Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E08339g2.287ON36936919540.0
TDEL0G021802.287ON36936916270.0
NCAS0B062502.287ON37337316100.0
KLTH0G10384g2.287ON36736815990.0
KNAG0A054202.287ON37237115830.0
CAGL0G02585g2.287ON37237215810.0
Kwal_27.115282.287ON36736815660.0
Smik_9.852.287ON37137115660.0
SAKL0E07656g2.287ON36836815650.0
YIL094C (LYS12)2.287ON37137115650.0
Suva_9.1052.287ON37137115620.0
Skud_9.792.287ON37137115530.0
NDAI0B035502.287ON37237215530.0
ZYRO0A01914g2.287ON36836915520.0
Kpol_1003.392.287ON37036015220.0
TBLA0B059402.287ON36936915080.0
Ecym_33262.287ON36636814830.0
TPHA0C034102.287ON37135314750.0
KAFR0J013602.287ON37335114530.0
ADL214C2.287ON36736813380.0
Ecym_33162.278ON3623804794e-56
ADL223W2.278ON3623804794e-56
Suva_8.1885.473ON3693914725e-55
TPHA0D015602.278ON3603784708e-55
CAGL0I07227g5.473ON3683604701e-54
Smik_15.3165.473ON3693914664e-54
SAKL0G03520g5.473ON3693964655e-54
KLLA0E03125g5.473ON3683544655e-54
Ecym_23135.473ON3703534622e-53
KLTH0F15048g5.473ON3683894603e-53
YOR136W (IDH2)5.473ON3693974571e-52
Skud_15.3005.473ON3693594551e-52
YNL037C (IDH1)2.278ON3603544533e-52
AFR137C5.473ON3673914533e-52
Kwal_55.212735.473ON3683954525e-52
Kpol_543.85.473ON3683544525e-52
KLLA0F04103g2.278ON3613504508e-52
Skud_14.2932.278ON3613544499e-52
NCAS0H022505.473ON4223594549e-52
Smik_14.2902.278ON3603544491e-51
KLTH0G10186g2.278ON3603854491e-51
SAKL0E07876g2.278ON3613844472e-51
NDAI0C014105.473ON3693544482e-51
NDAI0B035902.278ON3593544411e-50
KNAG0B040705.473ON3733924403e-50
TPHA0J027705.473ON3763534403e-50
TDEL0C038402.278ON3613564393e-50
Kwal_23.50122.278ON3613534384e-50
TDEL0A033705.473ON3713594385e-50
KAFR0B063705.473ON3783594387e-50
Kpol_440.125.473ON3683534378e-50
TBLA0B022405.473ON3733604361e-49
Kpol_1039.352.278ON3593764351e-49
ZYRO0D11220g5.473ON3683554316e-49
CAGL0G02673g2.278ON3583764306e-49
TPHA0E014805.473ON3773564309e-49
NCAS0B062902.278ON3593544253e-48
ZYRO0D02838g2.278ON3613534175e-47
TBLA0B069102.278ON3653524114e-46
KAFR0J014102.278ON3503734096e-46
KNAG0A052802.278ON3613544001e-44
Ecym_12961.402ON3633663704e-40
TBLA0C015001.402ON3653723705e-40
Smik_3.661.402ON3643643531e-37
YCL018W (LEU2)1.402ON3643643531e-37
KLTH0H12188g1.402ON3643643531e-37
KLLA0D04906g1.402ON3623693502e-37
TDEL0B060001.402ON3623673494e-37
AAL012C1.402ON3723653486e-37
Suva_14.3022.278ON3002963446e-37
Skud_3.431.402ON3643643477e-37
Kpol_1048.631.402ON3643673442e-36
KAFR0I022001.402ON3653713415e-36
NDAI0G042301.402ON3633663407e-36
Kwal_0.2251.402ON3643743354e-35
KNAG0I012801.402ON4473733394e-35
CAGL0H03795g1.402ON3653663346e-35
Suva_3.31.402ON3643683214e-33
ZYRO0E04796g1.402ON3623713162e-32
NCAS0C048701.402ON3653673129e-32
SAKL0D08690g1.402ON3643643083e-31
TPHA0B037301.402ON3653732831e-27
Kwal_23.42104.254ON4222971452e-09
KAFR0H031601.396ON4211341372e-08
YDL066W (IDP1)4.254ON4281061354e-08
KNAG0D044104.254ON4281721345e-08
Skud_4.1894.254ON4291061345e-08
Kpol_1055.784.254ON4271151346e-08
KLTH0H12012g1.396ON4132081337e-08
KLTH0D14476g4.254ON4201851328e-08
CAGL0H03663g1.396ON4181061311e-07
AAL022W1.396ON4152161311e-07
SAKL0H02860g4.254ON4211981311e-07
Smik_4.1694.254ON4281061301e-07
NCAS0A087201.396ON4131311302e-07
AER061C4.254ON4251401302e-07
TDEL0E011604.254ON4231851292e-07
KNAG0I013201.396ON4121331282e-07
TPHA0B022104.254ON4331731273e-07
NCAS0G036201.396ON4181281264e-07
CAGL0B04917g1.396ON4111061265e-07
Suva_4.1844.254ON4291061265e-07
Ecym_13061.396ON4151061265e-07
Kpol_1048.701.396ON4191061265e-07
Suva_10.2711.396ON4121301231e-06
NCAS0A025104.254ON4261061231e-06
KLLA0F12342g1.396ON4152641231e-06
SAKL0D08426g1.396ON4111411221e-06
Skud_12.2391.396ON4121061222e-06
CAGL0D00770g4.254ON4231331222e-06
KLLA0B03355g4.254ON4291061212e-06
Skud_14.3181.396ON4201061212e-06
Kwal_0.1911.396ON4111261212e-06
TBLA0C012901.396ON4181071212e-06
Smik_12.2351.396ON4121061212e-06
TDEL0B061001.396ON4141511202e-06
Smik_14.3191.396ON418901202e-06
KAFR0G032604.254ON4211741202e-06
KNAG0H016701.396ON4241091203e-06
KAFR0I021301.396ON4081071203e-06
NDAI0D043604.254ON4241061194e-06
ZYRO0B12496g4.254ON4221181184e-06
ZYRO0E05016g1.396ON4111441185e-06
YLR174W (IDP2)1.396ON4121061175e-06
NDAI0G008501.396ON4191071177e-06
Suva_14.3391.396ON4171331168e-06
Suva_14.303singletonON53501012e-05
Ecym_32654.254ON4241061132e-05
TBLA0A080104.254ON4281141132e-05
TPHA0B036601.396ON4221061095e-05
YNL009W (IDP3)1.396ON4201331096e-05
NDAI0G051601.396ON4201071033e-04
Smik_7.3014.149ON620114731.5
CAGL0D01034g4.231ON36134694.1
AFR599W4.231ON36134694.5
SAKL0E13992g2.23ON433133685.5
TBLA0A081304.231ON36134677.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08339g
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   757   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   631   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   624   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   620   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              614   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   613   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   607   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   607   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   607   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   607   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   606   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   602   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   602   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   602   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   590   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   585   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   575   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   572   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   564   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   520   0.0  
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   189   4e-56
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   189   4e-56
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   186   5e-55
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   185   8e-55
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   185   1e-54
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   184   4e-54
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   183   5e-54
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   183   5e-54
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   182   2e-53
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   181   3e-53
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   180   1e-52
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   179   1e-52
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   179   3e-52
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   179   3e-52
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   178   5e-52
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   178   5e-52
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   177   8e-52
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   177   9e-52
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    179   9e-52
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   177   1e-51
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   177   1e-51
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   176   2e-51
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   177   2e-51
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   174   1e-50
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   174   3e-50
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   174   3e-50
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   173   3e-50
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   173   4e-50
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   173   5e-50
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   173   7e-50
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   172   8e-50
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   172   1e-49
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   172   1e-49
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   170   6e-49
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   170   6e-49
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   170   9e-49
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   168   3e-48
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   165   5e-47
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            162   4e-46
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   162   6e-46
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              158   1e-44
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   147   4e-40
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   147   5e-40
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   140   1e-37
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   140   1e-37
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   140   1e-37
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   139   2e-37
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   139   4e-37
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   138   6e-37
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   137   6e-37
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   138   7e-37
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   137   2e-36
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   135   5e-36
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   135   7e-36
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   133   4e-35
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   135   4e-35
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             133   6e-35
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      128   4e-33
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   126   2e-32
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   124   9e-32
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   123   3e-31
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   113   1e-27
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    60   2e-09
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    57   2e-08
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    57   4e-08
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    56   5e-08
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    56   5e-08
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    56   6e-08
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    56   7e-08
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    55   8e-08
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    55   1e-07
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    55   1e-07
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    55   1e-07
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    55   1e-07
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    55   2e-07
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    55   2e-07
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    54   2e-07
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    54   2e-07
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    54   3e-07
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    53   4e-07
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    53   5e-07
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    53   5e-07
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    53   5e-07
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    53   5e-07
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    52   1e-06
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    52   1e-06
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    52   1e-06
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    52   1e-06
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    52   2e-06
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    52   2e-06
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    51   2e-06
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    51   2e-06
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    51   2e-06
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    51   2e-06
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    51   2e-06
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    51   2e-06
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    51   2e-06
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    51   2e-06
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    51   3e-06
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    51   3e-06
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    50   4e-06
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    50   4e-06
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    50   5e-06
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    50   5e-06
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     50   7e-06
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    49   8e-06
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    44   2e-05
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    48   2e-05
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    48   2e-05
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    47   5e-05
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    47   6e-05
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    44   3e-04
Smik_7.301 Chr7 (506286..508148) [1863 bp, 620 aa] {ON} YGR013W ...    33   1.5  
CAGL0D01034g Chr4 complement(121908..122993) [1086 bp, 361 aa] {...    31   4.1  
AFR599W Chr6 (1516363..1517448) [1086 bp, 361 aa] {ON} Syntenic ...    31   4.5  
SAKL0E13992g Chr5 complement(1152751..1154052) [1302 bp, 433 aa]...    31   5.5  
TBLA0A08130 Chr1 complement(2009133..2010218) [1086 bp, 361 aa] ...    30   7.2  

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/369 (100%), Positives = 369/369 (100%)

Query: 1   MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ 60
           MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ
Sbjct: 1   MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ 60

Query: 61  AGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANV 120
           AGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANV
Sbjct: 61  AGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANV 120

Query: 121 RPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIAT 180
           RPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIAT
Sbjct: 121 RPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIAT 180

Query: 181 IALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVD 240
           IALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVD
Sbjct: 181 IALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVD 240

Query: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAP 300
           SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAP
Sbjct: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAP 300

Query: 301 DIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQV 360
           DIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQV
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQV 360

Query: 361 LEDVLSKLD 369
           LEDVLSKLD
Sbjct: 361 LEDVLSKLD 369

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/369 (81%), Positives = 342/369 (92%), Gaps = 1/369 (0%)

Query: 1   MMRTRFIQL-SRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDL 59
           M+R+   +L +RRAYAS  K++ IGLIPGDGIGKEVIPAGK++LE+L+ K+GL+F FIDL
Sbjct: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60

Query: 60  QAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFAN 119
           QAGW TFQ TGKALP++T+ +LKNQC+GALFGAVQSPTTKVEGYSSPIVALRK LGL+AN
Sbjct: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120

Query: 120 VRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIA 179
           VRPVKSV+GTKDR VD+VIVRENTEDLYIKLEK+Y+D+ATGTRVA+ATKRI+E+AT+ IA
Sbjct: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180

Query: 180 TIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIV 239
           TIAL IA QRL+ NGHATLTVTHKSNVLSQSDGLFRE+C++ YE+NKDKYG V YNEQIV
Sbjct: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240

Query: 240 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSA 299
           DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHGSA
Sbjct: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300

Query: 300 PDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQ 359
           PDIAGKGISNPIATIRST LMLEFLG+ +PA+DI++AVDAN+RE K  TPDLGGNSTTQQ
Sbjct: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360

Query: 360 VLEDVLSKL 368
           V+ED+LSKL
Sbjct: 361 VVEDILSKL 369

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/373 (80%), Positives = 340/373 (91%), Gaps = 5/373 (1%)

Query: 1   MMRT---RFIQLSRRAYASNA--KNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFK 55
           M+RT   RF   + R YA+NA  KNLTIGLIPGDGIGKEVIPAGK++LE+LN K+GL F 
Sbjct: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60

Query: 56  FIDLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLG 115
           FIDLQAG++TF +TGKALPDET+ +LK+QC+GALFGAVQSPTTKVEGYSSPIVALRK +G
Sbjct: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120

Query: 116 LFANVRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIAT 175
           LFANVRPVKSV GTKDR VD+VIVRENTEDLYIK+EK+YID+ATGTRVA+ATKRI+EIAT
Sbjct: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180

Query: 176 KNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYN 235
           + IATIAL IA QRL+ NG ATLTVTHKSNVLSQSDGLFRE+C++ YE+NKDKYG + YN
Sbjct: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240

Query: 236 EQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPC 295
           EQIVDSMVYRMFREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPC
Sbjct: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300

Query: 296 HGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNS 355
           HGSAPDIAGKGI+NPIATIRSTALMLEFLG+ + A+DIH+AV+AN+RE K  TPDLGGNS
Sbjct: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360

Query: 356 TTQQVLEDVLSKL 368
           TTQQV EDVL++L
Sbjct: 361 TTQQVTEDVLARL 373

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/368 (79%), Positives = 335/368 (91%), Gaps = 1/368 (0%)

Query: 1   MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ 60
           M+R  F QL+RR+YAS +K+LTIGLIPGDGIGKEVIPAG+++LE+L+ K+GL F FIDLQ
Sbjct: 1   MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ 60

Query: 61  AGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANV 120
           AGW+TFQ TGKALPDETIDIL+NQC+GALFGAVQSPT KVEGYSSPIVALRK LGL+ANV
Sbjct: 61  AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIAT 180
           RPVKSV   ++R VD++IVRENTEDLYIK EK+YIDE TGTRVA+A KRI+E ATKNIA 
Sbjct: 121 RPVKSV-LPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIAN 179

Query: 181 IALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVD 240
           IAL+IA QR + NG ATLTVTHKSNVLSQSDGLFREVCR+ YE+NKDK+G ++YNEQIVD
Sbjct: 180 IALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVD 239

Query: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAP 300
           SMVYRMFREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHGSAP
Sbjct: 240 SMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAP 299

Query: 301 DIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQV 360
           DIAGKGISNP+ATIRSTALMLEF+G+PE A+DIHKAVDAN+R+    TPDLGG STTQQV
Sbjct: 300 DIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQV 359

Query: 361 LEDVLSKL 368
           +EDVLS++
Sbjct: 360 VEDVLSRM 367

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/371 (79%), Positives = 340/371 (91%), Gaps = 3/371 (0%)

Query: 1   MMRTRFIQLSR-RAYASNA--KNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFI 57
           M+R+   +L+  R  A+NA  K+LTIGLIPGDGIGKEVIPAGK++L+SLNPK+GL+F FI
Sbjct: 2   MLRSAANKLAGCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFI 61

Query: 58  DLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLF 117
           DLQAG++TFQ+TGKALPDET+ ILK +C+GALFGAVQSPTTKVEGYSSPIVALRK +GL+
Sbjct: 62  DLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLY 121

Query: 118 ANVRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKN 177
           AN+RPVKSV+G+ +R VD++IVRENTEDLYIK+EK+YID+ATGTRVA+ATKRI+EIAT+ 
Sbjct: 122 ANIRPVKSVEGSNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQR 181

Query: 178 IATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQ 237
           IATIAL IA QRL+ NG ATLTVTHKSNVLSQSDGLFREVCRE YEANKDKY G+ YNEQ
Sbjct: 182 IATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQ 241

Query: 238 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHG 297
           IVDSMVYRMFREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHG
Sbjct: 242 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 301

Query: 298 SAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTT 357
           SAPDIAGKGI+NPIATIRSTALMLEFLG+ E A+DIHKAVDAN+R+G   T DLGGN+TT
Sbjct: 302 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNATT 361

Query: 358 QQVLEDVLSKL 368
           Q V++D+L++L
Sbjct: 362 QNVVDDILARL 372

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/372 (79%), Positives = 333/372 (89%), Gaps = 4/372 (1%)

Query: 1   MMRTRFIQLS-RRAYASN---AKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKF 56
           M+R    +L+  R ++S     K LTIGLIPGDGIGKEVIPAGK+ILE + PK+ L FKF
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60

Query: 57  IDLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGL 116
           IDL AGWETFQNTGKALPDET+++L+  C+GALFGAVQSPTTKVEGYSSPIVALRK +GL
Sbjct: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120

Query: 117 FANVRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATK 176
           FANVRPVK+V+GT DR VD+VIVRENTEDLYIK+EK+Y D ATGTRVA+ATKRI+E+AT+
Sbjct: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180

Query: 177 NIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNE 236
            IATIAL IA QRL+  GHATLTVTHKSNVLSQSDGLFRE+C++ YE+NKDKYG +QYNE
Sbjct: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240

Query: 237 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCH 296
           QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 297 GSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNST 356
           GSAPDIAG+GI+NPIATIRSTALMLEFLGYPE A+ I+KAVD+NIRE +  TPDLGG ST
Sbjct: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360

Query: 357 TQQVLEDVLSKL 368
           TQQV++D+LSK+
Sbjct: 361 TQQVVDDILSKI 372

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/368 (77%), Positives = 334/368 (90%), Gaps = 1/368 (0%)

Query: 1   MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ 60
           M+RT F QL+RR+Y S  K+LTIGLIPGDGIG+EVIPAGK +LE+L+ K+GL F FIDL+
Sbjct: 1   MLRTSFNQLARRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLE 60

Query: 61  AGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANV 120
           AGW+TF +TGKALPDETIDILKN+C+GALFGAVQSPT KVEGYSSPIVALRK LGL+ANV
Sbjct: 61  AGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIAT 180
           RPVKSV  ++++ +D+VIVRENTEDLYIK EK+YIDE TGTRVA+A KRI+E+AT+NIA 
Sbjct: 121 RPVKSV-LSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIAN 179

Query: 181 IALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVD 240
           IAL+IA QR + NG ATLTVTHKSNVLSQSDGLFRE+CR+ YE+N+DK+G + YNEQIVD
Sbjct: 180 IALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVD 239

Query: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAP 300
           SMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + V+GEPCHGSAP
Sbjct: 240 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAP 299

Query: 301 DIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQV 360
           DIAGKGISNP+ATIRSTALMLEF+G+PE A+DIHKAVDAN+R+    TPDLGG STTQQV
Sbjct: 300 DIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQV 359

Query: 361 LEDVLSKL 368
           ++DVLS++
Sbjct: 360 VDDVLSRM 367

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/371 (78%), Positives = 337/371 (90%), Gaps = 3/371 (0%)

Query: 1   MMRTRFIQLSR-RAYASNA--KNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFI 57
           M+R+   +LS  R  A+NA  K+LTIGLIPGDGIGKEVIPAGK++LE+LN K+GLSF FI
Sbjct: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 58  DLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLF 117
           DL AG++TFQ TGKALPDET+ +LK QC+GALFGAVQSPTTKVEGYSSPIVALR+ +GLF
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 118 ANVRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKN 177
           ANVRPVKSV+G KD+ +D+VIVRENTEDLYIK+EK+YID+ATGTRVADATKRI+EIAT+ 
Sbjct: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 178 IATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQ 237
           IATIA+ IA +RL+  G ATLTVTHKSNVLSQSDGLFRE+C+E YE+NKDKYG ++YNEQ
Sbjct: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 238 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHG 297
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 298 SAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTT 357
           SAPDIAGKGI+NPIATIRSTALMLEFLG+   A+DI+KAVDAN+REG   TPDLGG ++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360

Query: 358 QQVLEDVLSKL 368
           QQV+EDVLS+L
Sbjct: 361 QQVVEDVLSRL 371

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/368 (78%), Positives = 328/368 (89%)

Query: 1   MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ 60
           M+R+   Q +RR+YAS AK LTIGLIPGDGIGKEVIPAGK +LE+L+ K+ L F FIDLQ
Sbjct: 1   MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ 60

Query: 61  AGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANV 120
           AGW+TF +TGKALPDETI+ILK+ C+GALFGAVQSPT KVEGYSSPIVALRK LGL+ANV
Sbjct: 61  AGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIAT 180
           RPVKSV GT DR VD++IVRENTEDLYIK EK+YIDE TGTRVA+A KRI+E AT +IA 
Sbjct: 121 RPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180

Query: 181 IALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVD 240
           IAL+I+ QRL+ NG ATLTVTHKSNVLSQSDGLFREVC+  YE+NK++YG + YNEQIVD
Sbjct: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240

Query: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAP 300
           SMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVG + ++GEPCHGSAP
Sbjct: 241 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAP 300

Query: 301 DIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQV 360
           DIAGKGISNPIATIRSTALMLEF+GY E A+DIHKAVD NIRE +  TPDLGG STTQQV
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360

Query: 361 LEDVLSKL 368
           ++D+LSK+
Sbjct: 361 VDDILSKM 368

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/371 (78%), Positives = 336/371 (90%), Gaps = 3/371 (0%)

