKKDVLRFDRV---LCDVPC 260

Query: 330 SGSGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQ 389
           SG G   +     VN+ +  ++ +                             L + Q  
Sbjct: 261 SGDGTMRKN----VNVWRDWNTQSG--------------------------LGLHTVQLN 290

Query: 390 IVKHAMSFPSAK-KICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVRK----------- 437
           I+   +     K ++ YSTCS++  ENE VV      + +++WG K+R            
Sbjct: 291 ILNRGLHLLKPKGRLVYSTCSMNPIENEAVVA-----AALRKWGDKIRLVNCDDKLPGLV 345

Query: 438 RTGVIPTWP---------RRGWTSEFEEVF---PKEEAKELAEGCIRALPKEDGGIGFFA 485
           R+  I TWP         ++G  +  E  F   P+E  K     CIR  P +    GFF 
Sbjct: 346 RSKGISTWPVVDRNMEEKKKGDENTVESWFAPTPEEAEKFDLSSCIRVYPHQQNTGGFFI 405

Query: 486 VCFER 490
             FE+
Sbjct: 406 TVFEK 410

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 102/245 (41%), Gaps = 57/245 (23%)

Query: 180 QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPN 239
           Q + +W ++  G   +D  +P          I +  +Y  G+ I+Q  +S  P   L+P 
Sbjct: 292 QPIGNWTKV--GLQIFDSQVP----------IGATPEYLAGQYILQAASSFLPVIALDPQ 339

Query: 240 STDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299
             + ++D  +APG KTT+++A +        ++  + A + +  R K+L   +   GC  
Sbjct: 340 ENERILDMASAPGGKTTYISALM-------KNTGCVFANDANKNRTKSLIANIHRLGCTN 392

Query: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359
            +   V ++     P++       ++D  CSG+G+ G+    KV       S T++D   
Sbjct: 393 TI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKV-------SRTEKD--- 439

Query: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKK-----ICYSTCSIHAEE 414
                                 ++   Q Q++  A+    A       I YSTCS+  EE
Sbjct: 440 --------------------FIQIPHLQKQLLLSAIDSVDANSKSGGVIVYSTCSVAVEE 479

Query: 415 NERVV 419
           +E VV
Sbjct: 480 DEAVV 484

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 110/262 (41%), Gaps = 59/262 (22%)

Query: 180 QRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPN 239
           Q +  W ++  G   +D  +P          I +  +Y  G  I+Q  +S  P   L+P+
Sbjct: 298 QPIGPWTKV--GLQIFDSQVP----------IGATPEYLAGHYILQAASSFLPVIALDPH 345

Query: 240 STDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAK 299
             + ++D  AAPG KTT+++A +        ++  + A + +  R K+L   +   GC  
Sbjct: 346 ENERILDMAAAPGGKTTYISAMM-------KNTGCVFANDANKSRTKSLIANIHRLGCTN 398

Query: 300 GVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTS 359
            +   V ++     P++       ++D  CSG+G+ G+    KV       S T++D   
Sbjct: 399 TI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKV-------SRTEKDFIQ 448

Query: 360 VEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVV 419
           +  ++  K+L          L+ + S      KH         I YSTCS+  EE+E VV
Sbjct: 449 IPHLQ--KQLL---------LSAIDSVDCN-SKHGGV------IVYSTCSVAVEEDEAVV 490

Query: 420 IDLLLDSKVKEWGWKVRKRTGV 441
                        + +RKR  V
Sbjct: 491 ------------NYALRKRPNV 500

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 120/340 (35%), Gaps = 85/340 (25%)

Query: 198 YIPNLFGIH---PGDKITSHEQYKR-----------GKIIIQDRASCFPAHILNPNSTDV 243
           + PN  G     P   I  +EQ+ +           G I  Q+  S  P  +L       
Sbjct: 109 WYPNHLGWQLDVPKTVIRKNEQFAKTQRYLVVENAVGNISRQEAVSMIPPIVLEVEPQHT 168

Query: 244 VIDACAAPGNKTTHVAAHIFGDVD--------TKVDSVKIHAFEKDPERAKTLQMMVATA 295
           V+D CAAPG+KT  +   +  D D           D+ + H      +R  +  +MV   
Sbjct: 169 VLDMCAAPGSKTAQLIEALHKDTDEPTGFVVANDADARRSHMLVHQLKRLNSANLMVVNH 228

Query: 296 GCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDE 355
                 +I + D  +  +  L       + D  CSG G   +     VN+ K  ++    
Sbjct: 229 DAQFFPRIKLHDDAEKKRDML--KFDRILCDVPCSGDGTMRKN----VNVWKDWNAQG-- 280

Query: 356 DQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSF--PSAKKICYSTCSIHAE 413
                                      L + Q+ I+   +    P+ + + YSTCS++  
Sbjct: 281 ------------------------ALGLHTVQWNILNRGLHLLKPNGR-LVYSTCSLNPI 315

Query: 414 ENERVVIDLLLDSKVKEWGWKVRK-----------RTGVIPTWPRRGWTSE--------- 453
           ENE VV   L     ++WG K+R            R+  I  WP      E         
Sbjct: 316 ENEAVVAQAL-----RKWGNKIRLVNCDEKLPGLVRSKGISQWPVLNRDLETKNKNDEGV 370

Query: 454 FEEVFP--KEEAKEL-AEGCIRALPKEDGGIGFFAVCFER 490
            E  FP  +EEA     + CIR  P +    GFF   FE+
Sbjct: 371 LESWFPPSEEEASLFNLDACIRVYPHQQNTGGFFITVFEK 410

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 115/305 (37%), Gaps = 73/305 (23%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVD--------TKVD 271
           G I  Q+  S  P  +L+      V+D CAAPG+KT  +  ++  D D           D
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHRDNDEPSGFVVANDAD 201

Query: 272 SVKIHAFEKDPERAKTLQMMVAT--AGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSC 329
           + + H      +R  +  ++V    A     VK H  D T       F  V   + D  C
Sbjct: 202 AKRSHMLVHQLKRLNSANLIVVNHDAQFFPRVKAH-PDHTNKKDILRFDRV---LCDVPC 257

Query: 330 SGSGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQ 389
           SG G   RK +           N   D T+                 +N LA L + Q  
Sbjct: 258 SGDGTM-RKNV-----------NVWRDWTT-----------------QNGLA-LHNVQLN 287

Query: 390 IVKHAMSF-PSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVRK----------- 437
           I+   +    S  ++ YSTCS++  ENE VV + L     ++WG KVR            
Sbjct: 288 ILNRGLHLLKSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGGKVRLVDCSDKLPGLV 342

Query: 438 RTGVIPTWP---------RRGWTSEFEEVFP---KEEAKELAEGCIRALPKEDGGIGFFA 485
           R+  I  WP          +G     +  FP   +E A+   + C+R  P +    GFF 
Sbjct: 343 RSNGINQWPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFFI 402

Query: 486 VCFER 490
              E+
Sbjct: 403 TVLEK 407

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 111/278 (39%), Gaps = 66/278 (23%)

Query: 156 IRINPILVKERYDDVLAELNKKFPQRVNSWKQIVP----GSIYYDEYIPNLFGIHPGDKI 211
           IR N +  + R      +L +    R  + K I P    G   +D  +P          I
Sbjct: 282 IRTNSLKTRRR------DLAQTLVNRGVNLKPIGPWTKVGLQIFDSQVP----------I 325

Query: 212 TSHEQYKRGKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVD 271
            +  +Y  G  I+Q  +S  P   L+P+  + ++D  AAPG KTT+++A +        +
Sbjct: 326 GATPEYLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMM-------KN 378

Query: 272 SVKIHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSG 331
           +  + A + +  R K+L   +   GC   +   V ++     P++       ++D  CSG
Sbjct: 379 TGCVFANDANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSG 435

Query: 332 SGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIV 391
           +G+  +    KV       S T++D                         ++   Q Q++
Sbjct: 436 TGVIAKDQSVKV-------SRTEKD-----------------------FIQIPHLQKQLL 465

Query: 392 KHAMSFPSAKK-----ICYSTCSIHAEENERVVIDLLL 424
             A+    A       I YSTCS+  EENE  VID  L
Sbjct: 466 LSAIDSVDANSKTGGVIVYSTCSVAVEENE-AVIDYAL 502

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/341 (22%), Positives = 118/341 (34%), Gaps = 87/341 (25%)

Query: 198 YIPNLFGIH---PGDKITSHEQYKR-----------GKIIIQDRASCFPAHILNPNSTDV 243
           + PN F      P   I   EQ+ +           G I  Q+  S  P  +L       
Sbjct: 109 WYPNHFAWQLDVPKTVIRKQEQFAKMQRFLVVENAVGNISRQEAVSMIPPLVLEVKPHHT 168

Query: 244 VIDACAAPGNKTTHV--AAHIFGD------VDTKVDSVKIHAFEKDPERAKTLQMMVAT- 294
           V+D CAAPG+KT  +  A H+         V    D  + H      +R  +  MMV   
Sbjct: 169 VLDMCAAPGSKTAQMIEALHMENAEPTGFVVANDSDYRRSHMLVHQLKRLNSANMMVVNH 228