Query: 1   MMRTRFIQLSR-RAYASNA--KNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFI 57
           M R+   +LS  R  ASNA  K+LTIGLIPGDGIGKEVIPAGK++LE+LN K+GLSF FI
Sbjct: 1   MFRSVATRLSACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 58  DLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLF 117
           DL AG++TFQ TGKALPDET+ +LK QC+GALFGAVQSPTTKVEGYSSPIVALR+ +GLF
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 118 ANVRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKN 177
           ANVRPVKSV+G K + +D+VIVRENTEDLYIK+EK+YID+ATGTRVADATKRI+EIAT+ 
Sbjct: 121 ANVRPVKSVEGEKGKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 178 IATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQ 237
           IATIAL IA +RL+  G ATLTVTHKSNVLSQSDGLFRE+C+E YE+NKDKYG ++YNEQ
Sbjct: 181 IATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 238 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHG 297
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 298 SAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTT 357
           SAPDIAGKGI+NPIATIRSTALMLEFLG+ E A+DI+KAVDAN+REG   TPDLGG ++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKAST 360

Query: 358 QQVLEDVLSKL 368
           QQV++DVLS+L
Sbjct: 361 QQVVDDVLSRL 371

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/371 (78%), Positives = 338/371 (91%), Gaps = 3/371 (0%)

Query: 1   MMRTRFIQLSR-RAYASNA--KNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFI 57
           M R+   ++S  R  ASNA  K+LTIGLIPGDGIGKEVIPAGK+ILE+LN K+GLSF FI
Sbjct: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60

Query: 58  DLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLF 117
           DL AG++TFQ TGKALPDETI +LK+QC+GALFGAVQSPTTKVEGYSSPIVALR+ +GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120

Query: 118 ANVRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKN 177
           ANVRPVKSV+GTKD+ +D+VIVRENTEDLYIK+EK+YID+ATGTRVADA KRI+E+AT+ 
Sbjct: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180

Query: 178 IATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQ 237
           IA IAL IA QRL+  G ATLTVTHKSNVLSQSDGLFRE+C++ YE+NKDKYG ++YNEQ
Sbjct: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240

Query: 238 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHG 297
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP+IVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300

Query: 298 SAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTT 357
           SAPDIAGKGI+NPIATIRSTALMLEFLG+ + A+DI+KAVDAN+REG   TPDLGG ++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 358 QQVLEDVLSKL 368
           QQV++DVLS+L
Sbjct: 361 QQVVDDVLSRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/371 (77%), Positives = 338/371 (91%), Gaps = 3/371 (0%)

Query: 1   MMRTRFIQLSR-RAYASNA--KNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFI 57
           M R+   ++S  R  A+NA  K+LTIGLIPGDGIGKEVIPAGK++LE+LN K+GLSF FI
Sbjct: 1   MFRSVATRVSACRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 58  DLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLF 117
           DL AG++TFQ TGKALPDET+++LK QC+GALFGAVQSPTTKVEGYSSPIVALR+ +GLF
Sbjct: 61  DLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 118 ANVRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKN 177
           ANVRPVKSV+G++++ +D+VIVRENTEDLYIK+EK+YID+ATGTRVADATKRI+EIAT+ 
Sbjct: 121 ANVRPVKSVEGSRNKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 178 IATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQ 237
           IATIAL IA +RL+  G ATLTVTHKSNVLSQ+DGLFRE+C+E YE+NKDKYG ++YNEQ
Sbjct: 181 IATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 238 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHG 297
           IVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 298 SAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTT 357
           SAPDIAGKGI+NPIATIRSTALMLEFLG+   A+DI+KAVDAN+REG   TPDLGG ++T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 358 QQVLEDVLSKL 368
           QQV++DVLS+L
Sbjct: 361 QQVVDDVLSRL 371

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/372 (79%), Positives = 335/372 (90%), Gaps = 4/372 (1%)

Query: 1   MMRTRFIQLSR-RAYASNA--KNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFI 57
           M+RT   +L+  R YA+NA  KNLTIGLIPGDGIGKEVIPAGK++L++LN K+GL+F FI
Sbjct: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60

Query: 58  DLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLF 117
           DLQAG++TF +TGKALPDETI +LKNQC+GALFGAVQSPTTKVEGYSSPIVALRK +GL+
Sbjct: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120

Query: 118 ANVRPVKSVDGTKDRKVDLVIVRENTEDLY-IKLEKSYIDEATGTRVADATKRITEIATK 176
           ANVRPVKSV+GT D+ VD+VIVRENT     IKLE++YID ATGTRVA+ATKRI+EIAT+
Sbjct: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180

Query: 177 NIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNE 236
            IATIAL IA QRL+ NG ATLTVTHKSNVLSQSDGLFRE+C++ YE+NKDKYG + YNE
Sbjct: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240

Query: 237 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCH 296
           QIVDSMVYRMFREP+CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 297 GSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNST 356
           GSAPDIAGKGISNPIATIRSTALMLEFLG+ E A+DIH+AV+AN++E K  TPDLGG ST
Sbjct: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360

Query: 357 TQQVLEDVLSKL 368
           TQ+V EDVL++L
Sbjct: 361 TQEVTEDVLARL 372

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/369 (78%), Positives = 329/369 (89%), Gaps = 2/369 (0%)

Query: 1   MMRTRFIQLS-RRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDL 59
           M R+   +++ RRAY S  K++ IGLIPGDGIGKEVIPAGK++LE+L  K+GL F FIDL
Sbjct: 1   MFRSSVAKVAARRAY-SAPKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDL 59

Query: 60  QAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFAN 119
           +AGWE FQ  GKALPD+T+ +LK QC+GALFGAVQSPTTKV GYSSPIVALRK LGL+AN
Sbjct: 60  KAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYAN 119

Query: 120 VRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIA 179
           VRPVKSV+   DR VD++IVRENTEDLYIK EK+Y+DEATGTRVA+A KRI+E+AT+ IA
Sbjct: 120 VRPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIA 179

Query: 180 TIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIV 239
           TIAL I+ QRL+  GHATLTVTHKSNVLSQSDGLFRE+C++ YE NKDKYG V+YNEQIV
Sbjct: 180 TIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIV 239

Query: 240 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSA 299
           DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHGSA
Sbjct: 240 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 299

Query: 300 PDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQ 359
           PDIAGKGISNPIATIRSTALMLEFLG+PEPA+DI+KAVDAN+ +G   TPDLGG +TTQQ
Sbjct: 300 PDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQ 359

Query: 360 VLEDVLSKL 368
           V++D+LSK+
Sbjct: 360 VVDDILSKI 368

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/360 (78%), Positives = 319/360 (88%), Gaps = 1/360 (0%)

Query: 10  SRRAYASNAK-NLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQN 68
           +RR   + A+ NLTIGLIPGDGIGKEVIPAGKK+LE++  KY + FKFIDL AGW+TF +
Sbjct: 11  ARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLD 70

Query: 69  TGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDG 128
           TGKALPDET+ ILK QC+GALFGAVQSPTTKVEGYSSPIVALRK LGL+AN+RPVKSV G
Sbjct: 71  TGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG 130

Query: 129 TKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQ 188
           T DR VD+VIVRENTEDLYIK E++YIDEATGT+VA+ATKRI+E+AT+ IA IAL IA Q
Sbjct: 131 TNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQ 190

Query: 189 RLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFR 248
           RL+  G ATLTVTHKSNVLSQSDGLFREVCR+ YE NKD YG V YNEQIVDSMVYR+FR
Sbjct: 191 RLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFR 250

Query: 249 EPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGIS 308
           EPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP+I+IGEPCHGSAPDI+G+GIS
Sbjct: 251 EPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGIS 310

Query: 309 NPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
           NP+ATIRS ALML+FLGY E AKDI  AVD NIR GK  TPDLGG+S+T +V +D+LSKL
Sbjct: 311 NPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTDDILSKL 370

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/369 (76%), Positives = 324/369 (87%), Gaps = 1/369 (0%)

Query: 1   MMRTRFIQLSRRAY-ASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDL 59
           M+RT   Q S  A  AS+ K LTIGLIPGDGIGKEVIPAGK++L++LN K+GL+F+FIDL
Sbjct: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60

Query: 60  QAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFAN 119
           QAG++TF +TG ALP +T+DILKN+C+GALFGAVQSPTTKVEGYSSPIV LRK LGLFAN
Sbjct: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120

Query: 120 VRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIA 179
           VRPVK+V+GT  + +DLVIVRENTEDLYIK+EK+Y D   G+R+A+ATKRITE ATK IA
Sbjct: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180

Query: 180 TIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIV 239
             AL IA QRL+  G ATLTVTHKSNVLSQSDGLFREVC+E YE+NK  Y GV YNEQIV
Sbjct: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240

Query: 240 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSA 299
           DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLG+VPSANVGPNIVIGEPCHGSA
Sbjct: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300

Query: 300 PDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQ 359
           PDIAGKGI+NPIATIRSTA MLE+LGY  PA+DI+KAVDANIR+ K  T DLGG+STTQQ
Sbjct: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360

Query: 360 VLEDVLSKL 368
           V++D+L KL
Sbjct: 361 VIDDILGKL 369

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/368 (74%), Positives = 320/368 (86%), Gaps = 2/368 (0%)

Query: 1   MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ 60
           M+R    QLS R Y + +K+ TIGLIPGDGIGKEVIP G+K+LE + PKYG+ FK+IDLQ
Sbjct: 1   MLRVGRGQLSTRTYVT-SKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQ 59

Query: 61  AGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANV 120
           AGW+TF +TGKALPD+T++ L+N C+GALFGAVQSPTTKV+GYSSPIVALRK LGL+AN+
Sbjct: 60  AGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANI 119

Query: 121 RPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIAT 180
           RPVKSVDGT DR VDLVI RENTEDLYIK E++YID+ TG RVA+A KRI+E AT+NIA 
Sbjct: 120 RPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIAN 179

Query: 181 IALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVD 240
           IAL+IA QRL++ GHATLTVTHKSNVLSQSDGLFRE+C+  Y++NK K+  VQYNEQIVD
Sbjct: 180 IALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVD 238

Query: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAP 300
           SMVYR+F+EP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPS NVGPNIVIGEPCHGSAP
Sbjct: 239 SMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAP 298

Query: 301 DIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQV 360
           DI G+GI+NPIATIRS AL+LEFLG PE A+ I K VD NIRE K  TPDLGGNST +QV
Sbjct: 299 DIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQV 358

Query: 361 LEDVLSKL 368
             D+LS++
Sbjct: 359 ANDILSRI 366

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/353 (76%), Positives = 312/353 (88%)

Query: 16  SNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPD 75
           S   NLTIGLIPGDGIGKEVIP+G+++LE++ PK+GL+F FIDLQAGW+TF +TGKALP 
Sbjct: 19  SKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDTGKALPV 78

Query: 76  ETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDRKVD 135
           ET+  L+  C+GALFGAVQSPTTKVEGYSSPIVALRK LGL+AN+RPVKSVD   ++KVD
Sbjct: 79  ETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPGNKKVD 138

Query: 136 LVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGH 195
           +VIVRENTEDLYIKLEK+YIDE TGTRVADATKRI+E+AT+ IA IAL IA QRL+ NG+
Sbjct: 139 MVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGN 198

Query: 196 ATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDV 255
             LTVTHKSNVLSQSDGLFREVC+E +E+NK  Y  +QYNEQI+DSMVYR+FREPECFDV
Sbjct: 199 VQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFDV 258

Query: 256 VVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIR 315
           +VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHGSAPDIAGKGISNPIATIR
Sbjct: 259 IVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIR 318

Query: 316 STALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
           STALMLEFLG+ + A+DI  AVD+N+RE K  TPDLGG ++T  V+ DV+ +L
Sbjct: 319 STALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/351 (76%), Positives = 315/351 (89%), Gaps = 2/351 (0%)

Query: 19  KNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETI 78
           K+LTIGLIPGDGIGKEVIPAGK++L++L+ ++GL+F FIDL+AG++TF +TGKALPDET+
Sbjct: 22  KSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETV 81

Query: 79  DILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDRK-VDLV 137
            +LK QC+G LFGAVQSPTT+V+ YSSPIVALRK L L+AN+RPVKSV G    K VD+V
Sbjct: 82  KVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSGKPVDMV 141

Query: 138 IVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHAT 197
           IVRENTEDLYIK+EKSY D+  G RVA+ATKRITE+AT+ IA IAL +A QRL+ NG AT
Sbjct: 142 IVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKAT 200

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDVVV 257
           LTVTHKSNVLSQSDGLFRE+C++ Y+ANKDKY G+ YNEQI+DSMVYRMFREPE FDV+V
Sbjct: 201 LTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFDVIV 260

Query: 258 APNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRST 317
           APNLYGDILSDGAAALVGSLGVVPSANVGP+IV+GEPCHGSAPDIAGKGI+NPIATIRST
Sbjct: 261 APNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320

Query: 318 ALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
           ALMLEFLG+ E A+DIHKAV++N+RE K  TPDLGGNS+TQ V++DVL KL
Sbjct: 321 ALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEKL 371

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 304/368 (82%), Gaps = 1/368 (0%)

Query: 1   MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ 60
           M R+    L  +A  + +K LTIGLIPGDGIGKEVIPAG+++LE++  K+ + F +  L 
Sbjct: 1   MHRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLD 60

Query: 61  AGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANV 120
           AGW+TF  TG ALP  T++ L+ +C+GALFGAVQSPTTKVEGYSSPIVALR+ LGL+AN+
Sbjct: 61  AGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANI 120

Query: 121 RPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIAT 180
           RPVKSV GT  + VDLVIVRENTEDLY++ E++Y+D ATG RVA+A KRI+E AT+ IA 
Sbjct: 121 RPVKSVSGT-GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAE 179

Query: 181 IALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVD 240
           I+L++A QR    G   LTVTHKSNVLSQ+DGLF+EVCRE YEANK  YG ++YNEQIVD
Sbjct: 180 ISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVD 239

Query: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAP 300
           SMVYR+F+EP CFDVVVAPNLYGD+LSDGAAALVGSLG+VPS NVG NI+IGEPCHGSAP
Sbjct: 240 SMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAP 299

Query: 301 DIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQV 360
           DIAG+GI+NPIATIRS +LML+FLG  E A DI +AV  N+++ + ++PDLGG +TTQ+V
Sbjct: 300 DIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEV 359

Query: 361 LEDVLSKL 368
           L+D+L+++
Sbjct: 360 LDDILARI 367

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  189 bits (479), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 136/380 (35%), Positives = 197/380 (51%), Gaps = 33/380 (8%)

Query: 1   MMRTRFIQLSRRAYASNAKNL---------TIGLIPGDGIGKEVIPAGKKILESLNPKYG 51
           M+R  F+Q+S+R +A  +  L         T+ LIPGDG+GKEV  +   I E+ N    
Sbjct: 1   MLRNTFVQISKRRFALASGQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVNIFEAENVP-- 58

Query: 52  LSFKFIDLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALR 111
           + ++ ++L    E  +   KA     ++ LK    G L G   +P  +  G+ S  VA R
Sbjct: 59  IDWESVELSGLEENMEGVQKA-----VESLKRNKVG-LKGIWSTPADQT-GHGSLNVAFR 111

Query: 112 KNLGLFANVRPVKSVDG--TKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKR 169
           K L +FANV   KS  G  TK + VDLVI+RENTE  Y  LE   +       V ++ K 
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEYSGLEHESV-----PGVVESLKI 166

Query: 170 ITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKY 229
           +T+  ++ IA  A   A +    N   ++   HK+N++   DGLFR    E       +Y
Sbjct: 167 MTKAKSERIARFAFDFALK----NNRRSVCAVHKANIMKLGDGLFRNTVNEI---GAKEY 219

Query: 230 GGVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNI 289
             ++    IVD+   +   +P  FDV+V PNLYG IL +  AAL+GS G+VP AN G   
Sbjct: 220 PELEVKSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNVGAALIGSPGLVPGANFGREY 279

Query: 290 VIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLT 348
            + EP       DI G+ ++NP A I S+ LML  LG  + A  I KA    I EGK+ T
Sbjct: 280 AVFEPGSRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEGKHTT 339

Query: 349 PDLGGNSTTQQVLEDVLSKL 368
            D+GG+++T Q  + ++ KL
Sbjct: 340 KDIGGHASTTQFTKAIVDKL 359

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  189 bits (479), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 141/380 (37%), Positives = 194/380 (51%), Gaps = 33/380 (8%)

Query: 1   MMRTRFIQLSRRAYASNAKNL---------TIGLIPGDGIGKEVIPAGKKILESLNPKYG 51
           M R     +++R YA+  + L         T+ LIPGDGIGKEV  +  +I E+ N    
Sbjct: 1   MFRNTLSHITKRGYAAGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFEAENVP-- 58

Query: 52  LSFKFIDLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALR 111
           + ++ ++L A  E  +   KA     ++ LK    G L G   +P  +  G+ S  VA R
Sbjct: 59  VDWESVELSALEENHEGVQKA-----VESLKRNKVG-LKGIWHTPADQT-GHGSLNVAFR 111

Query: 112 KNLGLFANVRPVKSVDG--TKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKR 169
           K L +FANV   KS  G  TK + VDLVI+RENTE  Y  LE   +       V ++ K 
Sbjct: 112 KQLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESV-----PGVVESLKI 166

Query: 170 ITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKY 229
           +T+  ++ IA  A   A   L+ N  A   V HK+N++   DGLFR    E       +Y
Sbjct: 167 MTKAKSERIARFAFDFA---LKNNRKAVCAV-HKANIMKLGDGLFRNTVSEI---GAKEY 219

Query: 230 GGVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNI 289
             V  +  IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN G   
Sbjct: 220 PEVNVSSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREY 279

Query: 290 VIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLT 348
            + EP C     DI G+ ++NP A I S+ LML  LG  E A  I +A    I EGK  T
Sbjct: 280 AVFEPGCRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEGKRTT 339

Query: 349 PDLGGNSTTQQVLEDVLSKL 368
            D+GG +TT +    V+ KL
Sbjct: 340 KDIGGTATTTEFTNAVIDKL 359

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  186 bits (472), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 139/391 (35%), Positives = 199/391 (50%), Gaps = 45/391 (11%)

Query: 1   MMRTRFIQLSRRAYASNAKNLTIG----------------LIPGDGIGKEVIPAGKKILE 44
           M+R  F++ + R + S  K  +IG                 I GDGIG E+  + KKI  
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 45  SLNPKYGLSFKFIDLQAGWETFQNTGKALPDETI-DILKNQCEGALFGAVQSPTTKVEGY 103
           + +    ++++F D+      F N    +PD  +  I KN    AL G + +P  K  G+
Sbjct: 61  AAD--VPINWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GH 111

Query: 104 SSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVIVRENTEDLYIKLEKSYIDEATGT 161
            S  + LRK  GLFANVRP KS++G K     VDLV++RENTE  Y     S I+     
Sbjct: 112 RSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCP 166

Query: 162 RVADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRET 221
            V  + K IT  A++ +   A + A+      G   + V HKS +   +DGLF  V +E 
Sbjct: 167 GVVQSIKLITREASERVIRYAFEYARAI----GRPRIIVVHKSTIQRLADGLFVNVAKEL 222

Query: 222 YEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLG 278
            +    +Y  + +  +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG
Sbjct: 223 SK----EYPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLG 278

Query: 279 VVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVD 338
           + PSAN+G  + I E  HGSAPDIAGK  +NP A + S+ +ML  +G    A  I  AV 
Sbjct: 279 LTPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVL 338

Query: 339 ANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
           + I  G +  T DL G +TT    E V+ +L
Sbjct: 339 STIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  185 bits (470), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 138/378 (36%), Positives = 190/378 (50%), Gaps = 42/378 (11%)

Query: 9   LSRRAYASNAKN-----------LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFI 57
           +S+R+ AS  KN            T+ LIPGDGIGKEV  +  KI  S            
Sbjct: 6   VSKRSIASFTKNHNIVPKKYGGRYTVTLIPGDGIGKEVTDSVVKIFASQG---------- 55

Query: 58  DLQAGWETFQNTGKALPDET---IDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNL 114
            L   WE     G +  +E    ++ LK    G     +   +    GY S  VALRK L
Sbjct: 56  -LPIDWERIDVPGMSNENEVKKAVESLKRNKIG--LKGIWHTSADQTGYGSLNVALRKQL 112

Query: 115 GLFANVRPVKSVDGTKDR--KVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITE 172
            +FANV   KS+ G K +   VDLV++RENTE  Y  LE   +       V ++ K IT+
Sbjct: 113 DIFANVAIFKSLKGVKTKIPDVDLVVIRENTEGEYSGLEHESV-----PGVVESLKIITK 167

Query: 173 IATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGV 232
             T+ IA  A   A +    N  +T+T  HK+N++  SDGLF+    E  E    +Y  +
Sbjct: 168 PKTERIARFAFDFALE----NNRSTVTAVHKANIMKLSDGLFKNTVAEVGE---KEYPDI 220

Query: 233 QYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIG 292
           + N  IVD+   +   +P  FDV+V P++YG IL +  AAL+G  G++P AN G    + 
Sbjct: 221 KVNTIIVDNASMQAVAKPHQFDVMVTPSMYGTILGNIGAALIGGPGLIPGANYGREHAVF 280

Query: 293 EP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDL 351
           EP       DI  + I+NP A I S  LML  LG  E +K I  AV A I EGK  T D+
Sbjct: 281 EPGSRHVGLDIENQNIANPTAMILSATLMLNQLGLREESKRISNAVYAVIEEGKTTTKDI 340

Query: 352 GGNSTTQQVLEDVLSKLD 369
           GGN++T +  + V+ KL+
Sbjct: 341 GGNASTTEFTDAVIDKLN 358

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  185 bits (470), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 133/360 (36%), Positives = 186/360 (51%), Gaps = 39/360 (10%)

Query: 21  LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWET------FQNTGKALP 74
            T+  I GDGIG E+  + K+I           F+  D+   WET      F N    +P
Sbjct: 36  FTVSFIEGDGIGPEISSSVKRI-----------FQAADVPVEWETCDVTPIFVNGLTTIP 84

Query: 75  DETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--R 132
           D  +  + N+   AL G + +P  K  G+ S  + LRK   LFANVRP KS++G K    
Sbjct: 85  DPAVQSI-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYE 141

Query: 133 KVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQ 192
            VDLV++RENTE  Y     S I+      V  + K IT  A++ +   A + A+     
Sbjct: 142 NVDLVLIRENTEGEY-----SGIEHLVSPGVVQSIKLITRDASERVIRYAYEYARAI--- 193

Query: 193 NGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPEC 252
            G   L V HKS +   +DGLF  V +E       +Y  +Q   +++D+    +   P  
Sbjct: 194 -GRPRLIVVHKSTIQRLADGLFVNVAKEL----AAEYPDIQLETELIDNTCLNVVSNPSS 248

Query: 253 FD--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISN 309
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +N
Sbjct: 249 YTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKAN 308

Query: 310 PIATIRSTALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
           P A + S+ +ML  +G  E A  I KAV   I  G +Y T DLGG+++T    + ++ KL
Sbjct: 309 PTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTDAIIKKL 368

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  184 bits (466), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 140/391 (35%), Positives = 196/391 (50%), Gaps = 45/391 (11%)

Query: 1   MMRTRFIQLSRRAYASNAKNLTIG----------------LIPGDGIGKEVIPAGKKILE 44
           M+R  F + + R + +  K  +IG                 I GDGIG E+  + KKI  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 45  SLNPKYGLSFKFIDLQAGWETFQNTGKALPDETI-DILKNQCEGALFGAVQSPTTKVEGY 103
           + N    + ++F D+      F N    +PD  +  I KN    AL G + +P  K  G+
Sbjct: 61  AAN--VPIEWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GH 111

Query: 104 SSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVIVRENTEDLYIKLEKSYIDEATGT 161
            S  + LRK  GLFANVRP KSV+G K     VDLV++RENTE  Y     S I+     
Sbjct: 112 RSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCP 166

Query: 162 RVADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRET 221
            V  + K IT  A++ +   A + A+      G   + V HKS +   +DGLF  V +E 
Sbjct: 167 GVVQSIKLITRDASERVIRYAFEYARAI----GRPRVIVVHKSTIQRLADGLFVNVAKEL 222

Query: 222 YEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLG 278
                 +Y  +    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLG
Sbjct: 223 ----SKEYPDITLETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLG 278

Query: 279 VVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVD 338
           + PSAN+G  I I E  HGSAPDIAG+  +NP A + S+ +ML  +G    A  I  AV 
Sbjct: 279 LTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVL 338

Query: 339 ANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
           + I  G +  T DL G +TT    E V+ +L
Sbjct: 339 STIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  183 bits (465), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 139/396 (35%), Positives = 199/396 (50%), Gaps = 55/396 (13%)

Query: 1   MMRTRFI-QLSRRAYASNAK---------------NLTIGLIPGDGIGKEVIPAGKKILE 44
           M+R++ + QL RR  +S  +                 T+  I GDG+G E+  + K I  
Sbjct: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDI-- 58

Query: 45  SLNPKYGLSFKFIDLQAGWET------FQNTGKALPDETIDILKNQCEGALFGAVQSPTT 98
                    F   ++   WE+      F N    +P   +D + N+   AL G + +P  
Sbjct: 59  ---------FAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSI-NKNLIALKGPLATPIG 108

Query: 99  KVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVIVRENTEDLYIKLEKSYID 156
           K  G+ S  + LRK  GLFANVRP KSV+G K     VDLV++RENTE  Y     S I+
Sbjct: 109 K--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIE 161

Query: 157 EATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFRE 216
                 V  + K IT  A++ +   A + A+      G   + V HKS +   +DGLF +
Sbjct: 162 HVVSPGVVQSIKLITRDASERVIRYAFEYARAV----GRPKVMVVHKSTIQRLADGLFVD 217

Query: 217 VCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECF--DVVVAPNLYGDILSDGAAAL- 273
           V +E       +Y  +Q   Q++D+ V  +   P  +   V V PNLYGDILSD  + L 
Sbjct: 218 VAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLS 273

Query: 274 VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDI 333
            GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  E A  I
Sbjct: 274 AGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSI 333

Query: 334 HKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
            KAV + I  G +  T DL G+++T    E V+ +L
Sbjct: 334 EKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  183 bits (465), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 130/354 (36%), Positives = 192/354 (54%), Gaps = 29/354 (8%)

Query: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETI-DI 80
           T+  I GDG+G E+  + K I  +   K  + ++  D+      F N    +PD  +  I
Sbjct: 37  TVSFIEGDGVGPEISKSVKAIFSA--AKVPIEWESCDVSP---IFVNGLTTIPDPAVASI 91

Query: 81  LKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVI 138
            KN    AL G + +P  K  G+ S  + LRK  GLFANVRP KS++G K     V+LV+
Sbjct: 92  NKNLI--ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVL 147

Query: 139 VRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATL 198
           +RENTE  Y     S I+      V  + K IT+ A++ +   A + A+        + +
Sbjct: 148 IRENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAV----DRSKV 198

Query: 199 TVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VV 256
            V HKS +   +DGLF +V ++       +Y  ++   +++D+ V +  + PE +D  VV
Sbjct: 199 LVVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVV 254

Query: 257 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIR 315
           V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + 
Sbjct: 255 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLL 314

Query: 316 STALMLEFLGYPEPAKDIHKAVDANI-REGKYLTPDLGGNSTTQQVLEDVLSKL 368
           S+ +ML  +G  E A  I KAV   I  + K  T DLGG+++T    + V+ +L
Sbjct: 315 SSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  182 bits (462), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 187/353 (52%), Gaps = 27/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETIDIL 81
           T+  I GDGIG E+  + K I  +   K  + +++ D+      F N    +PD  +  +
Sbjct: 39  TVSFIEGDGIGPEISQSVKDIFSA--AKVPVEWEYCDVTP---IFINGLTTIPDPAVQSI 93

Query: 82  KNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVIV 139
            N+   AL G + +P  K  G+ S  + LRK  GLFANVRP KS++G K     VDLV++
Sbjct: 94  -NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 150

Query: 140 RENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLT 199
           RENTE  Y     S I+      V  + K IT  A++ +   A + A+      G   + 
Sbjct: 151 RENTEGEY-----SGIEHVVSPGVVQSIKLITRDASERVIRYAFEYARAV----GRPKVV 201

Query: 200 VTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VVV 257
           V HKS +   +DGLF  V +E       +Y  ++   +++D+ V  +  +PE +   V V
Sbjct: 202 VVHKSTIQRLADGLFVNVAQEV----GKEYPDIELQPELIDNTVLNVVSKPEKYSDSVAV 257

Query: 258 APNLYGDILSDGAAAL-VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRS 316
            PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + S
Sbjct: 258 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLLS 317

Query: 317 TALMLEFLGYPEPAKDIHKAVDANI-REGKYLTPDLGGNSTTQQVLEDVLSKL 368
           + +ML  +G  E A  I  AV A +  + K  T DL G +TT    + V+ +L
Sbjct: 318 SVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  181 bits (460), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 138/389 (35%), Positives = 201/389 (51%), Gaps = 42/389 (10%)

Query: 1   MMRTRFIQLSRRAYASNAK---------------NLTIGLIPGDGIGKEVIPAGKKILES 45
           M ++ F++ S R  A+  +                 T+  I GDG+G E+  A K I  +
Sbjct: 1   MFKSSFVRNSARFLATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60

Query: 46  LNPKYGLSFKFIDLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSS 105
              K  + ++  D+      F N    +P    D + N+   AL G + +P  K  G+ S
Sbjct: 61  A--KAPIQWESCDVSP---LFINGLTTIPQPAQDSI-NKNLIALKGPLATPIGK--GHRS 112

Query: 106 PIVALRKNLGLFANVRPVKSVDGTKDR--KVDLVIVRENTEDLYIKLEKSYIDEATGTRV 163
             + LRK  GLFANVRP KSV G K     VDLV++RENTE  Y     S I+      V
Sbjct: 113 LNLTLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLIRENTEGEY-----SGIEHVVSPGV 167

Query: 164 ADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYE 223
             + K IT+ A++ +   A + A+  +E+     + V HKS +   +DGLF  V  +  +
Sbjct: 168 VQSIKLITQDASERVIRYAFEYARA-VER---PKVVVVHKSTIQRLADGLFVSVAEQLSK 223

Query: 224 ANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSLGVV 280
               +Y  ++   +++D+ V    R+P  +   VVV PNLYGDILSD  + L  GSLG+ 
Sbjct: 224 ----EYPDIELQTELIDNTVLHTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLT 279

Query: 281 PSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDAN 340
           PSAN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  E A  I KAV   
Sbjct: 280 PSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTT 339

Query: 341 IREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
           I  G +  T DLGG+++T    E V+S+L
Sbjct: 340 IAAGPESRTGDLGGSASTSSFAEAVISRL 368

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  180 bits (457), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 139/397 (35%), Positives = 195/397 (49%), Gaps = 57/397 (14%)

Query: 1   MMRTRFIQLSRRAYASNAKNLTIG----------------LIPGDGIGKEVIPAGKKILE 44
           M+R  F + + R + +  K  +IG                 I GDGIG E+  + KKI  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 45  SLNPKYGLSFKFIDLQAGWET------FQNTGKALPDETI-DILKNQCEGALFGAVQSPT 97
           + N           +   WE+      F N    +PD  +  I KN    AL G + +P 
Sbjct: 61  AAN-----------VPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLV--ALKGPLATPI 107

Query: 98  TKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVIVRENTEDLYIKLEKSYI 155
            K  G+ S  + LRK  GLFANVRP KS++G K     VDLV++RENTE  Y     S I
Sbjct: 108 GK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGI 160

Query: 156 DEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFR 215
           +      V  + K IT  A++ +   A + A+      G   + V HKS +   +DGLF 
Sbjct: 161 EHIVCPGVVQSIKLITRDASERVIRYAFEYARAI----GRPRVIVVHKSTIQRLADGLFV 216

Query: 216 EVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL 273
            V +E  +    +Y  +    +++D+ V ++   P  +   V V PNLYGDILSD  + L
Sbjct: 217 NVAKELSK----EYPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGL 272

Query: 274 -VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKD 332
             GSLG+ PSAN+G  I I E  HGSAPDIAG+  +NP A + S+ +ML  +G    A  
Sbjct: 273 SAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQ 332

Query: 333 IHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
           I  AV + I  G +  T DL G +TT    E V+ +L
Sbjct: 333 IQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  179 bits (455), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 132/359 (36%), Positives = 183/359 (50%), Gaps = 39/359 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWET------FQNTGKALPD 75
           T+  I GDGIG E+  + KKI  + N           +   WE+      F N    +PD
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFNAAN-----------VPIEWESCDVNPIFVNGLTTIPD 86

Query: 76  ETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RK 133
             +  + N    AL G + +P  K  G+ S  + LRK  GLFANVRP KSV+G K     
Sbjct: 87  AAVQSITNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYEN 143

Query: 134 VDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQN 193
           VDLV++RENTE  Y     S I+      V  + K IT  A++ +   A + A+      
Sbjct: 144 VDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVIRYAFEYARAI---- 194

Query: 194 GHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECF 253
           G   + V HKS +   +DGLF  V +E  +    +Y  +    +++D+ V ++   P  +
Sbjct: 195 GRPRVIVVHKSTIQRLADGLFVNVAKELSK----EYPDIILETELIDNSVLKVVTNPSAY 250

Query: 254 D--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNP 310
              V V PNLYGDILSD  + L  GSLG+ PSAN+G  I I E  HGSAPDIAG+  +NP
Sbjct: 251 TNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANP 310

Query: 311 IATIRSTALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
            A + S+ +ML  +G    A  I  AV + I  G +  T DL G +TT    E V+ +L
Sbjct: 311 TALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  179 bits (453), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 184/354 (51%), Gaps = 31/354 (8%)

Query: 21  LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETF---QNTGKALPDET 77
            T+ LIPGDG+GKE+  + + I E+ N           +   WET    Q   K    E 
Sbjct: 29  FTVTLIPGDGVGKEITDSVRTIFEAEN-----------IPIDWETINIKQTDHKEGVYEA 77

Query: 78  IDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--KVD 135
           ++ LK    G L G   +P  +  G+ S  VALRK L ++ANV   KS+ G K R   +D
Sbjct: 78  VESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDID 135

Query: 136 LVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGH 195
           L+++RENTE  +  LE   +       V ++ K +T   T+ IA  A   A++       
Sbjct: 136 LIVIRENTEGEFSGLEHESVPG-----VVESLKVMTRPKTERIARFAFDFAKKY----NR 186

Query: 196 ATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDV 255
            ++T  HK+N++   DGLFR +  E     + +Y  +  +  IVD+   +   +P  FDV
Sbjct: 187 KSVTAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSIIVDNASMQAVAKPHQFDV 243

Query: 256 VVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEP-CHGSAPDIAGKGISNPIATI 314
           +V P++YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ ++NP A I
Sbjct: 244 LVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMI 303

Query: 315 RSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
            S+ LML  LG  E A  I KAV   I EGK+ T D+GG+S+T     ++++KL
Sbjct: 304 LSSTLMLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 357

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  179 bits (453), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 138/391 (35%), Positives = 199/391 (50%), Gaps = 47/391 (12%)

Query: 1   MMRTRFIQLSRRAYAS--------------NAKNLTIGLIPGDGIGKEVIPAGKKILESL 46
           M+R +  Q SRR  AS               A   T+  I GDG+G E+  + K I  + 
Sbjct: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60

Query: 47  NPKYGLSFKFIDLQAGWETFQNTGKALPDETI-DILKNQCEGALFGAVQSPTTKVEGYSS 105
           +    + +++ D+        N    +P+  +  I KN    AL G + +P  K  G+ S
Sbjct: 61  S--VPVEWEYCDVTP---LLVNGLTTIPEPAVASINKNLV--ALKGPLATPIGK--GHRS 111

Query: 106 PIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVIVRENTEDLYIKLEKSYIDEATGTRV 163
             + LRK  GLFANVRP KS++G K     VDLV++RENTE  Y     S I+      V
Sbjct: 112 LNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEY-----SGIEHVVSPGV 166

Query: 164 ADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYE 223
             + K IT  A++ +   A + A+      G   + V HKS +   +DGLF  V +E   
Sbjct: 167 VQSIKLITREASERVIRYAFEYARTV----GRPKVVVVHKSTIQRLADGLFVNVAQEL-- 220

Query: 224 ANKDKYGGVQYNEQIVDSMVYRMFREPECFDVVVA--PNLYGDILSDGAAAL-VGSLGVV 280
               +Y  ++   +++D+ V  +  +PE +  VVA  PNLYGDILSD  + L  GSLG+ 
Sbjct: 221 --GREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLT 278

Query: 281 PSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDAN 340
           PSAN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  E A  I KAV + 
Sbjct: 279 PSANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLST 338

Query: 341 I---REGKYLTPDLGGNSTTQQVLEDVLSKL 368
           I   RE +  T DL G ++T      V+ +L
Sbjct: 339 IASSRENR--TADLAGTASTSSFTNAVIERL 367

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  178 bits (452), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 139/395 (35%), Positives = 198/395 (50%), Gaps = 54/395 (13%)

Query: 1   MMRTRFIQLSRRAYASNAK---------------NLTIGLIPGDGIGKEVIPAGKKILES 45
           M R++F + + R +A+  +                 T+  I GDG+G E+  A K I   
Sbjct: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDI--- 57

Query: 46  LNPKYGLSFKFIDLQAGWET------FQNTGKALPDETIDILKNQCEGALFGAVQSPTTK 99
                   F        WET      F N    +P    D + N+   AL G + +P  K
Sbjct: 58  --------FAAAKAPIQWETCDVTPLFINGLTTIPQPAQDSI-NKNLIALKGPLATPIGK 108

Query: 100 VEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--KVDLVIVRENTEDLYIKLEKSYIDE 157
             G+ S  + LRK  GLFANVRP KS+ G K     VDLV++RENTE  Y     S I+ 
Sbjct: 109 --GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEY-----SGIEH 161

Query: 158 ATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREV 217
                V  + K IT+ A++ +   A + A+  +E+     + V HKS +   +DGLF  V
Sbjct: 162 VVAPGVVQSIKLITQDASERVIRYAFEYARA-VER---PKVLVVHKSTIQRLADGLFVSV 217

Query: 218 CRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-V 274
                E    +Y  ++   +++D+ V    R+P  +   VVV PNLYGDILSD  + L  
Sbjct: 218 A----EKLAKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSA 273

Query: 275 GSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIH 334
           GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  E A  I 
Sbjct: 274 GSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIE 333

Query: 335 KAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
           KAV + I  G +  T DL G+++T    E V+S+L
Sbjct: 334 KAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  178 bits (452), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 126/354 (35%), Positives = 184/354 (51%), Gaps = 27/354 (7%)

Query: 21  LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETIDI 80
            T+  I GDG+G E+  + KKI  +      +  +++    G   F N    +P+  +++
Sbjct: 36  FTVPFIEGDGVGPEISESVKKIFSAAK----VPIEWVPCDVG-PIFVNGQTTIPEPAVEL 90

Query: 81  LKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVI 138
           + N+   AL G + +P  K  G+ S  + LRK   LFANVRP +S+   K     VDLV+
Sbjct: 91  I-NKHLIALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSIPNYKSTYENVDLVL 147

Query: 139 VRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATL 198
           +RENTE  Y     S I+      V  + K IT  AT+ +   A +  Q      G   L
Sbjct: 148 IRENTEGEY-----SGIEHVITPGVIQSIKLITREATERVVRYAFEYTQAI----GRPRL 198

Query: 199 TVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VV 256
            V HKS +   +DGLF +V  E       +Y  ++   +I+D  +  +  +PE +   V 
Sbjct: 199 LVIHKSTIQRMADGLFVKVAEEL----ASEYPDIKLETEIIDKSILNVVSKPELYSDAVS 254

Query: 257 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIR 315
           V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + 
Sbjct: 255 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLL 314

Query: 316 STALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
           S+ +ML+ +G  E A  I  AV   I  G +  T DL G ++T    E+V+ +L
Sbjct: 315 SSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  177 bits (450), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 128/350 (36%), Positives = 182/350 (52%), Gaps = 25/350 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETIDIL 81
           T+ LIPGDG+GKEV  +  KI E  N    + ++ ID+ +G E  +N  +A     ++ L
Sbjct: 31  TVTLIPGDGVGKEVTDSVVKIFE--NENIPIDWETIDI-SGLENTENVQRA-----VESL 82

Query: 82  KNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--KVDLVIV 139
           K    G L G   +P  +  G+ S  VALRK L +FANV   KS+ G K R   +D+VI+
Sbjct: 83  KRNKVG-LKGIWHTPADQT-GHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVII 140

Query: 140 RENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLT 199
           RENTE  Y  LE   +       V ++ K +T   ++ IA  A   A +    N   ++ 
Sbjct: 141 RENTEGEYSGLEHESV-----PGVVESLKIMTRAKSERIARFAFDFALK----NNRKSVC 191

Query: 200 VTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDVVVAP 259
             HK+N++   DGLFR    E      ++Y  +     IVD+   +   +P  FDV+V P
Sbjct: 192 AVHKANIMKLGDGLFRNTVNEI---GANEYPELDVKNIIVDNASMQAVAKPHQFDVLVTP 248

Query: 260 NLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEP-CHGSAPDIAGKGISNPIATIRSTA 318
           NLYG IL +  +AL+G  G+VP AN G    + EP       DI G+ ++NP A I S+ 
Sbjct: 249 NLYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSST 308

Query: 319 LMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
           LML  LG    A  I KA    I EGK  T D+GG+++T +    V+ KL
Sbjct: 309 LMLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEFTNAVIEKL 358

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  177 bits (449), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 183/354 (51%), Gaps = 31/354 (8%)

Query: 21  LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETF---QNTGKALPDET 77
            T+ LIPGDG+GKE+  + + I E+             +   WET    Q   K    E 
Sbjct: 29  FTVTLIPGDGVGKEITDSVRTIFEAER-----------IPVDWETINIKQTDHKEGVYEA 77