Query: 295 -AGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNT 353
            A     +K+ VGD     K +        + D  CSG G   +     VN+ K  ++  
Sbjct: 229 DAQFFPRIKLSVGD----NKAKDALKFDRILCDVPCSGDGTMRKN----VNVWKDWNTQA 280

Query: 354 DEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSF-PSAKKICYSTCSIHA 412
                                        L + QY I+   +    +  ++ YSTCS++ 
Sbjct: 281 G--------------------------LGLHTIQYNILNRGLHLLKTGGRLVYSTCSLNP 314

Query: 413 EENERVVIDLLLDSKVKEWGWKVR-----------KRTGVIPTWP---------RRGWTS 452
            ENE VV   L     + WG K++            R+  +  WP          +G   
Sbjct: 315 IENEAVVARAL-----RTWGSKIKIINCDDKLPGLIRSNGVTQWPVFDRNMESKNKGDEG 369

Query: 453 EFEEVFPKEEAKELA---EGCIRALPKEDGGIGFFAVCFER 490
             E  FP  + +  A   + C+R  P +    GFF    E+
Sbjct: 370 TLESWFPPTDEEVTAFNLQNCMRVYPHQQNTGGFFITVIEK 410

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 120/309 (38%), Gaps = 79/309 (25%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVD--------TKVD 271
           G I  Q+  S  P  +L+      V+D CAAPG+KT  +   +  D D           D
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHIDSDEPSGFVIANDAD 199

Query: 272 SVKIHAFEKDPERAKTLQMMVAT--AGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSC 329
           + + H      +R  T  +++    A     +KI+  D +   + +L       + D  C
Sbjct: 200 NKRSHLLVHQLKRLSTSNVLIVNHDAQFFPNLKINTKDAS--SQEDL--KFDRILCDVPC 255

Query: 330 SGSGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQ 389
           SG G   +     VN+ K  ++                         +N L  L + Q+ 
Sbjct: 256 SGDGTMRKN----VNVWKNWNT-------------------------QNALG-LHNVQFN 285

Query: 390 IVKHAMSF-PSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVR------KRTGVI 442
           I+   ++      K+ YSTCS++  ENE VV  +L     ++WG KVR      K  G+I
Sbjct: 286 ILDRGLTLLKETGKLVYSTCSLNPIENEAVVAAVL-----RKWGDKVRLVCCDDKLKGLI 340

Query: 443 -----PTWPRRGWTSEFEEV-------------FP---KEEAKELAEGCIRALPKEDGGI 481
                 TWP      + EEV             +P   +E +K   + C+R  P +    
Sbjct: 341 RSKGLTTWPV--INRDMEEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTG 398

Query: 482 GFFAVCFER 490
           GFF   FE+
Sbjct: 399 GFFITMFEK 407

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 110/303 (36%), Gaps = 69/303 (22%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVD--------TKVD 271
           G I  Q+  S  P  +L       V+D CAAPG+KT  +   +  D D           D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 272 SVKIHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSG 331
           + + H      +R  +  +MV         +I + + +   K          + D  CSG
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHENS--NKKNDVLKFDRILCDVPCSG 262

Query: 332 SGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIV 391
            G   +     VN+ K  ++                               L + Q  I+
Sbjct: 263 DGTMRKN----VNVWKDWNTQAG--------------------------LGLHTVQLNIL 292

Query: 392 KHAMSF-PSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVR------KRTGVIPT 444
              +       ++ YSTCS++  ENE V+ + L     ++WG K+R      K +G++ +
Sbjct: 293 NRGLHLLKDGGRLVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDDKLSGLVRS 347

Query: 445 -----WP---------RRGWTSEFEEVF-PKEE--AKELAEGCIRALPKEDGGIGFFAVC 487
                WP          +G     E  F P EE  +K   + C+R  P +    GFF   
Sbjct: 348 KGVSKWPVYDRNLTEKTKGDEGTLESFFAPSEEEASKFNLQNCMRVYPHQQNTGGFFITV 407

Query: 488 FER 490
           FE+
Sbjct: 408 FEK 410

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 106/303 (34%), Gaps = 72/303 (23%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHV--AAHIFGD------VDTKVD 271
           G I  Q+  S  P  +L       V+D CAAPG+KT  +  A H   D      V    D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQEDEPTGFVVANDAD 204

Query: 272 SVKIHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSG 331
           + + H      +R  +  +MV         +I     +K      F      + D  CSG
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSQPDSKE-----FLKFDRVLCDVPCSG 259

Query: 332 SGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIV 391
            G   RK ++      T S                                L + Q  I+
Sbjct: 260 DGTM-RKNVNVWRDWGTASG-----------------------------LGLHTVQLNIL 289