Query: 78  IDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--KVD 135
           ++ LK    G L G   +P  +  G+ S  VALRK L ++ANV   KS+ G K R   +D
Sbjct: 78  VESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDID 135

Query: 136 LVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGH 195
           L+++RENTE  +  LE   +       V ++ K +T+  T+ IA  A   A++       
Sbjct: 136 LIVIRENTEGEFSGLEHESVPG-----VVESLKVMTKPKTERIARFAFDFAKKY----NR 186

Query: 196 ATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDV 255
             +T  HK+N++   DGLFR +  E     + +Y  +  +  IVD+   +   +P  FDV
Sbjct: 187 KAVTAVHKANIMKLGDGLFRNIITEI---GQTEYPDIDVSSIIVDNASMQAVAKPHQFDV 243

Query: 256 VVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEP-CHGSAPDIAGKGISNPIATI 314
           +V P++YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ ++NP A I
Sbjct: 244 LVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMI 303

Query: 315 RSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
            S+ LML  LG  E A  I KAV   I EGK+ T D+GG+S+T     +V++KL
Sbjct: 304 LSSVLMLNHLGLNENATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEVINKL 357

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  179 bits (454), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 131/359 (36%), Positives = 183/359 (50%), Gaps = 39/359 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWET------FQNTGKALPD 75
           T+  I GDGIG E+  + K+I           F    +   WET      F +    +P+
Sbjct: 91  TVSFIEGDGIGPEISNSVKQI-----------FSAAKVPIEWETCDVTPLFIDGLTTIPE 139

Query: 76  ETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--K 133
             +  + N+   AL G + +P  K  G+ S  + LRK  GLFANVRP +SV G K     
Sbjct: 140 PAVQSI-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPN 196

Query: 134 VDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQN 193
           VDLV++RENTE  Y     S I+      V  + K IT  A++ +   A +  +      
Sbjct: 197 VDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITREASERVIRYAFEYCRAI---- 247

Query: 194 GHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECF 253
           G   L V HKS +   SDGLF  V +E       +Y  +Q+  +++D+ V ++   P  +
Sbjct: 248 GRPRLVVVHKSTIQRLSDGLFVNVAKEL----SKEYPDIQFETELIDNTVLKVVSNPSSY 303

Query: 254 D--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNP 310
              V V PNLYGDILSD  + L  GSLG+ PS N+G  I I E  HGSAPDIAGK ++NP
Sbjct: 304 TDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAPDIAGKNMANP 363

Query: 311 IATIRSTALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
            A + S+ +ML  +G  + A  I  AV + I  G +  T DL G +TT    + V+ KL
Sbjct: 364 TALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  177 bits (449), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 182/354 (51%), Gaps = 31/354 (8%)

Query: 21  LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETF---QNTGKALPDET 77
            T+ LIPGDG+GKE+  + K I E+             +   WET    Q   K    E 
Sbjct: 29  FTVTLIPGDGVGKEITDSVKTIFEAEK-----------IPVDWETVNIKQTDHKEGVYEA 77

Query: 78  IDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--KVD 135
           ++ LK    G L G   +P  +  G+ S  VALRK L ++ANV   KS+ G K R   +D
Sbjct: 78  VESLKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDID 135

Query: 136 LVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGH 195
           L+++RENTE  +  LE   +       V ++ K +T   T+ IA  A   A++       
Sbjct: 136 LIVIRENTEGEFSGLEHESVPG-----VVESLKIMTRPKTERIARFAFDFAKKY----NR 186

Query: 196 ATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDV 255
             +T  HK+N++   DGLFR +  E     + +Y  +  +  IVD+   +   +P  FDV
Sbjct: 187 KAVTAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSIIVDNASMQAVAKPHQFDV 243

Query: 256 VVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEP-CHGSAPDIAGKGISNPIATI 314
           +V P++YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ ++NP A I
Sbjct: 244 LVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMI 303

Query: 315 RSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
            S+ LML  LG  E A  I KAV   I EGK+ T D+GG+S+T     ++++KL
Sbjct: 304 LSSVLMLNHLGLNEYATRISKAVHETIAEGKHTTKDIGGSSSTTDFTNEIINKL 357

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  177 bits (449), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 136/385 (35%), Positives = 192/385 (49%), Gaps = 45/385 (11%)

Query: 1   MMRTRFIQLSRRAYASNAKNL---------TIGLIPGDGIGKEVIPAGKKILESLNPKYG 51
           M+R  F  +S+R+ A+ A+ L         T+ LIPGDG+GKEV  +   I ES N    
Sbjct: 1   MLRNGF-GISKRSLATVAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESEN---- 55

Query: 52  LSFKFIDLQAGWETFQNTGKALPDE-----TIDILKNQCEGALFGAVQSPTTKVEGYSSP 106
                  +   WET + +G  L +E      +D LK    G L G   +P+ +  G+ S 
Sbjct: 56  -------VPIDWETVEISG--LDNEEGVQKAVDSLKRNKVG-LKGIWHTPSDQT-GHGSL 104

Query: 107 IVALRKNLGLFANVRPVKSVDGTKDRK--VDLVIVRENTEDLYIKLEKSYIDEATGTRVA 164
            VALRK L +FANV   K+V G   R   VDLV++RENTE  Y  LE   +       V 
Sbjct: 105 NVALRKQLDIFANVALFKTVPGVPSRHSNVDLVVIRENTEGEYSGLEHESV-----PGVV 159

Query: 165 DATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEA 224
           ++ K +T+  +  I   A   A +    N   ++   HK+N++   DGLFR    E    
Sbjct: 160 ESLKIMTKAKSDRIGRFAFDFALK----NNRKSVCAVHKANIMKLGDGLFRNCINEI--- 212

Query: 225 NKDKYGGVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSAN 284
              +Y  ++    IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN
Sbjct: 213 GAKEYPEIEVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGAN 272

Query: 285 VGPNIVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIRE 343
            G    + EP       DI G+ ++NP A I S+ALML  LG    A  I KA    I E
Sbjct: 273 FGREFAVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHLGLNSYADRISKATYDVIAE 332

Query: 344 GKYLTPDLGGNSTTQQVLEDVLSKL 368
            K  T D+GG+++T    + ++ KL
Sbjct: 333 AKNTTKDIGGSASTTDFTQAIIEKL 357

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  176 bits (447), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 135/384 (35%), Positives = 189/384 (49%), Gaps = 42/384 (10%)

Query: 1   MMRTRFIQLSRRAYASNAKN----------LTIGLIPGDGIGKEVIPAGKKILESLNPKY 50
           M R  F  +S+R+ A+ A             T+ LIPGDG+GKEV  +   I E+ N   
Sbjct: 1   MFRNTF-AVSKRSLATVATEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFEAEN--- 56

Query: 51  GLSFKFIDLQAGWETFQNTGKALPD---ETIDILKNQCEGALFGAVQSPTTKVEGYSSPI 107
                   +   WET   TG    +   + ++ LK    G L G   +P  +  G+ S  
Sbjct: 57  --------VPIDWETINITGVDSEEGVQKAVESLKRNKIG-LKGIWHTPADQT-GHGSLN 106

Query: 108 VALRKNLGLFANVRPVKSVDGTKDR--KVDLVIVRENTEDLYIKLEKSYIDEATGTRVAD 165
           VA RK L +FANV   K+V G K +   +DLV++RENTE  Y  LE   +       V +
Sbjct: 107 VAFRKQLDIFANVALFKNVPGVKTKLSNIDLVVIRENTEGEYSGLEHESV-----PGVVE 161

Query: 166 ATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEAN 225
           + K IT+  ++ IA  A   A +    N   ++   HK+N++   DGLFR    E     
Sbjct: 162 SLKIITKAKSERIARFAFDFALK----NNRKSVCAVHKANIMKLGDGLFRNTVNEV---G 214

Query: 226 KDKYGGVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANV 285
             +Y  +     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP AN 
Sbjct: 215 ASEYPEIDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANF 274

Query: 286 GPNIVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREG 344
           G    + EP       DI GK ++NP A I S+ LML  LG    A  I KA    I EG
Sbjct: 275 GREYAVFEPGSRHVGLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIAEG 334

Query: 345 KYLTPDLGGNSTTQQVLEDVLSKL 368
           K+ T D+GG+S+T +  + V+ KL
Sbjct: 335 KHTTKDIGGSSSTTEFTKSVIDKL 358

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 129/354 (36%), Positives = 188/354 (53%), Gaps = 27/354 (7%)

Query: 21  LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETIDI 80
            T+  I GDGIG E+  + K+I ++   K  + ++  D+      F N    +P+  +  
Sbjct: 37  FTVSFIEGDGIGPEISQSVKQIFDA--AKVPIDWEPCDVSP---LFINGLTTIPEPAVQS 91

Query: 81  LKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVI 138
           + N+   AL G + +P  K  G+ S  + LRK  GLFANVRP KS++G K     VDLVI
Sbjct: 92  I-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148

Query: 139 VRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATL 198
           +RENTE  Y     S I+      V  + K IT  A++ +   A + A+      G   +
Sbjct: 149 IRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAYEYARAI----GRPRV 199

Query: 199 TVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VV 256
            V HKS +   +DGLF +V +E  +    +Y  +Q   +++D+ V  +   P  +   V 
Sbjct: 200 IVVHKSTIQRLADGLFVDVAKELSQ----EYPDIQLETELIDNTVLNVVSNPSSYSNAVS 255

Query: 257 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIR 315
           V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + 
Sbjct: 256 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 315

Query: 316 STALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
           S+ +ML  +G    A  I KAV + I  G +  T DL G +TT    + V+ +L
Sbjct: 316 SSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  174 bits (441), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 122/354 (34%), Positives = 187/354 (52%), Gaps = 31/354 (8%)

Query: 21  LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPD---ET 77
            T+ L+PGDG+GKE+  +   I +S N           +   WET   +G    +     
Sbjct: 28  FTVTLLPGDGVGKEITDSVVSIFKSEN-----------VPIDWETVDISGLDHTEGVKAA 76

Query: 78  IDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--KVD 135
           +D LK    G L G   +P  +V G+ S  VA RK L ++ANV   KS++G K +   VD
Sbjct: 77  VDSLKRNKIG-LKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVD 134

Query: 136 LVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGH 195
           LV++RENTE  Y  LE   +       V ++ K IT+  ++ IA  A   A++    N  
Sbjct: 135 LVVIRENTEGEYSGLEHESV-----PGVVESLKIITKSKSERIARFAFDFAKR----NNR 185

Query: 196 ATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDV 255
            ++T  HK+N++  SDGLFR    +  E   ++Y  +Q +  IVD+   +   +P  FDV
Sbjct: 186 KSVTAVHKANIMKLSDGLFRNTVSKIGE---EEYPEIQTSSIIVDNASMQAVAKPHQFDV 242

Query: 256 VVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEP-CHGSAPDIAGKGISNPIATI 314
           +V P++YG I+ +  AAL+G  G+VP  N G +  + EP       DI G+ ++NP A +
Sbjct: 243 MVTPSMYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAML 302

Query: 315 RSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
            S  L+L+ LG  + A  I  AV   I EGK  T D+GG+++T +  + V++KL
Sbjct: 303 LSATLLLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKL 356

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  174 bits (440), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 136/392 (34%), Positives = 198/392 (50%), Gaps = 48/392 (12%)

Query: 1   MMRTRFIQLSRRAYASNAKN-----------------LTIGLIPGDGIGKEVIPAGKKIL 43
           ++R  F   +RR  A++ KN                   +  I GDGIG E+  + K I 
Sbjct: 6   LLRNSFT--ARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIF 63

Query: 44  ESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETI-DILKNQCEGALFGAVQSPTTKVEG 102
           ++   +  ++++F D+      F N    +PD  +  I KN    AL G + +P  K  G
Sbjct: 64  KA--AEVPINWEFCDVT---PIFVNGLTTIPDPAVASINKNLI--ALKGPLATPIGK--G 114

Query: 103 YSSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVIVRENTEDLYIKLEKSYIDEATG 160
           + S  + LRK   LFANVRP KS++G K     VDLV++RENTE  Y     S I+    
Sbjct: 115 HRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEY-----SGIEHVVA 169

Query: 161 TRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRE 220
             V  + K IT  A++ +   A + A+      G   + V HKS +   +DGLF  V +E
Sbjct: 170 PGVVQSIKLITRDASERVIRYAFEYAKAI----GRPRVVVVHKSTIQRLADGLFVNVAKE 225

Query: 221 TYEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAAL-VGSL 277
             +    +Y  ++   +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSL
Sbjct: 226 LSK----EYPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSL 281

Query: 278 GVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAV 337
           G+ PSAN+G  I I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A  I +AV
Sbjct: 282 GLTPSANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAV 341

Query: 338 DANI-REGKYLTPDLGGNSTTQQVLEDVLSKL 368
              I    K  T DLGG++TT    + V+  L
Sbjct: 342 LTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  174 bits (440), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 130/353 (36%), Positives = 180/353 (50%), Gaps = 27/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETIDIL 81
           T+  I GDG+G E+  + K I  + N    +  ++     G   F N    +P+  +  +
Sbjct: 45  TVPFIEGDGVGPEISKSVKDIFSAAN----VPIQWQPCDVG-PIFVNGLTTIPEPAVKAI 99

Query: 82  KNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVIV 139
           K     AL G + +P  K  G+ S  + LRK   LFANVRP KSV   K     VDLV++
Sbjct: 100 KESLV-ALKGPLATPVGK--GHRSLNLTLRKTFDLFANVRPAKSVPNYKSTYENVDLVLI 156

Query: 140 RENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLT 199
           RENTE  Y     S I+      V  + K IT  A++ +   A + A       G   L 
Sbjct: 157 RENTEGEY-----SGIEHIVTPGVVQSIKLITREASEKVIRYAYEYAIAV----GRPRLI 207

Query: 200 VTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VVV 257
           V HKS +    DGLF ++  E     + +Y  ++   QI+D+ V  +   P  +   V V
Sbjct: 208 VVHKSTIQRLGDGLFVQIANEL----QSEYPSIKLETQILDNTVLNVVSNPTLYKDAVSV 263

Query: 258 APNLYGDILSDGAAAL-VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRS 316
            PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + S
Sbjct: 264 CPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLS 323

Query: 317 TALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
           + +ML  +G  E A  I  AV + I  G +  T DLGG++TT    E V+ KL
Sbjct: 324 SVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  173 bits (439), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 132/356 (37%), Positives = 178/356 (50%), Gaps = 34/356 (9%)

Query: 21  LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDE---- 76
             + LIPGDG+GKEV  +   I E+ N           L   W+    +G  L  E    
Sbjct: 29  FVVTLIPGDGVGKEVTDSVVSIFEAEN-----------LPIDWDRVDISG--LDHEEGVQ 75

Query: 77  -TIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--K 133
             +D LK    G L G   +      G  S  VALRK L ++ANV   KSV G K +   
Sbjct: 76  AAVDSLKRNKIG-LKGIWHTSAADQAGKGSLNVALRKELDIYANVALFKSVPGVKTKIPN 134

Query: 134 VDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQN 193
           VDLV++RENTE  Y  LE   +       V ++ K +TE  T+ IA  A   A++    N
Sbjct: 135 VDLVVIRENTEGEYSGLEHESV-----PGVVESLKIMTEDKTERIARFAFDFAKK---YN 186

Query: 194 GHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECF 253
            HA +T  HK+N++   DGLFR V     E    +Y  V+    IVD+   +   +P  F
Sbjct: 187 RHA-VTAVHKANIMKLGDGLFRNVVTRVGE---QEYPDVKVGSIIVDNASMQTVAKPHQF 242

Query: 254 DVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEP-CHGSAPDIAGKGISNPIA 312
           DV+V P++YG IL +  AAL+G  G+V  AN G    + EP       DI  K I+NP A
Sbjct: 243 DVLVTPSMYGTILGNIGAALIGGPGLVAGANYGREYAVFEPGSRHVGLDIKDKNIANPTA 302

Query: 313 TIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
            I S +LML+ LG    A  I  AV   I EGK  TPD+GG+++T +  + V+ KL
Sbjct: 303 MILSASLMLDHLGLSTSATKISNAVHQVIAEGKSTTPDIGGSASTTEFTQAVIEKL 358

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  173 bits (438), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 126/353 (35%), Positives = 179/353 (50%), Gaps = 31/353 (8%)

Query: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTG---KALPDETI 78
           T+ LIPGDG+GKEV  +   I ES N           +   WET + +G   +    + +
Sbjct: 31  TVTLIPGDGVGKEVTDSVVSIFESEN-----------IPIDWETVEISGLDNQEGVQKAV 79

Query: 79  DILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDRK--VDL 136
           + LK    G L G   +P+ +  G+ S  VALRK L +FANV   KSV G   R   VD+
Sbjct: 80  ESLKRNKVG-LKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVDM 137

Query: 137 VIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHA 196
           V++RENTE  Y  LE   +       V ++ K +T+  ++ I   A   A +    N   
Sbjct: 138 VVIRENTEGEYSGLEHESV-----PGVVESLKIMTKAKSERIGRFAFDFAVK----NNRK 188

Query: 197 TLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDVV 256
           ++   HK+N++   DGLFR    E       +Y  +     IVD+   +   +P  FDV+
Sbjct: 189 SVCAVHKANIMKLGDGLFRNCINEV---GAKEYPEIDVKNIIVDNASMQAVAKPHQFDVL 245

Query: 257 VAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEP-CHGSAPDIAGKGISNPIATIR 315
           V PNLYG IL +  AAL+G  G+VP AN G    + EP       DI G+ ++NP A I 
Sbjct: 246 VTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMIL 305

Query: 316 STALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
           S++LML  LG    A  I KA    I E K  T D+GG+++T +  E ++SKL
Sbjct: 306 SSSLMLRHLGLNAYADRISKATYDVIAEAKTTTQDIGGSASTTEFTEAIISKL 358

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  173 bits (438), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 131/359 (36%), Positives = 184/359 (51%), Gaps = 39/359 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWET------FQNTGKALPD 75
           T+  I GDG+G E+  + K I           F    +   WE+        N    +P+
Sbjct: 40  TVSFIEGDGVGPEISKSVKDI-----------FAAAKVPIVWESCPVTPLLVNGVTTIPE 88

Query: 76  ETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RK 133
           +  + + N+   AL G + +P  K  G+ S  + LRK  GLFANVRP KSV+G K     
Sbjct: 89  QAQESI-NRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYED 145

Query: 134 VDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQN 193
           VDLV++RENTE  Y  +E   +       V  + K IT  A++ +   A + A+      
Sbjct: 146 VDLVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYARAV---- 196

Query: 194 GHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECF 253
           G   L V HKS +   +DGLF  V +E      D    +Q   +++D+ V  +   P  +
Sbjct: 197 GRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPD----IQLQTELIDNTVLNVVSNPSKY 252

Query: 254 -DVV-VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNP 310
            DVV V PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDIAG+  +NP
Sbjct: 253 SDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANP 312

Query: 311 IATIRSTALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
            A + S+ +ML  +G  E A  I KAV   I  G +  T DL G+++T    E V+S+L
Sbjct: 313 TALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  173 bits (438), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 130/359 (36%), Positives = 178/359 (49%), Gaps = 37/359 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWET------FQNTGKALPD 75
           T+  I GDGIG E+  + K I           F+   +   WET        +    +PD
Sbjct: 45  TVSFIEGDGIGPEISRSVKDI-----------FQAASVPITWETCDVSPILVDGLTTIPD 93

Query: 76  ETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--K 133
           E +  +     G L G + +P  K  G+ S  + LRK   LFANVRP KSV G K     
Sbjct: 94  EAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDN 150

Query: 134 VDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQN 193
           VDLV++RENTE  Y     S I+      V  + K IT  A++ +   A + A+      
Sbjct: 151 VDLVLIRENTEGEY-----SGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAI---- 201

Query: 194 GHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECF 253
           G   + V HKS +   SDGLF  V +E  +  +  +  ++ + +++D+ V  +   P  +
Sbjct: 202 GRPKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMNPSKY 259

Query: 254 D--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNP 310
              V V PNLYGDILSD  + L  GSLG+ PSAN+G  I I E  HGSAPDIAG+  +NP
Sbjct: 260 SDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQNKANP 319

Query: 311 IATIRSTALMLEFLGYPEPAKDIHKAVDANI-REGKYLTPDLGGNSTTQQVLEDVLSKL 368
            A + S+ +ML  +G  E    I  AV   I    K  T DLGG +TT    E V+  L
Sbjct: 320 TALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  172 bits (437), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 126/353 (35%), Positives = 184/353 (52%), Gaps = 27/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETIDIL 81
           T+  I GDG+G E+  + K I  +   K  + ++  D+      F N    +PD  +  +
Sbjct: 37  TVPFIEGDGVGPEISKSVKDIFAA--AKVPIEWEPCDV---GPIFVNGLTTIPDAAVQSI 91

Query: 82  KNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVIV 139
            N+   AL G + +P  K  G+ S  + LRK   LFANVRP +SV   K   + VDLV++
Sbjct: 92  -NKHLVALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSVPNYKTTYQNVDLVLI 148

Query: 140 RENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLT 199
           RENTE  Y     S I+      V  + K IT+ A++ +   A +  +      G   L 
Sbjct: 149 RENTEGEY-----SGIEHVISPGVIQSIKLITKDASERVIRYAFEYTRAI----GRPRLV 199