Query: 392 KHAMSF-PSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVRK-----------RT 439
              ++      ++ YSTCS++  ENE V+   L     ++WG K+R            R+
Sbjct: 290 NRGLNLLKDGGRLVYSTCSLNPIENESVIAAAL-----RKWGDKIRLVNCDEKLPGLVRS 344

Query: 440 GVIPTWP---------RRGWTSEFEEVFP--KEEAKEL-AEGCIRALPKEDGGIGFFAVC 487
             I  WP          +G     E  FP  +EEA     E CIR  P +    GFF   
Sbjct: 345 KGITQWPVYDKNFALKEKGDEGVIETWFPPTEEEATRFHLENCIRVYPHQQNTGGFFITV 404

Query: 488 FER 490
           FE+
Sbjct: 405 FEK 407

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 71/305 (23%), Positives = 114/305 (37%), Gaps = 73/305 (23%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVD--------TKVD 271
           G I  Q+  S  P  +L       V+D CAAPG+KT  +   +  D D           D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 272 SVKIHAFEKDPERAKTLQMMVAT--AGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSC 329
           + + H      +R  +  +MV    A     +++H G+ +       F  +   + D  C
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLH-GNSSNKNDVLKFDRI---LCDVPC 260

Query: 330 SGSGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQ 389
           SG G   +     VN+ K  ++                               L + Q  
Sbjct: 261 SGDGTMRKN----VNVWKDWNTQAG--------------------------LGLHTVQLN 290

Query: 390 IVKHAMSF-PSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVR------KRTGVI 442
           I+   +    +  ++ YSTCS++  ENE VV + L     ++WG K+R      K  G+I
Sbjct: 291 ILNRGLHLLKNNGRLVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDDKLPGLI 345

Query: 443 PT-----WP---------RRGWTSEFEEVF-PKEE--AKELAEGCIRALPKEDGGIGFFA 485
            +     WP          +G     E  F P EE  ++   + C+R  P +    GFF 
Sbjct: 346 RSKGVSKWPVYDRNLTEKTKGDEGTLESFFSPSEEEASRFNLQNCMRVYPHQQNTGGFFI 405

Query: 486 VCFER 490
             FE+
Sbjct: 406 TVFEK 410

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 76/327 (23%), Positives = 119/327 (36%), Gaps = 80/327 (24%)

Query: 207 PGDKITSHEQYKR-----------GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKT 255
           P   I  HEQ+ +           G I  Q+  S  P  +L   S   V+D CAAPG+KT
Sbjct: 120 PKTVIRKHEQFAKTQRFLVVETAVGNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKT 179

Query: 256 THV--AAHIFGDVDTKV------DSVKIHAFEKDPERAKTLQMMVATAGCAKGVKIHVGD 307
             +  A H   D  T +      D+ + H      +R  +  +MV         +I + +
Sbjct: 180 AQLIEALHTNEDEPTGIVVANDADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIALHE 239

Query: 308 FTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEK 367
            T       F      + D  CSG G   RK +           N   D TS   +    
Sbjct: 240 NTTDSND--FLKFDRILCDVPCSGDGTM-RKNV-----------NVWRDWTSQGGL---- 281

Query: 368 ELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAK-KICYSTCSIHAEENERVVIDLLLDS 426
                          L + Q  I+   +     K ++ YSTCS++  ENE V+      +
Sbjct: 282 --------------GLHNIQLNILNRGLHLLKPKGRLVYSTCSMNPIENEAVIA-----A 322

Query: 427 KVKEWGWKVR-----------KRTGVIPTWP---------RRGWTSEFEEVFP---KEEA 463
            +++WG K+R            R+  I +WP         ++G        FP   +E++
Sbjct: 323 ALRKWGSKIRVINCDEKLPGLVRSKGIDSWPVFNRDMEIRQKGDQGVSNTWFPPSEEEKS 382

Query: 464 KELAEGCIRALPKEDGGIGFFAVCFER 490
           +   + CIR  P +     FF    E+
Sbjct: 383 QFNLQNCIRVYPHQQNTGAFFITVIEK 409

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 103/297 (34%), Gaps = 69/297 (23%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVD--------TKVD 271
           G I  Q+  S  P  +L       V+D CAAPG+KTT +   +  D D           D
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKDTDEPTGFVVANDAD 202

Query: 272 SVKIHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSG 331
           S + H      +R  +  +MV         +I + D     K +L       + D  CSG
Sbjct: 203 SRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIILSDEPSKKKAQL--KFDRILCDVPCSG 260

Query: 332 SGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIV 391
            G   +     VN+ K  ++                               L + Q  I+
Sbjct: 261 DGTMRK----NVNVWKDWNTQG--------------------------ALGLHTVQLNIL 290

Query: 392 KHAMS-FPSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVRK-----------RT 439
              +    +  ++ YSTCS++  ENE VV + L     + WG KVR            R+
Sbjct: 291 DRGLHLLQNNGRLVYSTCSMNPIENEAVVAEAL-----RRWGDKVRLVDCSEKLPGLIRS 345

Query: 440 GVIPTWPRRGWTSE---------FEEVFPKEE---AKELAEGCIRALPKEDGGIGFF 484
             I  WP      E             FP  E   +K   E C+R  P +    GFF
Sbjct: 346 QGITQWPVIDRNMEERKKEDEGMINSWFPPSEEEVSKFHLERCMRVYPHQQNTGGFF 402

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 108/302 (35%), Gaps = 67/302 (22%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFE 279
           G I  Q+  S  P  +L   S   V+D CAAPG+KT  +   +  D D       I A +
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKDTDEPTGI--IVAND 216

Query: 280 KDPERAKTL--QMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTG----FIVDPSCSGSG 333
            D  R+  L  Q+    +     V      F  +    L  N+T      + D  CSG G
Sbjct: 217 SDMRRSYLLVHQLKRLNSSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGDG 276

Query: 334 IFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKH 393
              RK I+  N                            +   +N L  L   Q  I+  
Sbjct: 277 TL-RKNINIWN----------------------------DWRFQNALG-LHRLQNNILNR 306

Query: 394 AMS-FPSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVRK-----------RTGV 441
            +    +  ++ YSTCS++  ENE V+ + L     + W  +V             R+  
Sbjct: 307 GLQLLRNGGRLVYSTCSMNPIENEAVIANAL-----RNWAGEVSLVNFDDELPGLIRSRG 361

Query: 442 IPTWP---------RRGWTSEFEEVFP--KEEAKEL-AEGCIRALPKEDGGIGFFAVCFE 489
           I +WP          RG     +  FP   +E K    E CIR  P +     FF   FE
Sbjct: 362 ISSWPVIDRNGEMRERGDPETLDSWFPPTADEQKTFNLEKCIRVYPHQQDTGAFFIAVFE 421

Query: 490 RD 491
           ++
Sbjct: 422 KN 423

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 108/303 (35%), Gaps = 69/303 (22%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVD--------TKVD 271
           G I  Q+  S  P  +L       V+D CAAPG+KT  +   +  D D           D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLEALHRDTDEPTGFVVANDAD 204

Query: 272 SVKIHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSG 331
           + + H      +R  +  ++V         +I     ++  K +L +     + D  CSG
Sbjct: 205 NRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSKNSE-KKSDLLK-FDRILCDVPCSG 262

Query: 332 SGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIV 391
            G   RK ++                              ++ + +N L  L   Q  I+
Sbjct: 263 DGTM-RKNVN----------------------------VWRDWNTQNALG-LHQVQANIL 292

Query: 392 KHAMSF-PSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVRK-----------RT 439
              +       ++ YSTCS++  ENE VV   L     ++WG KVR            R 
Sbjct: 293 NRGLHLLKKGGRLVYSTCSMNPIENEAVVAQAL-----RKWGDKVRLVNCDDKLPGLVRN 347

Query: 440 GVIPTWP---------RRGWTSEFEEVF-PKEEAKE--LAEGCIRALPKEDGGIGFFAVC 487
             I  WP          +G     +  F P EE  E    E CIR  P +    GFF   
Sbjct: 348 KGISKWPTLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGFFITV 407

Query: 488 FER 490
           FE+
Sbjct: 408 FEK 410

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 113/308 (36%), Gaps = 79/308 (25%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVD--------TKVD 271
           G I  Q+  S  P  +L       V+D CAAPG+KT  +   +  D D           D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 272 SVKIHAFEKDPERAKTLQMMVAT--AGCAKGVKIHVGDFTKLGKPELFQNVTGF---IVD 326
           + + H      +R  +  +MV    A     +++H     K        +V  F   + D
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNK-------NDVLKFDRILCD 257

Query: 327 PSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSF 386
             CSG G   +     VN+ K  ++                               L + 
Sbjct: 258 VPCSGDGTMRKN----VNVWKDWNTQAG--------------------------LGLHAV 287

Query: 387 QYQIVKHAMSF-PSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVR------KRT 439
           Q  I+   +    +  ++ YSTCS++  ENE VV + L     ++WG K+R      K  
Sbjct: 288 QLNILNRGLHLLKNNGRLVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDDKLP 342