Query: 200 VTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VVV 257
           V HKS +   +DGLF  V +E       +Y  ++   +++D+ +  +   PE +   V V
Sbjct: 200 VVHKSTIQRMADGLFVNVAKEL----ASEYPDIELQTELIDNTILNVVTHPESYTDAVSV 255

Query: 258 APNLYGDILSDGAAAL-VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRS 316
            PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + S
Sbjct: 256 CPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 317 TALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
           + +ML  +G  E A  I  A+ + I  G +  T DL G +TT    E V++KL
Sbjct: 316 SVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSFTEAVINKL 368

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  172 bits (436), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 182/360 (50%), Gaps = 39/360 (10%)

Query: 21  LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWE------TFQNTGKALP 74
            T+  I GDG+G E+  + K I           FK   +   WE         N    +P
Sbjct: 41  FTVPFIEGDGVGPEISKSVKDI-----------FKAAQVPVDWEYCDVSPLLINGLTTIP 89

Query: 75  DETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDG--TKDR 132
           +  +  + N+ + AL G + +P  K  G+ S  + LRK  GLFANVRP +S+ G  T  +
Sbjct: 90  EPAVQQI-NKHKIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYK 146

Query: 133 KVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQ 192
            VDLV++RENTE  Y     S I+      V  + K IT  A++ +   A + A+     
Sbjct: 147 NVDLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAI--- 198

Query: 193 NGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPEC 252
            G   L V HKS +   +DGLF  + +E       ++  ++   +++D+ V  + R+P  
Sbjct: 199 -GRPRLVVVHKSTIQKLADGLFVNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPS 253

Query: 253 FD--VVVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISN 309
           +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +N
Sbjct: 254 YTDAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKAN 313

Query: 310 PIATIRSTALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
           P A + S+ +ML ++G    +  I  A+   I  G +  T DL G +TT    E V+  L
Sbjct: 314 PTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  172 bits (435), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 129/376 (34%), Positives = 186/376 (49%), Gaps = 41/376 (10%)

Query: 9   LSRRAYASNAKN-----------LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFI 57
           +S+RA+ S A              T+ L+PGDG+G+E+  +   I E+ N          
Sbjct: 6   ISKRAFTSIASRENIIPKKYGGRYTVTLLPGDGVGREITDSVVSIFEAEN---------- 55

Query: 58  DLQAGWETFQNTGKALPD--ETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLG 115
            L   WE  + +G    D    ++ LK    G     +   +   +G++S  VALRK L 
Sbjct: 56  -LPIDWERVELSGLEQEDVHTAVESLKRNKIG--LKGIWHTSADHDGHTSWNVALRKELD 112

Query: 116 LFANVRPVKSVDGTKDR--KVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEI 173
           ++ANV   KS  G   R   VDLVI+RENTE  Y  LE   +       V ++ K +T  
Sbjct: 113 IYANVAIFKSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESV-----PGVVESLKIMTAQ 167

Query: 174 ATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQ 233
            T+ IA  A   A +   +    ++T  HK+N++   DGLFR +  E       +Y  V 
Sbjct: 168 KTERIARFAFDYAMKYNRK----SVTAVHKANIMKLGDGLFRNLVTEI---GAKEYPEVG 220

Query: 234 YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGE 293
            +  IVD+   +   +P  FDV+VAP++YG IL +  AAL+G  G+VP AN G +  + E
Sbjct: 221 VSSIIVDNASMQAVAKPHQFDVMVAPSMYGTILGNIGAALIGGPGLVPGANYGRDYAVFE 280

Query: 294 P-CHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLG 352
           P       DI  + I+NP A I S  LML  LG+   A  I KAV   I EGK  T D+G
Sbjct: 281 PGSRHVGLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIAEGKTTTRDIG 340

Query: 353 GNSTTQQVLEDVLSKL 368
           G++TT +    V++KL
Sbjct: 341 GSATTTEFTNAVIAKL 356

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  170 bits (431), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 127/355 (35%), Positives = 186/355 (52%), Gaps = 27/355 (7%)

Query: 20  NLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETID 79
           N  +  I GDGIG E+  + K I  +   K  + F+ + ++       N   ++P+E   
Sbjct: 35  NYKVSFIEGDGIGPEISKSVKDIFAA--AKVPVDFESVVVKP---ILVNGVTSIPEEAQK 89

Query: 80  ILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLV 137
            + N    AL G + +P  K  G+ S  + LRK  GLFAN+RP KSV+G K     V+LV
Sbjct: 90  SI-NTNLVALKGPLATPVGK--GHRSMNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLV 146

Query: 138 IVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHAT 197
           ++RENTE  Y  +E + +       V  + K IT  A++ +   A + A+          
Sbjct: 147 LIRENTEGEYAGIEHAIVPG-----VVQSIKLITREASERVIRFAYEYARAAERPR---- 197

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--V 255
           L V HKS +   SDGLF +V +E     + ++  ++   +++D+ V     +P  +   V
Sbjct: 198 LIVVHKSTIQRLSDGLFVDVAKEL----QSEFPDIKLETELIDNAVLNTVTDPTKYSDAV 253

Query: 256 VVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATI 314
            V PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDIAGK  +NP A +
Sbjct: 254 SVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALL 313

Query: 315 RSTALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368
            S+ +ML  +G  E A  I KAV   I  G +  T DL G+++T    E V+ KL
Sbjct: 314 LSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  170 bits (430), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 124/376 (32%), Positives = 192/376 (51%), Gaps = 35/376 (9%)

Query: 6   FIQLSRRAYASNAKNL----------TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFK 55
           F  + RR  AS AK L          T+ LIPGDG+GKE+  +   I E+ N    + ++
Sbjct: 2   FRTVQRRGMASMAKELVLPKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAEN--IPVDWE 59

Query: 56  FIDLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLG 115
            +D+    +  Q+  +A     ++ LK    G     +   +  +  + S  VALRK L 
Sbjct: 60  RVDISTS-DNIQDVSQA-----VESLKRNKIG--LKGIWHTSADIADHGSFNVALRKQLD 111

Query: 116 LFANVRPVKSVDGTKDR--KVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEI 173
           +FA+V   KSV G K +   VDLV++RENTE  Y  LE   +       V ++ K IT+ 
Sbjct: 112 MFAHVAFFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESV-----PGVVESLKIITKA 166

Query: 174 ATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQ 233
            ++ IA  A   A++   +    ++   HK+N++   DGLFR    E      ++Y  +Q
Sbjct: 167 KSERIARFAFDFAKKYNRK----SVCAVHKANIMKMGDGLFRNTVTEI---GANEYPDIQ 219

Query: 234 YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGE 293
            +  IVD+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  A+ G    + E
Sbjct: 220 TSSIIVDNASMQAVAKPHQFDVMVTPSMYGTIIGNIGAALIGGPGLVAGAHYGREHAVFE 279

Query: 294 P-CHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLG 352
           P       DI GK ++NP A I S+ LML+ LG  E AK I KA    I  G+  T D+G
Sbjct: 280 PGSQHVGLDIKGKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLGQVTTKDIG 339

Query: 353 GNSTTQQVLEDVLSKL 368
           G+++T +  E ++ +L
Sbjct: 340 GSASTTEFTEAIIKRL 355

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  170 bits (430), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 123/356 (34%), Positives = 183/356 (51%), Gaps = 28/356 (7%)

Query: 20  NLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETID 79
           N T+  I GDG+G E+  + + I ++      +   +++   G     N    +P   +D
Sbjct: 44  NYTVPFIEGDGVGPEISKSVRTIFKAAK----VPIDWVNCDIG-PLLINGETTIPQTAVD 98

Query: 80  ILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVD--GTKDRKVDLV 137
            + N    AL G + +P    +G+ S  + LRK  GLFANVRP KS+    +    VDL+
Sbjct: 99  QINNSLI-ALKGPLATPVG--QGHRSINLTLRKTFGLFANVRPAKSIPNLASTYENVDLI 155

Query: 138 IVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHAT 197
           ++RENTE  Y  +E   +       V  + K IT  A++ +   A +  +      G + 
Sbjct: 156 VIRENTEGEYSGIEHEIVP-----GVVQSIKLITRKASEKVIKYAFEYTRSI----GRSN 206

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECF--DV 255
           L V HK+ +  + DGLF +  +E      DKY  V    +++D+ V      PE +   V
Sbjct: 207 LIVVHKATIQRRGDGLFVQTAQEM----ADKYPDVNLKLELIDNTVLNCIMNPEKYADSV 262

Query: 256 VVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATI 314
            V PNLYGDILSD  + L  GSLG+ PSAN+G   V+ E  HGSAPDIAG+  +NP A +
Sbjct: 263 SVCPNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKANPTALL 321

Query: 315 RSTALMLEFLGYPEPAKDIHKAVDANIREGK-YLTPDLGGNSTTQQVLEDVLSKLD 369
            S+ +ML  +G  + A  I  AV   I  GK + T DLGG++TT    + V+  L+
Sbjct: 322 LSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENLN 377

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  168 bits (425), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 121/354 (34%), Positives = 182/354 (51%), Gaps = 32/354 (9%)

Query: 21  LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPD---ET 77
           +T+ L+PGDG+GKE+  +   I ++ N           +   WET   +     D     
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQAEN-----------VPIDWETVDISQLDHEDGVNAA 77

Query: 78  IDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--KVD 135
           ++ LK    G L G   +   +V G+ S  VA RK L ++ANV   KS+ G K +   VD
Sbjct: 78  VESLKRNKIG-LKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVD 135

Query: 136 LVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGH 195
           LVI+RENTE  Y  LE   +       V ++ K +T++ ++ IA  A   A +   +   
Sbjct: 136 LVIIRENTEGEYSGLEHESV-----PGVVESLKIVTKVNSERIAKFAFDFAMRHDRK--- 187

Query: 196 ATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDV 255
             +T  HK+N++  SDGLFR       EA    Y  ++ +  IVD+   +   +P  FDV
Sbjct: 188 -MVTAVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFDV 242

Query: 256 VVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEP-CHGSAPDIAGKGISNPIATI 314
           +V P++YG IL +  AAL+G  G+VP  N G    + EP       DI G+ ++NP A I
Sbjct: 243 MVTPSMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMI 302

Query: 315 RSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
            S+ L+L+ LG  + A  I KAV   I+EG   T D+GGN++T +  + V+ KL
Sbjct: 303 LSSTLLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  165 bits (417), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 120/353 (33%), Positives = 181/353 (51%), Gaps = 30/353 (8%)

Query: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDET---I 78
           T+ LIPGDG+GKEV  +   I           FK  ++   W+    +G    ++    +
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSI-----------FKAENVPVDWDRVDISGVDRAEDVKSAV 78

Query: 79  DILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--KVDL 136
           + LK    G L G   +      G+ S  VALRK L ++ANV   KS+ G + +   VDL
Sbjct: 79  ESLKRNRIG-LKGIWHTSPADQAGHGSLNVALRKELDIYANVARFKSIPGVQVKIPDVDL 137

Query: 137 VIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHA 196
           V++RENTE  +  LE   +       V ++ K +T+   + IA  A   A++    N   
Sbjct: 138 VVIRENTEGEFSGLEHESV-----PGVVESLKIMTQDNIERIARFAFDYAKK----NDRK 188

Query: 197 TLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDVV 256
            +   HK+N++   DGLF+ + +E  E    +Y  +Q    IVD+   +    P  FDV+
Sbjct: 189 QVVAVHKANIMKMGDGLFKNLVQEVGE---KEYPELQVGNIIVDNASMQTVANPHQFDVL 245

Query: 257 VAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEP-CHGSAPDIAGKGISNPIATIR 315
           V P++YG IL +  AAL+G  G+V  AN G ++ + EP       DI G+ ++NP A I 
Sbjct: 246 VTPSMYGTILGNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLDIKGQNVANPTAMIL 305

Query: 316 STALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
           S+ L+L  LG    A  I KAV A I EGK +T D+GG ++T +  E V++KL
Sbjct: 306 SSVLLLNHLGLNTSADRISKAVHAVIAEGKSVTRDIGGTASTTEFTEAVINKL 358

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  162 bits (411), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 120/352 (34%), Positives = 178/352 (50%), Gaps = 29/352 (8%)

Query: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETIDIL 81
           T+ LIPGDG+GKEV  +   I  + N           L   WE    +G    +E ++  
Sbjct: 35  TVTLIPGDGVGKEVTDSVVSIFNAEN-----------LPIDWERVDISGLD-HEEGVEAA 82

Query: 82  KNQCEGALFG--AVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--KVDLV 137
            N  +    G   +   +     + S  VALRK L ++ANV   K++ G K R   VDLV
Sbjct: 83  VNSLKRNKIGLKGIWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLV 142

Query: 138 IVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHAT 197
           I+RENTE  Y  LE   +       V ++ K IT+  ++ IA  A   A+ R ++     
Sbjct: 143 IIRENTEGEYSGLEHESV-----PGVVESLKIITKEKSERIARFAFDFAK-RFDRK---L 193

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDVVV 257
           +T  HK+N++   DGLFR       E    +Y  ++ +  IVD+   +   +P  FDV+V
Sbjct: 194 VTAVHKANIMKLGDGLFRNSVTSIGET---EYPDIKVSSIIVDNASMQSVAKPHQFDVLV 250

Query: 258 APNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEP-CHGSAPDIAGKGISNPIATIRS 316
            P++YG IL +  AAL+G  G+VP AN G    + EP       DI G+ ++NP A I S
Sbjct: 251 TPSMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILS 310

Query: 317 TALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
           + L+L+ LG    AK I  AV   I EGK  T D+GG+++T +   +++ KL
Sbjct: 311 STLLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  162 bits (409), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 121/373 (32%), Positives = 187/373 (50%), Gaps = 37/373 (9%)

Query: 1   MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ 60
           ++R     +S + Y        I LIPG+GIGKEV  + + I ++ N           L 
Sbjct: 6   LLRRSISTISPKKYGGR---FQITLIPGNGIGKEVTDSVRSIFQAEN-----------LP 51

Query: 61  AGWE--TFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFA 118
             WE    ++    +      I +N+   AL G   S    ++G  S  VALRK L +FA
Sbjct: 52  IDWEIVNIESHRDGIKTAVDSIKRNKI--ALKGIWSS--DPIDG--SLNVALRKQLDIFA 105

Query: 119 NVRPVKSVDGTKDR--KVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATK 176
           NV   KS D    R   VDLV++RENTE  +  LE   +D      V ++ K +T+  T+
Sbjct: 106 NVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDG-----VVESLKIVTKPKTE 160

Query: 177 NIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNE 236
            IA  A   A++    +    +T  HK+N++   DGLF+ +         ++Y  ++ + 
Sbjct: 161 RIARFAFDFAKKHNRNH----VTAVHKANIMKLGDGLFKNIVAHI---GNNEYPEIKNSS 213

Query: 237 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEP-C 295
            IVD+   +   +P  FDV+V+P++YG IL +  AAL+G  G+VP AN G +  + EP  
Sbjct: 214 IIVDNASMQAVAKPHQFDVLVSPSMYGTILGNIGAALIGGPGLVPGANFGRDYAVFEPGS 273

Query: 296 HGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNS 355
                DI G+ ++NP A I S   ML  LG   PA+ I  AV   I +G  +T D+GG +
Sbjct: 274 RHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQGTTVTKDIGGTA 333

Query: 356 TTQQVLEDVLSKL 368
           +T +  + V+++L
Sbjct: 334 STTEFTDAVINEL 346

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  158 bits (400), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 115/354 (32%), Positives = 172/354 (48%), Gaps = 32/354 (9%)

Query: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTG----KALPDET 77
           T+ L+PGDG+GKE   +   +  + N           +   WE    +G    + +    
Sbjct: 28  TVTLLPGDGVGKECTDSVVSVFNAEN-----------IPIDWEIVNISGLDHKEGVAAAV 76

Query: 78  IDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--KVD 135
             + +N+    L G   +      G+ S  VA RK L ++ANV   KS+ G K     VD
Sbjct: 77  QSLRRNKI--GLKGLWHTSNADQSGHGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVD 134

Query: 136 LVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGH 195
           LV++RENTE  +  LE   ++      V ++ K  T   T+ IA  A   AQ+    NG 
Sbjct: 135 LVVIRENTEGEFSGLEHESVEG-----VVESLKVTTLPKTERIARFAFNYAQK----NGR 185

Query: 196 ATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDV 255
             +   HK+N++   DGLFR       E    +Y  ++ +  IVD+   +   +P  FDV
Sbjct: 186 KAVCAVHKANIMKLGDGLFRNTVTSIGE---KEYPDIETSSIIVDNASMQAVAKPHQFDV 242

Query: 256 VVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEP-CHGSAPDIAGKGISNPIATI 314
           +V P++YG I+ +  AAL+G  G+V  AN G    + EP       DI G+ I+NP A +
Sbjct: 243 LVTPSMYGTIIGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNIANPTAML 302

Query: 315 RSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
            S+ALML  LG  +  K I  AV   I EG   T D+GG++TT +  + V+ KL
Sbjct: 303 LSSALMLNHLGLTKSGKRISDAVREVIAEGDVRTKDIGGDATTTEFTQAVIEKL 356

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  147 bits (370), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 128/366 (34%), Positives = 186/366 (50%), Gaps = 37/366 (10%)

Query: 25  LIPGDGIGKEVIPAGKKILESLN-PKYGLSFKFIDLQAGWETFQNTGKALPDETIDILKN 83
           ++PGD IG+EVI    K+L ++   +  ++F+F     G      TG  L D+TI+  K 
Sbjct: 9   VLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLSDKTIEAAK- 67

Query: 84  QCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRPV----KSVDGTKDRK--- 133
             +  L GAV  P     G   P   ++A+RK LGL+AN+RP     KS+ G    K   
Sbjct: 68  AADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGLSPLKPEI 126

Query: 134 ---VDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRL 190
               D VI+RE    +Y    K    E  G  VA  +++ T    + I  +   +A   L
Sbjct: 127 AQGTDFVILRELVGGIYFGERK----EDDGDGVAWDSEKYTVSEVERITRMGAFLA---L 179

Query: 191 EQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREP 250
           + +    L    K+NVL+ S  L+R    ET    K ++  +    Q++DS    M + P
Sbjct: 180 QHDPPLPLWSFDKANVLASSR-LWRRTVNETI---KREFPQLSVQHQLIDSAAMIMIKNP 235

Query: 251 ECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIVIG--EPCHGSAPDIA 303
             F+ +V+  N++GDI+SD A+ + GSLG++PSA++      N   G  EPCHGSAPD+ 
Sbjct: 236 RKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCHGSAPDLE 295

Query: 304 GKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLE 362
            KG +NPIA I S A+ML+  L   +  K I  AV   I  G   T DLGGN+TT +V +
Sbjct: 296 -KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVKQVIESG-IRTGDLGGNNTTTEVGD 353

Query: 363 DVLSKL 368
            V   L
Sbjct: 354 AVTHAL 359

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  147 bits (370), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 122/372 (32%), Positives = 193/372 (51%), Gaps = 40/372 (10%)

Query: 19  KNLTIGLIPGDGIGKEVIPAGKKILESLNPK-YGLSFKFIDLQAGWETFQNTGKALPDET 77
           KN+ +  +PGD +G+E++    K+L+ +  K +G+ F F     G +    TG  LPDET
Sbjct: 5   KNIVV--LPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDET 62

Query: 78  IDILKNQCEGALFGAVQSP---TTKVEGYSSPIVALRKNLGLFANVRPVKSVD----GTK 130
           ++  K Q +  L GAV  P   T KV      ++ +RK LGL+ N+RP K +     G  
Sbjct: 63  LEAAK-QSDAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFISDKLIGLS 120

Query: 131 DRK------VDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQ 184
             K       D V+VRE    +Y    +    E  G+ VA  +++ +    K I  +A  
Sbjct: 121 PLKEEVCKGTDFVVVRELVGGIYFGERQ----EDDGSGVAWDSEKYSIEEVKRITKMA-- 174

Query: 185 IAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVY 244
            A   L+ +    +    K+NVL+ S  L+R    ET      ++  ++   Q++DS   
Sbjct: 175 -AFLSLQNDPPLPIWSLDKANVLASSR-LWRAAVDETIA----EFPNLKVQHQLIDSAAM 228

Query: 245 RMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIVIG--EPCHG 297
            + + P   + +++  N++GDI+SD A+ + GSLG++PSA++      N   G  EPCHG
Sbjct: 229 MLVKNPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHG 288

Query: 298 SAPDIAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAVDANIREGKYLTPDLGGNST 356
           SAPD+A +G  NP+ATI S A+ML+  L   +  + I +AV   +  G   T DLGGNST
Sbjct: 289 SAPDLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVVLDRG-IRTADLGGNST 346

Query: 357 TQQVLEDVLSKL 368
           T ++ + V  +L
Sbjct: 347 TSELGDAVAQEL 358

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  140 bits (353), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 119/364 (32%), Positives = 187/364 (51%), Gaps = 45/364 (12%)