Query: 440 GVIPT-----WP---------RRGWTSEFEEVF-PKEE--AKELAEGCIRALPKEDGGIG 482
           G+I +     WP          +G     +  F P EE  +K   + C+R  P +    G
Sbjct: 343 GLIRSKGVSKWPVYDRNLTEKTKGDEGTLDSFFSPSEEEASKFNLQNCMRVYPHQQNTGG 402

Query: 483 FFAVCFER 490
           FF   FE+
Sbjct: 403 FFITVFEK 410

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 107/303 (35%), Gaps = 68/303 (22%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVD--------TKVD 271
           G I  Q+  S  P  +L+      V+D CAAPG+KT  +   +  + D           D
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHAESDEPSGFVIANDAD 204

Query: 272 SVKIHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSG 331
             + H      +R  +  +MV         +I V D T+  K   F      + D  CSG
Sbjct: 205 YKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKV-DSTEGSKGPQFLKFDRVLCDVPCSG 263

Query: 332 SGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIV 391
            G   RK ++      TGS                                L   Q  I+
Sbjct: 264 DGTM-RKNVNVWKDWNTGSG-----------------------------LGLHIVQLNIL 293

Query: 392 KHAMS-FPSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVRK-----------RT 439
           +  ++      K+ YSTCS++  ENE V+      + ++ WG KVR            R+
Sbjct: 294 ERGLNLLKEGGKLVYSTCSLNPIENEAVIA-----AALRRWGDKVRLVNCDDQLPGLVRS 348

Query: 440 GVIPTWP---------RRGWTSEFEEVFP---KEEAKELAEGCIRALPKEDGGIGFFAVC 487
             I  W           +G  +  +  FP   +E  K   E C+R    +    GFF   
Sbjct: 349 KGITEWKVYDKQFQVREKGHENCLDSWFPPTAEEVEKFHLENCMRVYQHQQNTGGFFITV 408

Query: 488 FER 490
           FE+
Sbjct: 409 FEK 411

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 70/305 (22%), Positives = 111/305 (36%), Gaps = 72/305 (23%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHV--AAHIFGD------VDTKVD 271
           G I  Q+  S  P  +L+      V+D CAAPG+KT  +  A H+ G       V    D
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGPEPSGFVVANDSD 198

Query: 272 SVKIHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSG 331
           S + H      +R  +  +MV         KI + D  K    + +      + D  CSG
Sbjct: 199 SKRSHMLVHQLKRLNSANLMVVNHDAQFFPKIQL-DSNKGRHNKEYLKFDRILCDVPCSG 257

Query: 332 SGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIV 391
            G   RK ++                              K+ + +N L  L + Q  I+
Sbjct: 258 DGTI-RKNVN----------------------------IWKDWNTQNSLG-LHNVQLNIL 287

Query: 392 KHAMS-FPSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWG------------------ 432
              +    S  ++ YSTCS+   ENE V+      + +++WG                  
Sbjct: 288 NRGIQLLKSGGRLVYSTCSLSPIENEAVI-----SATLRKWGNKIKLVDCKEMLPGLISS 342

Query: 433 -----WKVRKRT-GVIPTWPRRGWTSEFEEVFPKEEAKEL-AEGCIRALPKEDGGIGFFA 485
                W+V  RT  ++     +   + F+    +EEA +     CIR  P +    GFF 
Sbjct: 343 PGISKWEVYDRTMSIVSKGAEKSKDTWFQPT--EEEANDFNLSHCIRVFPHQQNTGGFFI 400

Query: 486 VCFER 490
              E+
Sbjct: 401 AVLEK 405

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 107/300 (35%), Gaps = 66/300 (22%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFE 279
           G I  Q+  S  P  +L   S   V+D CAAPG+KT  +   +    D     V   A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALHSSEDEPTGFVV--AND 202

Query: 280 KDPERAKTLQMMVATAGCAKGVKI-HVGDFTKLGKPE----LFQNVTGFIVDPSCSGSGI 334
            D  R+  L   +     A  V + H   F    K +     F      + D  CSG G 
Sbjct: 203 ADARRSHMLVHQLKRLNSANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGT 262

Query: 335 FGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHA 394
             +     VN+ K   + +                             L + Q  I+K  
Sbjct: 263 MRKN----VNVWKDWGTASG--------------------------LGLHTVQLNILKRG 292

Query: 395 MSF-PSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVR-----------KRTGVI 442
           ++      ++ YSTCS++  ENE VV   L     ++WG K++            R+  I
Sbjct: 293 LNLLKKGGRLVYSTCSMNPIENEAVVAAAL-----RQWGDKIKLVDCSDKLPGLVRSKGI 347

Query: 443 PTWP---------RRGWTSEFEEVFP--KEEAKEL-AEGCIRALPKEDGGIGFFAVCFER 490
             WP          +G     E  FP   EEA +   + CIR  P +    GFF    E+
Sbjct: 348 SNWPVIDKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFFITVIEK 407

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 109/303 (35%), Gaps = 72/303 (23%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHV--AAHIFGD------VDTKVD 271
           G I  Q+  S  P  +L       V+D CAAPG+KT  +  A H  G       V    D
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGPEPSGFVVANDAD 204

Query: 272 SVKIHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSG 331
             + H      +R  +  ++V         +I   + +K      F      + D  CSG
Sbjct: 205 YRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSEGSKD-----FLRFDRVLCDVPCSG 259

Query: 332 SGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIV 391
            G   RK I+      T S                                L + Q  I+
Sbjct: 260 DGTM-RKNINVWKDWATASG-----------------------------LGLHTVQVNIL 289

Query: 392 KHAMSF-PSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVRK-----------RT 439
              ++      ++ YSTCS++  ENE VV      + +++WG K++            R+
Sbjct: 290 NRGLNLLKDGGRLVYSTCSLNPIENEAVVA-----AALRKWGDKIKLVECGDKLPGLIRS 344

Query: 440 GVIPTWP--RRGWTSEFE-------EVFP---KEEAKELAEGCIRALPKEDGGIGFFAVC 487
             I  WP   +G+ ++           FP   +E +K   E C+R  P +    GFF   
Sbjct: 345 QGISQWPVYDKGFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAV 404

Query: 488 FER 490
           FE+
Sbjct: 405 FEK 407

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 112/304 (36%), Gaps = 71/304 (23%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFE 279
           G I  Q+  S  P  +L       V+D CAAPG+KT  +   +  D +     V   A +
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLEALHRDSNEPTGFVV--AND 196

Query: 280 KDPERAKTLQMMVATAGCAKGVKIH--VGDFTKLGKPELFQNVTGF------IVDPSCSG 331
            D  RA  L   +     A  + ++     F K+       N +G       + D  CSG
Sbjct: 197 SDSRRAYMLVHQLKRLNSANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILCDVPCSG 256

Query: 332 SGIFGRKAIDKVNLSKTGSSNTDEDQTSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIV 391
            G   RK ++                              K+ + +N L  L + Q  I+
Sbjct: 257 DGTM-RKNVN----------------------------VWKDWNTQNALG-LHNVQLNIL 286

Query: 392 KHAMS-FPSAKKICYSTCSIHAEENERVVIDLLLDSKVKEWGWKVR------KRTGVIPT 444
              +       ++ YSTCS++  ENE VV      + +++WG K++      K  G++ +
Sbjct: 287 NRGLQLLKDNGRLVYSTCSLNPIENEAVVA-----AALRKWGNKIKLVDCQNKLQGLVRS 341

Query: 445 WPRRGW------------------TSEFEEVFPKEEAKELAEGCIRALPKEDGGIGFFAV 486
                W                  +S FE    ++E   L E C+R  P +    GFF  
Sbjct: 342 NGISHWSVYDREMNAITKDSESTKSSWFEPTDAEKENFNL-EHCMRVYPHQQNTGGFFIA 400

Query: 487 CFER 490
            FE+
Sbjct: 401 VFEK 404

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 50/130 (38%), Gaps = 14/130 (10%)

Query: 220 GKIIIQDRASCFPAHILNPNSTDVVIDACAAPGNKTTHV--AAHIFGD------VDTKVD 271
           G I  Q+  S  P  +L       V+D CAAPG+KT  +  A H   D      V    D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALHATEDEPTGFVVANDAD 204

Query: 272 SVKIHAFEKDPERAKTLQMMVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSG 331
           + + H      +R  +  +MV         ++ + + +       F      + D  CSG
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRVKLDNDSN-----QFLKFDRVLCDVPCSG 259

Query: 332 SGIFGRKAID 341
            G   RK ++
Sbjct: 260 DGTM-RKNVN 268

>TPHA0A03430 Chr1 complement(751127..752620) [1494 bp, 497 aa] {ON}
           Anc_3.390 YPR084W
          Length = 497

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 38/91 (41%), Gaps = 1/91 (1%)

Query: 231 FPAHILNPNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERA-KTLQ 289
            P + + P+ T ++ID    PG K   V   +   +   +    +H    +P RA  T  
Sbjct: 195 IPGNYVPPDYTPILIDIIDTPGFKPEMVVPFLEVSLFRNLGKNILHGLADEPRRAVSTTS 254