Query: 23  IGLIPGDGIGKEVIPAGKKILESLNP-KYGLSFKFIDLQAGWETFQNTGKALPDETIDIL 81
           I ++PGD +G+E+     K+L++++  +  ++F F +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 82  KNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRPVK-SVDGTKD------ 131
           K + +  L GAV  P     G   P   ++ +RK L L+AN+RP   + D   D      
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 132 ---RKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQ 188
              +  D V+VRE    +Y    K    E  G  VA  +++ T    + I  +A  +A  
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMA-- 178

Query: 189 RLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFR 248
            L+      +    K+NVL+ S  L+R+   ET    K+++  ++   Q++DS    + +
Sbjct: 179 -LQHEPPLPIWSLDKANVLASSR-LWRKTVEETI---KNEFPTLKVQHQLIDSAAMILVK 233

Query: 249 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIVIG--EPCHGSAPD 301
            P   + +++  N++GDI+SD A+ + GSLG++PSA++      N   G  EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 302 IAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYLTPDLGGNST 356
           +  K   NPIATI S A+ML+  L  PE  K I  AV    DA IR G     DLGG+++
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGIRTG-----DLGGSNS 347

Query: 357 TQQV 360
           T +V
Sbjct: 348 TTEV 351

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  140 bits (353), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 119/364 (32%), Positives = 186/364 (51%), Gaps = 45/364 (12%)

Query: 23  IGLIPGDGIGKEVIPAGKKILESLNP-KYGLSFKFIDLQAGWETFQNTGKALPDETIDIL 81
           I ++PGD +G+E+     K+L++++  +  + F F +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 82  KNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRPVK-SVDGTKD------ 131
           K + +  L GAV  P     G   P   ++ +RK L L+AN+RP   + D   D      
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 132 ---RKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQ 188
              +  D V+VRE    +Y    K    E  G  VA  +++ T    + I  +A  +A  
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMA-- 178

Query: 189 RLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFR 248
            L+      +    K+NVL+ S  L+R+   ET    K+++  ++   Q++DS    + +
Sbjct: 179 -LQHEPPLPIWSLDKANVLASSR-LWRKTVEETI---KNEFPTLKVQHQLIDSAAMILVK 233

Query: 249 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIVIG--EPCHGSAPD 301
            P   + +++  N++GDI+SD A+ + GSLG++PSA++      N   G  EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 302 IAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYLTPDLGGNST 356
           +  K   NPIATI S A+ML+  L  PE  K I  AV    DA IR G     DLGG+++
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGIRTG-----DLGGSNS 347

Query: 357 TQQV 360
           T +V
Sbjct: 348 TTEV 351

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  140 bits (353), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 118/364 (32%), Positives = 187/364 (51%), Gaps = 45/364 (12%)

Query: 23  IGLIPGDGIGKEVIPAGKKILESLNP-KYGLSFKFIDLQAGWETFQNTGKALPDETIDIL 81
           I ++PGD +G+E+     K+L++++  +  + F+F     G      TG+ LPD +++  
Sbjct: 7   IVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAA 66

Query: 82  KNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRP----------VKSVDG 128
           K + +  L GAV  P     G   P   ++ +RK L L+AN+RP          +  +  
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKA 124

Query: 129 TKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQ 188
              R  D V+VRE    +Y    K   DE  G  VA  +++ +    + I  +A  +A  
Sbjct: 125 EHARGTDFVVVRELVGGIYFGERKE--DEGDG--VAWDSEKYSVPEVQRITRMAAFLA-- 178

Query: 189 RLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFR 248
            L+ N    +    K+NVL+ S  L+R+   ET    K+++  +    Q++DS    M +
Sbjct: 179 -LQHNPPLPVWSLDKANVLASSR-LWRKTVEETI---KNEFPTLTVQHQLIDSAAMIMVK 233

Query: 249 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIVIG--EPCHGSAPD 301
            P   + V++  N++GDI+SD A+ + GSLG++PSA++      N   G  EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 293

Query: 302 IAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYLTPDLGGNST 356
           +  KG  NPIATI S A+MLE  L   E    + +AV    D+ IR G     DL G+++
Sbjct: 294 LE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVRRVLDSGIRTG-----DLRGSNS 347

Query: 357 TQQV 360
           TQ+V
Sbjct: 348 TQEV 351

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  139 bits (350), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 188/369 (50%), Gaps = 47/369 (12%)

Query: 18  AKNLTIGLIPGDGIGKEVIPAGKKILESL-NPKYGLSFKFIDLQAGWETFQNTGKALPDE 76
           +KN+ +  +PGD +GKEV     K+L ++   +  + F F     G      TG  LPDE
Sbjct: 2   SKNIVV--LPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDE 59

Query: 77  TIDILKNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRPVK-SVDGTKD- 131
            ++  K + +  L GAV  P     G   P   ++ +RK LGL+AN+RP   + D   D 
Sbjct: 60  ALEASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDL 117

Query: 132 --------RKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIAL 183
                   +  D V+VRE    +Y    K   DE  G  VA  +++ +    + I  +A 
Sbjct: 118 SPLKPEYAKGTDFVVVRELVGGIYFGERKE--DEGDG--VAWDSEKYSVPEVQRITRMAA 173

Query: 184 QIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMV 243
            +A   L+QN    +    K+NVL+ S  L+R+   ET    K ++  +    Q++DS  
Sbjct: 174 FLA---LQQNPPLPIWSLDKANVLASSR-LWRKTVEETI---KTEFPQLTVQHQLIDSAA 226

Query: 244 YRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIVIG--EPCH 296
             + + P   + VV+  N++GDI+SD A+ + GSLG++PSA++      N   G  EPCH
Sbjct: 227 MILVKSPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCH 286

Query: 297 GSAPDIAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYLTPDL 351
           GSAPD+    + NPIATI S A+ML+  L   E  + + +AV    DA +R G     DL
Sbjct: 287 GSAPDLPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAVRNVLDAGVRTG-----DL 340

Query: 352 GGNSTTQQV 360
           GG+++T +V
Sbjct: 341 GGSNSTTEV 349

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  139 bits (349), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 116/367 (31%), Positives = 185/367 (50%), Gaps = 43/367 (11%)

Query: 18  AKNLTIGLIPGDGIGKEVIPAGKKILESLNP-KYGLSFKFIDLQAGWETFQNTGKALPDE 76
           +KN+ +  +PGD +G+E+     K+L++++  +   +F F     G      TG  LPDE
Sbjct: 2   SKNIVV--LPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDE 59

Query: 77  TIDILKNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRP----------V 123
            ++  K + +  L GAV  P     G   P   ++ +RK L L+AN+RP          +
Sbjct: 60  ALEASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLEL 117

Query: 124 KSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIA--TKNIATI 181
             +     +  D V+VRE    +Y    K   DE  G         + E+   T+  A +
Sbjct: 118 SPLKAQYAQGTDFVVVRELVGGIYFGERKE--DEGDGVAWDSEQYSVPEVQRITRMAAFL 175

Query: 182 ALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDS 241
           ALQ        N    +    K+NVL+ S  L+R+   +T    K+++  +  N Q++DS
Sbjct: 176 ALQ-------HNPPLPIWSLDKANVLASSR-LWRKTVEKTI---KEEFPTLSVNHQLIDS 224

Query: 242 MVYRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIVIG--EP 294
               + + P   + +++  N++GDI+SD A+ + GSLG++PSA++      N   G  EP
Sbjct: 225 AAMILVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEP 284

Query: 295 CHGSAPDIAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAVDANIREGKYLTPDLGG 353
           CHGSAPD+A KG  NP+ATI S A+ML+  L   E    I KAV   + +G   T DLGG
Sbjct: 285 CHGSAPDLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKKVLDDG-IRTGDLGG 342

Query: 354 NSTTQQV 360
           +++T +V
Sbjct: 343 SNSTSEV 349

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  138 bits (348), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 121/365 (33%), Positives = 190/365 (52%), Gaps = 47/365 (12%)

Query: 23  IGLIPGDGIGKEVIPAGKKILESLNPKYG-LSFKFIDLQAGWETFQNTGKALPDETIDIL 81
           I ++PGD IG+EV+    K+L ++      + F F     G      TG ALPDE +   
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGAA 66

Query: 82  KNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRPVK-SVDGTKD------ 131
           K + +  L GAV  P  +  G   P   ++ LR+ LG++AN+RP   + D   +      
Sbjct: 67  K-EADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSPLRP 124

Query: 132 ---RKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQ 188
              R  D+++VRE     Y    + + DE  G  VA  T + T    + IA +A  +A  
Sbjct: 125 EIARDTDIMVVRELLGGSYFG--ERHEDEGDG--VAWDTDKYTVKEVQRIARMAGFLA-- 178

Query: 189 RLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFR 248
            L+ +    +    K+NVL+ S  L+R+   ET+++   ++  VQ   Q++DS    + +
Sbjct: 179 -LQHDPPLPVWSLDKANVLASSR-LWRKTVEETFQS---EFPNVQLQHQLIDSAAMILVK 233

Query: 249 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG--PN----IVIGEPCHGSAPD 301
            P  F+ VVV  N++GDI+SD A+ + GSLG++PSA++   P+      + EPCHGSAPD
Sbjct: 234 NPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPD 293

Query: 302 I-AGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYLTPDLGGNS 355
           + AGK  +NPI  I S A+ML+  L      + + +AV    D+ +R G     DL G+S
Sbjct: 294 LPAGK--ANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVLDSGVRTG-----DLLGSS 346

Query: 356 TTQQV 360
           +T +V
Sbjct: 347 STSEV 351

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  137 bits (344), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 150/296 (50%), Gaps = 31/296 (10%)

Query: 21  LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETF---QNTGKALPDET 77
            T+ LIPGDG+GKEV  + K I E+ N           +   WET    Q   K   +E 
Sbjct: 29  FTVTLIPGDGVGKEVTDSVKTIFEAEN-----------IPIDWETINIKQTDHKEGVNEA 77

Query: 78  IDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDR--KVD 135
           ++ L+    G L G   +P  +  G+ S  VALRK L ++ANV   KS+ G K R   +D
Sbjct: 78  VESLRRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDID 135

Query: 136 LVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGH 195
           L+++RENTE  +  LE   +       V ++ K +T+  T+ IA  A   A++       
Sbjct: 136 LIVIRENTEGEFSGLEHESV-----PGVVESLKIMTKPKTERIARFAFDFAKKY----NR 186

Query: 196 ATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDV 255
             +T  HK+N++   DGLFR +  E     + +Y  +  +  IVD+   +   +P  FDV
Sbjct: 187 KAVTAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSIIVDNASMQAVAKPHQFDV 243

Query: 256 VVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEP-CHGSAPDIAGKGISNP 310
           +V P++YG IL +  AAL+G  G+V  AN G +  + EP       DI G+ ++NP
Sbjct: 244 LVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANP 299

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  138 bits (347), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 116/364 (31%), Positives = 184/364 (50%), Gaps = 45/364 (12%)

Query: 23  IGLIPGDGIGKEVIPAGKKILESLNP-KYGLSFKFIDLQAGWETFQNTGKALPDETIDIL 81
           I ++PGD +G+E+     K+L++++  +  + F F +   G      TG  LPDE ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 82  KNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRP----------VKSVDG 128
           K + +  L GAV  P     G   P   ++ +RK L L+AN+RP          +  +  
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 129 TKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQ 188
              +  D V+VRE    +Y    K    E  G  VA   ++ T    + I  +A  +A  
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGERK----EDDGDGVAWDCEQYTVPEVQRITRMAAFMA-- 178

Query: 189 RLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFR 248
            L+      +    K+NVL+ S  L+R+   ET    K+++  ++   Q++DS    + +
Sbjct: 179 -LQHEPPLPIWSLDKANVLASSR-LWRKTVEETI---KNEFPTLKVQHQLIDSAAMILVK 233

Query: 249 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIVIG--EPCHGSAPD 301
            P   + +++  N++GDI+SD A+ + GSLG++PSA++      N   G  EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 302 IAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYLTPDLGGNST 356
           +  K   NP+ATI S A+ML+  L  PE  K I  AV    DA IR G     DLGG+++
Sbjct: 294 LP-KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVKRVLDAGIRTG-----DLGGSNS 347

Query: 357 TQQV 360
           T +V
Sbjct: 348 TTEV 351

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  137 bits (344), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 118/367 (32%), Positives = 184/367 (50%), Gaps = 50/367 (13%)

Query: 23  IGLIPGDGIGKEVIPAGKKILESL--NPKYGLSFKFIDLQAGWETFQNTGKALPDETIDI 80
           I ++PGD +G+E++    K+LE++  +   G+ F+F     G  +   TG  LPDE +D 
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDA 65

Query: 81  LKNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRPVKSVDGTK------- 130
            KN  +  L GAV  P     G   P   ++ +RK L L+AN+RP   V  +        
Sbjct: 66  AKNS-DAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLGLSPLK 123

Query: 131 ---DRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIA--TKNIATIALQI 185
               +  D  +VRE    +Y    K   D+  G+        I E+   T+  A +ALQ 
Sbjct: 124 EEIAKGTDFTVVRELVGGIYFGDRKE--DDGDGSAWDCEKYTIPEVQRITRMAAFLALQ- 180

Query: 186 AQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYR 245
                  +    +    K+NVL+ S  L+R+   ET    K+++  ++   Q++DS    
Sbjct: 181 ------HDPPLPIWSLDKANVLASSR-LWRKTVEETI---KNEFPNLKVQHQLIDSAAMI 230

Query: 246 MFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIVIG--EPCHGS 298
           + + P   + +++  N++GDI+SD A+ + GSLG++PSA++      N   G  EPCHGS
Sbjct: 231 LVKSPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGS 290

Query: 299 APDIAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYLTPDLGG 353
           APD+  KG  NPIATI S A+ML+  L   +    I +AV    DA IR     T DL G
Sbjct: 291 APDLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAGIR-----TADLKG 344

Query: 354 NSTTQQV 360
           +++T +V
Sbjct: 345 SNSTSEV 351

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  135 bits (341), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 122/371 (32%), Positives = 186/371 (50%), Gaps = 47/371 (12%)

Query: 16  SNAKNLTIGLIPGDGIGKEVIPAGKKILESL-NPKYGLSFKFIDLQAGWETFQNTGKALP 74
           S+ KN+T+   PGD IG E++    K+L+++      +SFK+     G      TG+ L 
Sbjct: 2   SSVKNITV--FPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPLT 59

Query: 75  DETIDILKNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRPVKSVDGTK- 130
           DE + + KN  +  L GAV  P     G   P   ++ +RK LG++AN+RP + V  T  
Sbjct: 60  DEALQVAKNS-DAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSETLL 117

Query: 131 -----DRKV----DLVIVRENTEDLYIKLEKSYIDEATG----TRVADATKRITEIATKN 177
                 R++    D VIVRE    +Y    +   D+       +      +RIT +A   
Sbjct: 118 DLSPLKREIVQGTDFVIVRELVGGIYFGERQEAGDDGVAWDKESYSVPEIQRITRMA--- 174

Query: 178 IATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQ 237
            A +ALQ        N    +    K+NVL+ S  L+R+   ET    K+++  +  N  
Sbjct: 175 -AFLALQ-------HNPPLPVWSLDKANVLATSR-LWRKTVEETI---KNEFPTLTINHH 222

Query: 238 IVDSMVYRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIVIG 292
           ++DS    + + P   + VV+  N++GDI+SD A+ + GSLG++PSA++      N  +G
Sbjct: 223 LIDSAAMTLVQNPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALG 282

Query: 293 --EPCHGSAPDIAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAVDANIREGKYLTP 349
             EPCHGSAPD+     +NPIATI S A+M +  L   +    I +AV   I  G   T 
Sbjct: 283 LYEPCHGSAPDLPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTIDAG-IKTG 340

Query: 350 DLGGNSTTQQV 360
           DLGG +TT +V
Sbjct: 341 DLGGKNTTTEV 351

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  135 bits (340), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 119/366 (32%), Positives = 183/366 (50%), Gaps = 49/366 (13%)

Query: 23  IGLIPGDGIGKEVIPAGKKILESL-NPKYGLSFKFIDLQAGWETFQNTGKALPDETIDIL 81
           I ++PGD +G+E+     K+L+++      ++F F     G      TG  LPDE ++  
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEALEAS 65

Query: 82  KNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRPV----KSVDGTKD--- 131
           KN  +  L GAV  P     G   P   ++ +RK LGL+AN+RP     +S+ G      
Sbjct: 66  KN-SDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 132 ---RKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIA--TKNIATIALQIA 186
              +  D ++VRE    +Y    K   DE  G         + E+   T+  A +ALQ  
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRKE--DEGDGVAWDSEQYSVPEVQRITRMAAFLALQ-- 179

Query: 187 QQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRM 246
                 N    +    K+NVL+ S  L+R+   ET    K+++  +    Q++DS    +
Sbjct: 180 -----HNPPLPIWSLDKANVLASSR-LWRKTVEETI---KNEFPTLTVQNQLIDSAAMIL 230

Query: 247 FREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIVIG--EPCHGSA 299
            + P   + +++  N++GDI+SD A+ + GSLG++PSA++      N   G  EPCHGSA
Sbjct: 231 VKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSA 290

Query: 300 PDIAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYLTPDLGGN 354
           PD+  KG  NPIATI S A+ML+  L   +    I +AV    DA IR G     DLGG+
Sbjct: 291 PDLP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAGIRTG-----DLGGS 344

Query: 355 STTQQV 360
           ++T +V
Sbjct: 345 NSTTEV 350

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  133 bits (335), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 118/374 (31%), Positives = 190/374 (50%), Gaps = 49/374 (13%)

Query: 23  IGLIPGDGIGKEVIPAGKKILESLN---PKYGLSFKFIDLQAGWETFQNTGKALPDETID 79
           I ++PGD +G+E+     K+L++++   P+    F++  +  G      TG+ LPD +++
Sbjct: 7   IVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLI--GGAAIDATGEPLPDASLE 64

Query: 80  ILKNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRP----------VKSV 126
             K + +  L GAV  P     G   P   ++ +RK L L+AN+RP          +  +
Sbjct: 65  AAK-KSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPL 122

Query: 127 DGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIA 186
                R  D V+VRE    +Y    K    E TG  VA  +++ +    + I  +A  +A
Sbjct: 123 KPECARGTDFVVVRELVGGIYFGERK----EDTGDGVAWDSEQYSVPEVQRITRMAAFLA 178

Query: 187 QQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRM 246
              L+ +    +    K+NVL+ S  L+R+   ET    K+++  +    Q++DS    +
Sbjct: 179 ---LQHSPPLPVWSLDKANVLASSR-LWRKTVEETI---KNEFPTLTVQHQLIDSAAMIL 231

Query: 247 FREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG----PNIVIG--EPCHGSA 299
            + P   + V++  N++GDI+SD A+ + GSLG++PSA++      N   G  EPCHGSA
Sbjct: 232 VKNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSA 291

Query: 300 PDIAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYLTPDLGGN 354
           PD+  KG  NPIATI S A+ML+  L   E    + +AV    D+ +R     T DL G 
Sbjct: 292 PDLP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVLDSGVR-----TADLKGT 345

Query: 355 STTQQVLEDVLSKL 368
           STT +V E V+  L
Sbjct: 346 STTSEVGEAVVKAL 359

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  135 bits (339), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 119/373 (31%), Positives = 187/373 (50%), Gaps = 39/373 (10%)

Query: 10  SRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNP-KYGLSFKFIDLQAGWETFQN 68
           S  A A   K++ +  +PGD +G+E+     K+L +++  +  ++F F     G      
Sbjct: 79  STTAMAQTTKHIVV--LPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDA 136

Query: 69  TGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRPVK- 124
           TG  LPDE ++  K + +  L GAV  P     G   P   ++ +RK L L+AN+RP   
Sbjct: 137 TGVPLPDEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNF 194

Query: 125 SVDGTKD---------RKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIAT 175
           + D   D         +  D+ IVRE    +Y    K   DE  G         ++E+  
Sbjct: 195 ASDSLLDLSPLKPEIVKGTDICIVRELVGGIYFGERKE--DEGDGVAWDSEKYSVSEV-- 250

Query: 176 KNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYN 235
           + I  +A  +A   L+ N    +    K+NVL+ S  L+R+   ET    K+++  +   
Sbjct: 251 QRITRMAGFLA---LQHNPPLPVWSLDKANVLASSR-LWRKTVEETI---KNEFPTLTVQ 303

Query: 236 EQIVDSMVYRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIV 290
            Q++DS    + + P   + VV+A N++GDI+SD A+ + GSLG++PSA++      N  
Sbjct: 304 HQLIDSAAMILVKNPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTA 363

Query: 291 IG--EPCHGSAPDIAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAVDANIREGKYL 347
            G  EPCHGSAPD+  KG  NP+ATI S A+ML+  L   E    + KAV   +  G   
Sbjct: 364 FGLYEPCHGSAPDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVLDSG-VR 421

Query: 348 TPDLGGNSTTQQV 360
           T DL G+++T +V
Sbjct: 422 TADLRGSNSTSEV 434

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  133 bits (334), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 119/366 (32%), Positives = 185/366 (50%), Gaps = 46/366 (12%)