Query: 290 MMVATAGCAKGVKIHVGDFTKLGKPELFQNV 320
           ++VA+       KI    FT    PEL  N+
Sbjct: 255 LLVASGAAELNGKIDGYIFTYSAVPELSHNI 285

>KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} similar
           to uniprot|P09959 Saccharomyces cerevisiae YLR182W SWI6
           Transcription cofactor forms complexes with DNA-binding
           proteins Swi4p and Mbp1p to regulate transcription at
           the G1/S transition involved in meiotic gene expression
           localization regulated by phosphorylation potential
           Cdc28p substrate
          Length = 663

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%)

Query: 76  PKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQTRLK 123
           P KK KP     T+R   HDL L+    +Q+ K P+KTF  + + +L+
Sbjct: 131 PLKKLKPAEAFQTVRTFSHDLDLASPLAVQLAKKPLKTFQPEERVKLE 178

>ZYRO0C12430g Chr3 (981824..981840,981909..983340) [1449 bp, 482 aa]
           {ON} similar to uniprot|P53255 Saccharomyces cerevisiae
           YGR093W Hypothetical ORF
          Length = 482

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 15/104 (14%)

Query: 260 AHIFGDVDTKVDSVKIHA-----FEKDPERAKTLQMMVATAGCAKGV-KIHVGDFTKLGK 313
           A + G++ +K+DS+KI A     F    + +    +++   G  K   K+ +G FT   +
Sbjct: 36  AILLGNIGSKLDSIKITAKLPPIFVPGNDDSNIEGLVILKNGIYKSASKLKIGYFTGSNE 95

Query: 314 PEL--FQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDE 355
            EL  F +    ++ P CS        AI K +L   G+S  DE
Sbjct: 96  EELSKFNDPVDILITPECS-------VAIGKEHLKTPGNSQVDE 132

>TBLA0F02540 Chr6 (615371..619162) [3792 bp, 1263 aa] {ON} Anc_6.123
           YBR225W
          Length = 1263

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 144 TDDGEDVTPVRWIRINPILVKERYDDVLAELN-KKFPQRVNSWKQIVPGSIYYDEY 198
           T D  D+  VR I ++PI+ +  YD  L E     FP  +N W    P SI++D Y
Sbjct: 624 TKDSIDILFVRPIFVSPIVWQLAYD--LPEFTIADFPIDLNPWISDDPDSIFFDNY 677

>KAFR0B06650 Chr2 complement(1386066..1387784) [1719 bp, 572 aa]
           {ON} Anc_6.174 YGL095C
          Length = 572

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (65%)

Query: 168 DDVLAELNKKFPQRVNSWKQIVPGSIYYDEYIPNLFGI 205
           DD+L+EL KKF  R++++K+    +  Y ++IP L  I
Sbjct: 459 DDLLSELAKKFNTRMDAYKKTNVSNNVYMQHIPKLSNI 496

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 10/74 (13%)

Query: 241 TDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAKG 300
           +D+V++     GN TT +             + K+ A E DP  A  L   V      K 
Sbjct: 57  SDIVLEVGPGTGNLTTRILEK----------ARKVVAVEFDPRMAAELTKRVHGTAAEKK 106

Query: 301 VKIHVGDFTKLGKP 314
           ++I +GDFTK   P
Sbjct: 107 LEIILGDFTKTELP 120

>TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5.370
           YHR080C
          Length = 1708

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 195 YDEYIPNLFGIHPGDKIT-------SHEQYKRGKIIIQDRASCFPAHIL 236
           +  +  N+ GI P +K+        S +  ++GK+ I DR  CF A+IL
Sbjct: 826 FHSFFKNINGISPDEKLIIDITCALSRDILQQGKMYITDRNICFNANIL 874

>Kwal_27.12148 s27 (1107013..1108686) [1674 bp, 557 aa] {ON}
          YPL086C (ELP3) - RNA polymerase II-associated Histone
          acetyltransferase [contig 23] FULL
          Length = 557

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 12/57 (21%)

Query: 27 SLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYREYLDKIIKKSGILEDVPKKKGKPL 83
          +L  L++   K+YKLK  PR    I S   QY++YL            +PK K KP+
Sbjct: 46 NLNGLIMKYSKKYKLKQQPRLTDVINSIPDQYKKYL------------LPKLKAKPV 90

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,455,736
Number of extensions: 2323758
Number of successful extensions: 8807
Number of sequences better than 10.0: 88
Number of HSP's gapped: 8918
Number of HSP's successfully gapped: 108
Length of query: 491
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 377
Effective length of database: 40,409,475
Effective search space: 15234372075
Effective search space used: 15234372075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)