Query: 22  TIGLIPGDGIGKEVIPAGKKILESLNP--KYGLSFKFIDLQAGWETFQNTGKALPDETID 79
           TI ++PGD +G+E+     K+L ++       ++FKF     G      TG  LPDE ++
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 80  ILKNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRPVK-SVDGTKD---- 131
             K + +  L GAV  P     G   P   ++ +RK L L+AN+RP   + D   D    
Sbjct: 66  ASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 132 -----RKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIA 186
                R  D V+VRE    +Y    K   DE  G  VA  +++ +    + I  +A  +A
Sbjct: 124 KPEIARGTDFVVVRELVGGIYFGERKE--DEGDG--VAWDSEKYSVPEVQRITRMAAFMA 179

Query: 187 QQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRM 246
              L+ N    +    K+NVL+ S  L+R+   ET    K+++  +    Q++DS    +
Sbjct: 180 ---LQHNPPLPIWSLDKANVLASSR-LWRKTVEETI---KNEFPQLTVQHQLIDSAAMIL 232

Query: 247 FREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIVIG--EPCHGSA 299
            + P   + +++  N++GDI+SD A+ + GSLG++PSA++      N   G  EPCHGSA
Sbjct: 233 VKNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSA 292

Query: 300 PDIAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYLTPDLGGN 354
           PD+  KG  NP+ATI S A+ML+  L   E  + I +AV    D+ IR     T DL G 
Sbjct: 293 PDLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSGIR-----TADLKGT 346

Query: 355 STTQQV 360
           ++T +V
Sbjct: 347 NSTTEV 352

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  128 bits (321), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 115/368 (31%), Positives = 181/368 (49%), Gaps = 53/368 (14%)

Query: 23  IGLIPGDGIGKEVIPAGKKILESL-----NPKYGLSFKFIDLQAGWETFQNTGKALPDET 77
           I ++PGD +G+E+     K+L+++     N K+   +  I    G      TG  L DE 
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLI----GGAAIDATGVPLTDEA 62

Query: 78  IDILKNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRP----------VK 124
           ++  K + +  L GAV  P     G   P   ++ +RK L L+AN+RP          + 
Sbjct: 63  LEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLELS 120

Query: 125 SVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQ 184
            +     R  D V+VRE    +Y    K    E  G  VA  +++ T    + I  +A  
Sbjct: 121 PIKPQFARGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAF 176

Query: 185 IAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVY 244
           +A   L+      +    K+NVL+ S  L+R+   ET    K+++  ++   Q++DS   
Sbjct: 177 MA---LQHQPPLPIWSLDKANVLASSR-LWRKTVEETI---KNEFPTLKVQHQLIDSAAM 229

Query: 245 RMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIVIG--EPCHG 297
            + + P   + +++  N++GDI+SD A+ + GSLG++PSA++      N   G  EPCHG
Sbjct: 230 ILVKNPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHG 289

Query: 298 SAPDIAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYLTPDLG 352
           SAPD+  K   NPIATI S A+ML+  L      + I  AV    DA IR G     DLG
Sbjct: 290 SAPDLP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVKKVLDAGIRTG-----DLG 343

Query: 353 GNSTTQQV 360
           G+++T +V
Sbjct: 344 GSNSTIEV 351

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  126 bits (316), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 187/371 (50%), Gaps = 51/371 (13%)

Query: 18  AKNLTIGLIPGDGIGKEVIPAGKKILESLN---PKYGLSFKFIDLQAGWETFQNTGKALP 74
           +KN+ +  +PGD  G+E+     K+LE+++   P+    F F     G      TG  LP
Sbjct: 2   SKNIVV--LPGDHAGQEIAQEAIKVLEAISEVSPEA--KFNFQHHLIGGAAIDATGSPLP 57

Query: 75  DETIDILKNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRP--------- 122
           D+ +   K      L GAV  P     G   P   ++ +RK L L+AN+RP         
Sbjct: 58  DDALAAAKKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLL 115

Query: 123 -VKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATI 181
            +  +     +  D V+VRE    +Y    K   DE  G  VA  +++ T+   + +  +
Sbjct: 116 DLSPLKPQHAKGTDFVVVRELVGGIYFGERKE--DEGDG--VAWDSEKYTKPEVQRLTRM 171

Query: 182 ALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDS 241
           A  +A   L+ N    +    K+NVL+ S  L+R+   ET    K+++  ++ N Q++DS
Sbjct: 172 AAFLA---LQHNPPLPIWSLDKANVLASSR-LWRKTVEETI---KNEFPQLKLNHQLIDS 224

Query: 242 MVYRMFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVGP----NIVIG--EP 294
               + + P   + +V+  NL+GDI+SD A+ + GSLG++PSA++      N   G  EP
Sbjct: 225 AAMILVKSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEP 284

Query: 295 CHGSAPDIAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYLTP 349
           CHGSAPD+  KG  NPIA I S A+ML+  L   +  + + KAV    D+ +R G     
Sbjct: 285 CHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQVLDSGVRTG----- 338

Query: 350 DLGGNSTTQQV 360
           DLGG+++T +V
Sbjct: 339 DLGGSNSTSEV 349

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  124 bits (312), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 112/367 (30%), Positives = 182/367 (49%), Gaps = 50/367 (13%)

Query: 23  IGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ---AGWETFQNTGKALPDETID 79
           I ++PGD +G E+     K+L+++        KF D Q    G       G  L DE ++
Sbjct: 7   IVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKF-DFQYHLIGGAAIDAAGVPLTDEALE 65

Query: 80  ILKNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRP----------VKSV 126
             K + +  L GAV  P     G   P   ++ +RK LGL+AN+RP          +  +
Sbjct: 66  ASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASEPLLGLSPL 123

Query: 127 DGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIA 186
                +  D ++VRE    +Y    K    E  G  VA  +++ +    + I  +A  +A
Sbjct: 124 RPEIAKGTDFMVVRELVGGIYFGERK----EDDGDGVAWDSEKYSVPEVERITRMAAFLA 179

Query: 187 QQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYGGVQYNEQIVDSMVYR 245
              L+ N    +    K+NVL+ S      + R+T EA  K+++  +    Q++DS    
Sbjct: 180 ---LQHNPPLPIWSLDKANVLASS-----RLWRKTVEATIKNEFPTLTVQNQLIDSAAMI 231

Query: 246 MFREPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG----PNIVIG--EPCHGS 298
           + + P   + +++  N++GDI+SD A+ + GSLG++PSA++      N   G  EPCHGS
Sbjct: 232 LVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGS 291

Query: 299 APDIAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYLTPDLGG 353
           APD+  K   NP+ATI S A+ML+  L   +  + + +AV    DA +R G     DLGG
Sbjct: 292 APDLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRRVLDAGVRTG-----DLGG 345

Query: 354 NSTTQQV 360
           +++TQ+V
Sbjct: 346 SNSTQEV 352

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  123 bits (308), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 117/364 (32%), Positives = 182/364 (50%), Gaps = 45/364 (12%)

Query: 23  IGLIPGDGIGKEVIPAGKKILESLNP-KYGLSFKFIDLQAGWETFQNTGKALPDETIDIL 81
           I ++PGD +G+E+     ++L++++  +  + F +     G      TG  LPDE +D  
Sbjct: 7   IVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLPDEALDAA 66

Query: 82  KNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRPVK-SVDGTKD------ 131
           K      L GAV  P     G   P   ++ +RK L L+AN+RP   + D   D      
Sbjct: 67  KKADA-VLLGAVGGPKWGT-GQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 124

Query: 132 ---RKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQ 188
              +  D V+VRE    +Y    K   DE  G  VA  +++ +    + I  +A  +A  
Sbjct: 125 EYAKGTDFVVVRELVGGIYFGERKE--DEGDG--VAWDSEKYSVPEVQRITRMAAFLA-- 178

Query: 189 RLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFR 248
            L+QN    +    K+NVL+ S  L+R+   ET    K+++  +    Q++DS    + +
Sbjct: 179 -LQQNPPLPIWSLDKANVLASSR-LWRKTVEETI---KNEFPTLTVQHQLIDSAAMILVK 233

Query: 249 EPECFD-VVVAPNLYGDILSDGAAALVGSLGVVPSANVG----PNIVIG--EPCHGSAPD 301
            P   + +V+  N++GDI+SD A+ + GSLG++PSA++      N   G  EPCHGSAPD
Sbjct: 234 SPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 302 IAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYLTPDLGGNST 356
           +  K   NPIATI S A+ML+  L   E    + +AV    DA IR     T DL G ++
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRRVLDAGIR-----TADLRGENS 347

Query: 357 TQQV 360
           T +V
Sbjct: 348 TSEV 351

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  113 bits (283), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 113/373 (30%), Positives = 181/373 (48%), Gaps = 56/373 (15%)

Query: 19  KNLTIGLIPGDGIGKEVIPAGKKILESL----NPKYGLSFKFIDLQAGWETFQNTGKALP 74
           KN+ +  +PGD +G EV     KIL+++    N K   +F++  +  G      TG  LP
Sbjct: 5   KNIVV--LPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLI--GGAAIDATGNPLP 60

Query: 75  DETIDILKNQCEGALFGAVQSPTTKVEGYSSP---IVALRKNLGLFANVRPVK-SVDGTK 130
           DE+++  K + +  L GAV  P     G   P   ++ +RK L L+AN+RP   + D   
Sbjct: 61  DESLEASK-RADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLL 118

Query: 131 D---------RKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATI 181
           D         +  D  +VRE    +Y    K    E  G  VA  +++ +    + I  +
Sbjct: 119 DLSPLKEKYAKGTDFTVVRELVGGIYFGKRK----EDDGDGVAWDSEQYSVPEVQRITRM 174

Query: 182 ALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDS 241
           A  +A Q    N    +    K+NVL+ S  L+R+   ET +   +++  ++ + Q++DS
Sbjct: 175 AAFLAMQ---HNPPLPIWSLDKANVLASSR-LWRKTVEETIQ---NEFPSLKVSHQLIDS 227

Query: 242 MVYRMFREPECFD-VVVAPNLYGDILSDGAAALVG--------SLGVVPSANVGPNIVIG 292
               + + P   + +++  N++GDI+SD A+ + G        SL  +P  N    +   
Sbjct: 228 AAMILVKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLY-- 285

Query: 293 EPCHGSAPDIAGKGISNPIATIRSTALMLEF-LGYPEPAKDIHKAV----DANIREGKYL 347
           EPCHGSAPD+  KG  NPI TI S A+ML+  L   E    + +AV    D NIR     
Sbjct: 286 EPCHGSAPDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAVRRVLDNNIR----- 339

Query: 348 TPDLGGNSTTQQV 360
           T DLGG+++T  +
Sbjct: 340 TADLGGSNSTSDI 352

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 133/297 (44%), Gaps = 40/297 (13%)

Query: 100 VEGYSSPIVALRKNLGLFANVRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEAT 159
           V G+  PI+     +G  A+    ++ D   ++   L +V    +    K+ + +  + T
Sbjct: 129 VPGWQKPII-----IGRHAHGDQYRATDAIIEKAGKLELVHRPADGSEPKILQVHEFKGT 183

Query: 160 GTRVADATKRITEIATKNIATIALQIA-QQRLEQNGHATLTVTHKSNVLSQSDGLFREVC 218
           G R        T+ + +  A  + ++A  +RL       L ++ K+ +L Q DG F+++ 
Sbjct: 184 GARGVALAMYNTDESIRGFAHASFKLALSKRL------NLFMSTKNTILKQYDGRFKDIF 237

Query: 219 RETYEA---NKDKYGGVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVG 275
           +E Y      + +  G+ Y  +++D MV +M +    F V+   N  GD+LSD  A   G
Sbjct: 238 QEVYAQEYQTQFRDEGISYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQGFG 296

Query: 276 SLGVVPSANVGPN--IVIGEPCHGSAP-----DIAGKGIS-NPIATIRSTALML----EF 323
           SLG++ S  V P+      E  HG+          GK  S N IA+I + +  L    E 
Sbjct: 297 SLGLMTSMLVTPDGKTFESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWSRGLGKRGEL 356

Query: 324 LGYP---EPAKDIHKAVDANIREGKYLTPDLG---GNS------TTQQVLEDVLSKL 368
            G P   E A+ +  A    +++   +T DL    GN+      TT + L+ V ++L
Sbjct: 357 DGTPDVVEFARKLEAATIETVQQHGIMTKDLALACGNANRDAYVTTNEFLDAVEARL 413

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 68/134 (50%), Gaps = 11/134 (8%)

Query: 171 TEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEAN-KDKY 229
           T  + K  A  + ++A +R        L  T K+ VL + DG F+++ +E YE++ K ++
Sbjct: 188 TRKSIKGFARASFEMALKR-----KMPLFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQF 242

Query: 230 G--GVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 287
              G+ Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P
Sbjct: 243 DEIGILYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVAP 301

Query: 288 N--IVIGEPCHGSA 299
           +      E  HG+ 
Sbjct: 302 DGKTFESEAAHGTV 315

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F+++ +E YEA  K K+   G+ Y  +++D MV +M +    F 
Sbjct: 224 LFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKGGF- 282

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 83/172 (48%), Gaps = 19/172 (11%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKY--GGVQYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F+++ +E ++A  K ++   G+QY  +++D MV +M +    F 
Sbjct: 224 LFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQFEESGIQYQHRLIDDMVAQMIKSKGGF- 282

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGSAPDIAGK------G 306
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+      K       
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRKYQRGEET 342

Query: 307 ISNPIATI----RSTALMLEFLGYPEP---AKDIHKAVDANIREGKYLTPDL 351
            +NPIA+I    R  A   E  G P+    A  +  A    ++E   +T DL
Sbjct: 343 STNPIASIFAWTRGIAKRGELDGTPDVVRFANILESATLNTVQEDGKMTKDL 394

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 58/106 (54%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F+++ +E YEA  K K+   G+ Y  +++D MV +M +    F 
Sbjct: 225 LFLSTKNTILKKYDGRFKDIFQEVYEAEYKSKFEKLGIHYEHRLIDDMVAQMIKSKGGF- 283

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 284 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 189 RLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG--GVQYNEQIVDSMVYR 245
           +L  N    L ++ K+ +L + DG F+++ +E YE++ K ++   G+ Y  +++D MV +
Sbjct: 209 KLAINKKLNLFLSTKNTILKKYDGRFKDIFQEIYESDYKSQFENLGISYEHRLIDDMVAQ 268

Query: 246 MFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 269 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGT 322

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 93/208 (44%), Gaps = 25/208 (12%)

Query: 163 VADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETY 222
           VA A    TE + +  A  + ++A QR        L  T K+ +L + DG F++     Y
Sbjct: 180 VALAMYNTTE-SIRGFARASFELALQR-----KMPLYSTTKNTILKRYDGRFKDEFEAMY 233

Query: 223 EAN-KDKY--GGVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGV 279
           EA  ++++   G+ Y  +++D MV +M +    F V+   N  GD+ SD  A   GSLG+
Sbjct: 234 EAEYRERFERAGIWYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGSLGL 292

Query: 280 VPSANVGPN--IVIGEPCHGSAP-----DIAGKGIS-NPIATIRSTALML----EFLGYP 327
           + S  V P+      E  HG+          GK  S N IA+I +    L       G P
Sbjct: 293 MTSVLVTPDGRAFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLLQRGRLDGTP 352

Query: 328 EP---AKDIHKAVDANIREGKYLTPDLG 352
           E    A+ +  A  A + E   +T DL 
Sbjct: 353 EVEGFARALETATVATVNEDGIMTKDLA 380

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 82/185 (44%), Gaps = 19/185 (10%)

Query: 186 AQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEAN-KDKY--GGVQYNEQIVDSM 242
           A  RL  +    L +  K+ +L Q DG F+++ ++ Y+A  ++ +   G+ Y  +++D M
Sbjct: 204 ASFRLALSKQLNLFLATKNTILKQYDGRFKDLFQQLYDAEYREAFERAGISYEHRLIDDM 263

Query: 243 VYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP--NIVIGEPCHGS-- 298
           V +M +    F V+   N  GD+ SD  A   GSLG++ S  + P  N    E  HG+  
Sbjct: 264 VAQMIKSRGGF-VLALKNYDGDVQSDIVAQGFGSLGLMSSVLITPDGNAFESEAAHGTVT 322

Query: 299 --------APDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIR---EGKYL 347
                     + +   I++  A  R  A   +  G P  A   H    A +R   +   +
Sbjct: 323 RHFRLHQQGKETSTNSIASIFAWTRGLARRADLDGTPAVADFAHALEGATLRTVQDDAIM 382

Query: 348 TPDLG 352
           T DL 
Sbjct: 383 TKDLA 387

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN---KDKYGGVQYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F+++ ++ Y+ +   K K  G+ Y  +++D MV +M +    F 
Sbjct: 208 LFFTTKNTILKKYDGRFKDIFQKMYDEDYKGKFKELGISYEHRLIDDMVAQMIKSKGGF- 266

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  + P+  I   E  HG+
Sbjct: 267 IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLLTPDGKIFESEAAHGT 312

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 90/216 (41%), Gaps = 40/216 (18%)

Query: 100 VEGYSSPIVALRKNLGLFANVRPV------------KSVDGTKDRKVDLVIVRENTEDLY 147
           V G++ PI+  R   G       V            +S DG K + +DL +        Y
Sbjct: 121 VPGWNEPIIVGRHAFGDQYKATDVVIPGEGTLKLVFESKDGDKSKNLDLEVFE------Y 174

Query: 148 IKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVL 207
            K      D      + + T  IT       A  + ++A QR        L  T K+ +L
Sbjct: 175 PK------DGGVAMTMYNTTDSIT-----GFAKSSFELALQR-----KMPLYSTTKNTIL 218

Query: 208 SQSDGLFREVCRETYEAN-KDKY--GGVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGD 264
            + DG F+++    Y A  K+K+   G+ Y  +++D MV +M +    F ++   N  GD
Sbjct: 219 KKYDGKFKDIFEGMYAAEYKEKFEAAGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGD 277

Query: 265 ILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           + SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 278 VQSDIVAQGFGSLGLMTSVLVSPDGKTFESEAAHGT 313

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 95/198 (47%), Gaps = 28/198 (14%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEANKDKY---GGVQYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F+++ +E Y+A   K     G+ Y  +++D MV +M +    F 
Sbjct: 217 LYLSTKNTILKKYDGRFKDIFQELYDAEYKKQFEAAGIYYEHRLIDDMVAQMIKSKGGF- 275

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGSAP-----DIAGKGI 307
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+          GK  
Sbjct: 276 IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQHQQGKET 335

Query: 308 S-NPIATI----RSTALMLEFLGYPEPAK--DIHKAVDAN-IREGKYLTPDL---GGNS- 355
           S N IA+I    R  A   E    P+  +  +I +A   N +++   +T DL   GGN+ 
Sbjct: 336 STNSIASIFAWSRGLAKRGELDNTPQVVRFANILEAATLNTVQQDGIMTKDLALAGGNTD 395

Query: 356 -----TTQQVLEDVLSKL 368
                TT + L+ V ++L
Sbjct: 396 RSAYVTTNEFLDAVEARL 413

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 58/106 (54%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F+++ ++ YEA  K K+   G+ Y  +++D MV +M +    F 
Sbjct: 224 LFLSTKNTILKKYDGRFKDIFQKVYEAQYKSKFEALGIHYEHRLIDDMVAQMIKSKGGF- 282

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 63/131 (48%), Gaps = 11/131 (8%)

Query: 174 ATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG-- 230
           A +  A  + Q+A +R        L  T K+ +L + DG F+ V  + YE   K ++   
Sbjct: 190 AIEGFARSSFQLALER-----QLPLYSTTKNTILKKYDGKFKSVFEDMYEREYKQQFEDL 244

Query: 231 GVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN-- 288
           G+ Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+  
Sbjct: 245 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAPDGK 303

Query: 289 IVIGEPCHGSA 299
               E  HG+ 
Sbjct: 304 TFESEAAHGTV 314

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 69/140 (49%), Gaps = 12/140 (8%)

Query: 186 AQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG--GVQYNEQIVDSM 242
           A  RL       L ++ K+ +L Q DG F++V  E Y+A  K ++   G+ Y  +++D M
Sbjct: 212 ASFRLALAKQLNLFLSTKNTILKQYDGRFKDVFEELYQAQYKAEFERLGIYYEHRLIDDM 271

Query: 243 VYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGSAP 300
           V +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+  
Sbjct: 272 VAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVT 330

Query: 301 -----DIAGKGIS-NPIATI 314
                  AGK  S N IA+I
Sbjct: 331 RHFRQHQAGKETSTNSIASI 350

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 83/185 (44%), Gaps = 19/185 (10%)

Query: 186 AQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEAN-KDKY--GGVQYNEQIVDSM 242
           A  +L  N    L ++ K+ +L + DG F+++ +E ++A  K ++    + Y  +++D M
Sbjct: 207 ASFKLALNKKLNLFLSTKNTILKKYDGRFKDIFQEIFDAEYKTQFEAANISYEHRLIDDM 266

Query: 243 VYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS-- 298
           V +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+  
Sbjct: 267 VAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVT 325

Query: 299 --------APDIAGKGISNPIATIRSTALMLEFLGYPEPAKD---IHKAVDANIREGKYL 347
                     + +   I++  A  R  A   E  G PE  K    +  A    ++E   +
Sbjct: 326 RHYRQYQQGKETSTNSIASIFAWTRGLAKRGELDGTPEVTKFANLLESATLNTVQEDGIM 385

Query: 348 TPDLG 352
           T DL 
Sbjct: 386 TKDLA 390

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 67/133 (50%), Gaps = 11/133 (8%)

Query: 171 TEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEAN-KDKY 229
           T+ + +  A  + Q+A +R        L  T K+ +L + DG+F+++    YE   K+K+
Sbjct: 188 TKESIEGFAKASFQLAVER-----KMPLYSTTKNTILKKYDGMFKDIFEGMYEREYKEKF 242

Query: 230 G--GVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 287
              G+ Y  +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P
Sbjct: 243 EELGIWYEHRLIDDMVAQMLKSSGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITP 301

Query: 288 N--IVIGEPCHGS 298
           +      E  HG+
Sbjct: 302 DGKTFESEAAHGT 314

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 84/173 (48%), Gaps = 19/173 (10%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYGG--VQYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F++V +E +++  KDK+    ++Y  +++D MV +M +    + 
Sbjct: 229 LFLSTKNTILKKYDGRFKDVFQEVFDSTYKDKFEALNIKYEHRLIDDMVAQMIKSKGGY- 287

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGSAP-----DIAGKGI 307
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+          GK  
Sbjct: 288 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRQHQQGKQT 347

Query: 308 S-NPIATI----RSTALMLEFLGYPEP---AKDIHKAVDANIREGKYLTPDLG 352
           S N IA+I    R  A   E    P+    A+ + KA    ++E   +T DL 
Sbjct: 348 STNSIASIFAWSRGLAKRGELDNTPDVMKFAQTLEKATLDTVQEDGIMTKDLA 400

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 64/128 (50%), Gaps = 12/128 (9%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETY-EANKDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F+++  E Y    KD++   G+ Y  +++D MV +M +    F 
Sbjct: 211 LYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLGIFYEHRLIDDMVAQMLKSKGGF- 269

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGSAP-----DIAGKGI 307
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+         AGK  
Sbjct: 270 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQSEAAHGTVTRHYRLHQAGKPT 329

Query: 308 S-NPIATI 314
           S N IA+I
Sbjct: 330 STNSIASI 337

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKY--GGVQYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F++     YEA  K+++   G+ Y  +++D MV +M +    F 
Sbjct: 207 LYSTTKNTILKKYDGKFKDTFESMYEAEYKEQFEAKGIWYEHRLIDDMVAQMLKSKGGF- 265

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 266 IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISPDGKTFESEAAHGT 311

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F+++ +  YEA  K K+   G+ Y  +++D MV +M +    F 
Sbjct: 225 LFLSTKNTILKKYDGRFKDIFQNIYEAQYKPKFEELGIHYEHRLIDDMVAQMVKSKGGF- 283

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 284 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F+++    YE   K K+   G+ Y  +++D MV +M +    F 
Sbjct: 209 LYSTTKNTILKKYDGQFKDIFEGMYEREYKQKFEAVGIWYEHRLIDDMVAQMLKSKGGF- 267

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 268 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFESEAAHGT 313

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKY--GGVQYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG ++++  + YE + KDK+   G+ Y  +++D MV +M +    F 
Sbjct: 212 LYSTTKNTILKKYDGQYKDIFNDMYEKDYKDKFEAKGIWYEHRLIDDMVAQMLKSKGGF- 270

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           V+   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 271 VIAMKNYDGDVQSDVVAQGFGSLGLMSSILISDDGKTFESEAAHGT 316

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 11/130 (8%)

Query: 174 ATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETY-EANKDKYG-- 230
           + K  A  + ++A +R        L  T K+ +L + DG F++V    Y E  K+K+   
Sbjct: 188 SIKGFAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEAL 242

Query: 231 GVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN-- 288
           G+ Y  +++D MV +M +    + ++   N  GD+ SD  A   GSLG++ S  + P+  
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDGK 301

Query: 289 IVIGEPCHGS 298
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F+++ +E ++   K K+   G+ Y  +++D MV +M +    F 
Sbjct: 222 LFLSTKNTILKKYDGRFKDIFQEIFDMEYKTKFANLGISYEHRLIDDMVAQMIKSKGGF- 280

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 281 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 326

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 115/264 (43%), Gaps = 34/264 (12%)

Query: 133 KVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQ 192
           K+ LV   +++    I+L     DE +   VA A     E  T   A  + ++A +R   
Sbjct: 151 KLKLVFESDDSNTENIELSVYDFDEESKGGVAMAMYNTLESIT-GFAHASFKMALER--- 206

Query: 193 NGHATLTVTHKSNVLSQSDGLFREVCRETYEAN-KDKY--GGVQYNEQIVDSMVYRMFRE 249
                L  T K+ +L + DG F++V    YE+  K  +   G+ Y  +++D MV +M + 
Sbjct: 207 --GLPLYSTTKNTILKKYDGKFKDVFESLYESQYKSAFEAKGIWYEHRLIDDMVAQMLKS 264

Query: 250 PECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGSAP-----DI 302
              + ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+         
Sbjct: 265 KGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQ 323

Query: 303 AGKGIS-NPIATIRSTALMLEFLGYPEPAKDIHK-------AVDANIREGKYLTPDLG-- 352
            GK  S N IA+I +    L   G  +   D+ K       A    ++E + +T DL   
Sbjct: 324 QGKETSTNSIASIFAWTRGLIQRGKLDSTPDVVKFAELVESATVNTVQEDEIMTKDLALI 383

Query: 353 -GNS------TTQQVLEDVLSKLD 369
            G +      TT++ +E V  +LD
Sbjct: 384 LGKTDRSSYVTTEEFIEAVHKRLD 407

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 69/141 (48%), Gaps = 12/141 (8%)

Query: 163 VADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETY 222
           VA A    TE  T   A  + ++A +R        L  T K+ +L + DG F+++    Y
Sbjct: 178 VAMAMYNTTESIT-GFAKASFELALER-----KLPLYSTTKNTILKRYDGKFKDIFESMY 231

Query: 223 EAN-KDKYG--GVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGV 279
            ++ +DK+   G+ Y  +++D MV +M +    + ++   N  GD+ SD  A   GSLG+
Sbjct: 232 ASDYQDKFEVIGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGL 290

Query: 280 VPSANVGPN--IVIGEPCHGS 298
           + S  V P+      E  HG+
Sbjct: 291 MSSVLVTPDGKTFESEAAHGT 311

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F++V    Y  N K+K+   G+ Y  +++D MV +M +    + 
Sbjct: 207 LYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESLGIWYEHRLIDDMVAQMLKSKGGY- 265

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 266 IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGKTFESEAAHGT 311

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 68/133 (51%), Gaps = 11/133 (8%)

Query: 171 TEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEAN-KDKY 229
           T+ + +  A  + ++A Q+        L ++ K+ +L + DG F+++ +E Y++  K K+
Sbjct: 197 TDESIRGFAHSSFKLALQK-----KLNLFLSTKNTILKKYDGRFKDIFQEVYDSEYKQKF 251

Query: 230 G--GVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 287
               + Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P
Sbjct: 252 AELNITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILITP 310

Query: 288 N--IVIGEPCHGS 298
           +      E  HG+
Sbjct: 311 DGKTFESEAAHGT 323

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 58/106 (54%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F+++ +E Y++  K ++   G+ Y  +++D MV +M +    F 
Sbjct: 225 LYLSTKNTILKKYDGRFKDIFQEIYDSEYKSEFEKLGIWYEHRLIDDMVAQMIKSKGGF- 283

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 284 ILAFKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKAFESEAAHGT 329

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L   D  F+E+  + ++A  K+K+   G+ Y  +++D MV +M +    F 
Sbjct: 207 LFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITYEHRLIDDMVAQMLKSRGGF- 265

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           +V   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 266 IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFESEAAHGT 311

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 178 IATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEA---NKDKYGGVQY 234
            A  + ++A QR        L  T K+ +L + DG F++V    Y A   ++ +  G+ Y
Sbjct: 192 FARASFELALQR-----RMPLYSTTKNTILKKYDGKFKDVFEAMYAAEYQSRFEELGIWY 246

Query: 235 NEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIG 292
             +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P+      
Sbjct: 247 EHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFES 305

Query: 293 EPCHGS 298
           E  HG+
Sbjct: 306 EAAHGT 311

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%), Gaps = 6/107 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETY-EANKDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L Q DG F+++  E Y +  +DK+    + Y  +++D MV +M +    F 
Sbjct: 213 LYSTTKNTILKQYDGKFKDIFEEMYAKEYEDKFKVLNIWYEHRLIDDMVAQMLKSKGGF- 271

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGSA 299
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+ 
Sbjct: 272 IIAMKNYDGDVESDVVAQGFGSLGLMTSVLLTPDGSSFESEAAHGTV 318

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETY-EANKDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F++V    Y E+ K+K+   G+ Y  +++D MV +M +    + 
Sbjct: 207 LYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESLGIWYEHRLIDDMVAQMLKSKGGY- 265

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 266 IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 311

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 69/151 (45%), Gaps = 22/151 (14%)

Query: 156 DEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFR 215
           D   G  + + T+ IT       A  + ++A +R        L  T K+ +L + DG F+
Sbjct: 174 DGGVGMAMYNTTESIT-----GFAKASFELALER-----KLPLYSTTKNTILKKYDGKFK 223

Query: 216 EVCRETYEANKDKYG------GVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDG 269
           +V  + Y    D+Y       G+ Y  +++D MV +M +    F ++   N  GD+ SD 
Sbjct: 224 DVFEQMY---ADQYQSRFEELGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDI 279

Query: 270 AAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
            A   GSLG++ S  V P+      E  HG+
Sbjct: 280 VAQGFGSLGLMTSVLVTPDGKTFESEAAHGT 310

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 8/90 (8%)

Query: 211 DGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGA 270
           DGLF E  RE ++A      G++Y  +++D MV +M +    F ++   N  GD+ SD  
Sbjct: 228 DGLFNEKYREKFQA-----LGIKYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIV 281

Query: 271 AALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           A   GSLG++ S  V P+      E  HG+
Sbjct: 282 AQGFGSLGLMTSILVTPDGKTFESEAAHGT 311

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 81/174 (46%), Gaps = 17/174 (9%)

Query: 171 TEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEAN-KDKY 229
           T+ + +  A  + Q+A      N    L +  K+ +L + DG F+++ ++ Y    K K+
Sbjct: 197 TDESIEGFAHSSFQVAL-----NKKLNLFLATKNTILKKYDGRFKDIFQQIYNGQYKAKF 251

Query: 230 G--GVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 287
              G+ Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  V P
Sbjct: 252 EQLGITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSP 310

Query: 288 N--IVIGEPCHGSAP------DIAGKGISNPIATIRSTALMLEFLGYPEPAKDI 333
           +      E  HG+         +  +  +N IA+I + +  L   G  +  KD+
Sbjct: 311 DGKTFESEAAHGTVTRHFRRHQMGEETSTNSIASIFAWSRGLAKRGELDGTKDV 364

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 12/109 (11%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEANKDKYG------GVQYNEQIVDSMVYRMFREPE 251
           L    K+ +L + DGLF+++  + Y   KD Y       G+ +  +++D MV +M +   
Sbjct: 210 LFFATKNTILKEYDGLFKDIFEKLY---KDHYKTKFEELGITFEHRLIDDMVAQMLKSNG 266

Query: 252 CFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
            F ++   N  GD+ SD  A   GSLG++ S  V P+  +   E  HG+
Sbjct: 267 GF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDSVFESEAAHGT 314

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 6/107 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L Q DG F+++ +  YE   K+ +   G+ Y  +++D MV +M +    F 
Sbjct: 205 LYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEELGIWYEHRLIDDMVAQMLKSKGGF- 263

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGSA 299
           ++   N  GD+ SD  A   GSLG++ S  +  +      E  HG+ 
Sbjct: 264 IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGKTFESEAAHGTV 310

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L + DG F+++ +  YE + K K+    + Y  +++D MV +M +    F 
Sbjct: 224 LFLSTKNTILKKYDGRFKDIFQSIYETHYKAKFQQLNINYEHRLIDDMVAQMIKSKGGF- 282

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  V P+      E  HG+
Sbjct: 283 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 61/118 (51%), Gaps = 6/118 (5%)

Query: 186 AQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEAN-KDKY--GGVQYNEQIVDSM 242
           A  +L  +    L ++ K+ +L + DG F+++ +E Y+   K ++   G+ Y  +++D M
Sbjct: 206 ASFKLALDKKLNLYLSTKNTILKKYDGRFKDIFQELYDTQYKAEFEKAGIFYEHRLIDDM 265

Query: 243 VYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           V +M +    F ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 266 VAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 322

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 70/144 (48%), Gaps = 12/144 (8%)

Query: 160 GTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCR 219
           G  VA A    TE + +  A  + ++A +R +      L  T K+ +L + DG F+++  
Sbjct: 176 GGGVAMAMYNTTE-SIEGFAKASFELALERKQ-----PLYSTTKNTILKKYDGKFKDIFE 229

Query: 220 ETYEA---NKDKYGGVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGS 276
             YE    ++ +  G+ Y  +++D MV +M +    + ++   N  GD+ SD  A   GS
Sbjct: 230 AMYEKEYRSQFEKLGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQGFGS 288

Query: 277 LGVVPSANVGPN--IVIGEPCHGS 298
           LG++ S  V P+      E  HG+
Sbjct: 289 LGLMTSVLVTPDGKTFESEAAHGT 312

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETY-EANKDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F++V    Y  + K+K+   G+ Y  +++D MV +M +    + 
Sbjct: 207 LYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESLGIWYEHRLIDDMVAQMLKSKGGY- 265

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+
Sbjct: 266 IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 311

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 55/107 (51%), Gaps = 6/107 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKYG--GVQYNEQIVDSMVYRMFREPECFD 254
           L +  K+ +L + DG F+ +  + Y+   K+K+   G+ Y  +++D MV +M +    F 
Sbjct: 210 LFLATKNTILKKYDGRFKSIFDDMYQNEFKEKFEKLGLTYEHRLIDDMVAQMLKSKGGF- 268

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGSA 299
           ++   N  GD+ SD  A   GSLG++ S  + P+      E  HG+ 
Sbjct: 269 IIAMKNYDGDVQSDIVAQGFGSLGLMTSQLITPDGKTFQSEAAHGTV 315

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 65/133 (48%), Gaps = 11/133 (8%)

Query: 171 TEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEAN-KDKY 229
           T  + K  A  + ++A +R        L  T K+ +L   D  F+++  + ++A  K+++
Sbjct: 185 TNDSIKGFAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQF 239

Query: 230 G--GVQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 287
              G+ Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P
Sbjct: 240 QALGITYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITP 298

Query: 288 N--IVIGEPCHGS 298
           +      E  HG+
Sbjct: 299 DGKTFESEAAHGT 311

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 31/50 (62%)

Query: 319 LMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368
           LML  LG  E A  I KAV   I EGK+ T D+GG+S+T     ++++KL
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEAN-KDKY--GGVQYNEQIVDSMVYRMFREPECFD 254
           L ++ K+ +L   DG F+++ +E Y+   K ++   G+ Y  +++D MV +M +    F 
Sbjct: 220 LFLSTKNTILKTYDGRFKDIFQELYDTQYKTEFENHGIYYEHRLIDDMVAQMIKSKGGF- 278

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S    P+      E  HG+
Sbjct: 279 IMALKNYDGDVQSDIVAQGFGSLGLMTSILATPDGKTFESEAAHGT 324

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 55/114 (48%), Gaps = 6/114 (5%)

Query: 190 LEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYG---GVQYNEQIVDSMVYRM 246
           L  N +  L +  K+ +L + DG F+++ +E YE    K      + Y  +++D MV +M
Sbjct: 214 LAVNKNMNLFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQM 273

Query: 247 FREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
            +    + ++   N  GD+ SD  A   GSLG++ S    P+      E  HG+
Sbjct: 274 IKSKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILASPDGKTFESEAAHGT 326

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 6/106 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETY-EANKDKYGG--VQYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F+++    Y E  ++K+    + Y  +++D MV +M +    F 
Sbjct: 218 LYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKALNIWYEHRLIDDMVAQMLKSKGGF- 276

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGS 298
           ++   N  GD+ SD  A   GSLG++ S  +  +      E  HG+
Sbjct: 277 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFESEAAHGT 322

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 63/133 (47%), Gaps = 11/133 (8%)

Query: 171 TEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEAN-KDKY 229
           T  + K  A  + ++A +R        L  T K+ +L   D  F+++    ++   K+K+
Sbjct: 185 TNDSIKGFAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKF 239

Query: 230 GGVQ--YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGP 287
             ++  Y  +++D MV +M +    F ++   N  GD+ SD  A   GSLG++ S  + P
Sbjct: 240 QALKITYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITP 298

Query: 288 N--IVIGEPCHGS 298
           +      E  HG+
Sbjct: 299 DGKTFESEAAHGT 311

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 6/107 (5%)

Query: 198 LTVTHKSNVLSQSDGLFREVCRETYEANKDKYG---GVQYNEQIVDSMVYRMFREPECFD 254
           L  T K+ +L + DG F+++    YE    +     G+ Y  +++D MV +M +    F 
Sbjct: 215 LYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELGIWYEHRLIDDMVAQMLKSKGGF- 273

Query: 255 VVVAPNLYGDILSDGAAALVGSLGVVPSANVGPN--IVIGEPCHGSA 299
           ++   N  GD+ SD  A   GSLG++ S  +  +      E  HG+ 
Sbjct: 274 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGKSFESEAAHGTV 320

>Smik_7.301 Chr7 (506286..508148) [1863 bp, 620 aa] {ON} YGR013W
           (REAL)
          Length = 620

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 47/114 (41%), Gaps = 11/114 (9%)

Query: 57  IDLQAGWETFQNTGKALPDETIDILKNQCEGALFGAVQS-PTTKVEGYSSPIVALRKNLG 115
           +D Q    + Q    +   E I++L + C        QS PT KVE +SS   +  +   
Sbjct: 110 LDQQIHTISLQGVSSSFSHEQIELLLDNCLSLALAETQSSPTLKVEAWSS-FSSFLETQD 168

Query: 116 LFANVRPVKS----VDGTKDRKVDLVIVRENTEDLYIKLE-----KSYIDEATG 160
           +F     V +    V   K       ++REN ED  ++L      + YI + TG
Sbjct: 169 IFLRFSKVDNDEAFVRVLKYWTALFTLIRENHEDFKVELHLDLNTQEYIKDRTG 222

>CAGL0D01034g Chr4 complement(121908..122993) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P41940 Saccharomyces
           cerevisiae YDL055c PSA1 mannose-1-phosphate
           guanyltransferase
          Length = 361

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 260 NLYGDILSDGAAALVGSLGVVPSANVGPNIVIGE 293
           N+ G+++ D +A +  S  V P   +GPN+ IGE
Sbjct: 250 NIVGNVMVDPSAKIAASAKVGPDVVIGPNVTIGE 283

>AFR599W Chr6 (1516363..1517448) [1086 bp, 361 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL055C (PSA1)
          Length = 361

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 260 NLYGDILSDGAAALVGSLGVVPSANVGPNIVIGE 293
           N+ G+++ D +A + GS  + P   +GPN+ IGE
Sbjct: 250 NIVGNVIIDPSAKISGSAKLGPDVVIGPNVTIGE 283

>SAKL0E13992g Chr5 complement(1152751..1154052) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P80210 Saccharomyces
           cerevisiae YNL220W ADE12 Adenylosuccinate synthase
           catalyzes the first committed step in the 'de novo'
           biosynthesis of adenosine
          Length = 433

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 53/133 (39%), Gaps = 15/133 (11%)

Query: 176 KNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYN 235
           KNI T    I      ++  + L V H  N   ++   F    +   E  + +YG   YN
Sbjct: 129 KNIGTTGKGIGPTYATKSSRSGLRVHHLVNDEPEAWDEFVTKYKRLVETRQQRYGPFDYN 188

Query: 236 --EQIVDSMVYRMFREPECFDVVV----APNLYGDILSDGAAALV-----GSLGVVPSAN 284
             E++     YR   +P   D VV    A      IL +GA AL+     G+   V S+N
Sbjct: 189 VEEELARYKQYREQLKPFVVDSVVFMHKAIQEKKKILVEGANALMLDIDFGTYPYVTSSN 248

Query: 285 VGPNIVIGEPCHG 297
            G    IG  C G
Sbjct: 249 TG----IGGVCTG 257

>TBLA0A08130 Chr1 complement(2009133..2010218) [1086 bp, 361 aa]
           {ON} Anc_4.231 YDL055C
          Length = 361

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 21/34 (61%)

Query: 260 NLYGDILSDGAAALVGSLGVVPSANVGPNIVIGE 293
           N+ G +L D  A +  +  + P+  +GPN++IG+
Sbjct: 250 NVVGSVLVDSTAKIASTAKIGPNVTIGPNVIIGD 283

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,466,765
Number of extensions: 1633843
Number of successful extensions: 4577
Number of sequences better than 10.0: 151
Number of HSP's gapped: 4357
Number of HSP's successfully gapped: 151
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)