Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E08317g2.288ON92192147790.0
NDAI0G006702.288ON96890125340.0
Skud_14.3062.288ON97090024740.0
SAKL0E07634g2.288ON97489124660.0
Suva_14.3242.288ON96890024640.0
YNL023C (FAP1)2.288ON96589924640.0
KAFR0H033002.288ON96689924460.0
ZYRO0A01936g2.288ON95389324270.0
NCAS0G037802.288ON95789624130.0
Smik_14.3082.288ON96590024130.0
KNAG0H019902.288ON97390423930.0
KLTH0G10406g2.288ON96388723910.0
TDEL0G021902.288ON93689523630.0
CAGL0M06919g2.288ON95690023400.0
TBLA0B059502.288ON99589923410.0
Kpol_1039.452.288ON96889823130.0
Ecym_33272.288ON92689223030.0
Kwal_27.115182.288ON95388622960.0
ADL213W2.288ON90889022320.0
TPHA0D015302.288ON96290622310.0
Ecym_74563.330ON1090126762.2
TBLA0B095402.323ON27445742.8
KAFR0D006401.71ON234127707.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08317g
         (921 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...  1845   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...   980   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...   957   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...   954   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...   953   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...   953   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...   946   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...   939   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...   934   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...   934   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...   926   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...   925   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...   914   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...   905   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...   906   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...   895   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   891   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...   889   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   864   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...   863   0.0  
Ecym_7456 Chr7 complement(935231..938503) [3273 bp, 1090 aa] {ON...    34   2.2  
TBLA0B09540 Chr2 (2264713..2265536) [824 bp, 274.666666666667 aa...    33   2.8  
KAFR0D00640 Chr4 (107585..108289) [705 bp, 234 aa] {ON} Anc_1.71...    32   7.1  

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score = 1845 bits (4779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 908/921 (98%), Positives = 908/921 (98%)

Query: 1   MTAEELIYPESEPRLYXXXXXXXXXXXXXTNIPYYEQTVKEIKDGDQYVCMICTVELDST 60
           MTAEELIYPESEPRLY             TNIPYYEQTVKEIKDGDQYVCMICTVELDST
Sbjct: 1   MTAEELIYPESEPRLYSSDSDFDSDNDEDTNIPYYEQTVKEIKDGDQYVCMICTVELDST 60

Query: 61  CRMYACDSCYRVFDYECVREWALKSTNKTLDKSWKCPNCYKINHKIPKQKRSTCWCGKVV 120
           CRMYACDSCYRVFDYECVREWALKSTNKTLDKSWKCPNCYKINHKIPKQKRSTCWCGKVV
Sbjct: 61  CRMYACDSCYRVFDYECVREWALKSTNKTLDKSWKCPNCYKINHKIPKQKRSTCWCGKVV 120

Query: 121 NPDVNELDPNSCGQTCNAYSCVHGCSKVCHLGPHPECLIPVQIKCKCGKHCKQIPCSRSK 180
           NPDVNELDPNSCGQTCNAYSCVHGCSKVCHLGPHPECLIPVQIKCKCGKHCKQIPCSRSK
Sbjct: 121 NPDVNELDPNSCGQTCNAYSCVHGCSKVCHLGPHPECLIPVQIKCKCGKHCKQIPCSRSK 180

Query: 181 VLGNSYNCGDVCGLLLPCGKHTCQKTCHTGFCGPCESIIKTELPCYCGSDVKSGIQCSDL 240
           VLGNSYNCGDVCGLLLPCGKHTCQKTCHTGFCGPCESIIKTELPCYCGSDVKSGIQCSDL
Sbjct: 181 VLGNSYNCGDVCGLLLPCGKHTCQKTCHTGFCGPCESIIKTELPCYCGSDVKSGIQCSDL 240

Query: 241 RVLDYSKDVSGKKWIGVYSCGEVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKT 300
           RVLDYSKDVSGKKWIGVYSCGEVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKT
Sbjct: 241 RVLDYSKDVSGKKWIGVYSCGEVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKT 300

Query: 301 CPCGKTMLKELDKPRRKCTDTIPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTP 360
           CPCGKTMLKELDKPRRKCTDTIPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTP
Sbjct: 301 CPCGKTMLKELDKPRRKCTDTIPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTP 360

Query: 361 CTCHSKTFLTPCQLHDTPRCNIKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLN 420
           CTCHSKTFLTPCQLHDTPRCNIKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLN
Sbjct: 361 CTCHSKTFLTPCQLHDTPRCNIKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLN 420

Query: 421 NETLVEPEHVCLKQCNLKLSCGIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVR 480
           NETLVEPEHVCLKQCNLKLSCGIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVR
Sbjct: 421 NETLVEPEHVCLKQCNLKLSCGIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVR 480

Query: 481 CGTKLPPCPNPCIKISEGPAPCGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTL 540
           CGTKLPPCPNPCIKISEGPAPCGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTL
Sbjct: 481 CGTKLPPCPNPCIKISEGPAPCGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTL 540

Query: 541 CLVPDSQVACGTECGLPLATCHHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHG 600
           CLVPDSQVACGTECGLPLATCHHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHG
Sbjct: 541 CLVPDSQVACGTECGLPLATCHHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHG 600

Query: 601 NSPCPEKVCHEKVVITCDCNRRTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELME 660
           NSPCPEKVCHEKVVITCDCNRRTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELME
Sbjct: 601 NSPCPEKVCHEKVVITCDCNRRTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELME 660

Query: 661 AFGMNEKPKNTKEQLESIVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIED 720
           AFGMNEKPKNTKEQLESIVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIED
Sbjct: 661 AFGMNEKPKNTKEQLESIVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIED 720

Query: 721 TQKLSLHLKPMRVPQRQFIKELASAYALYSESQDREPNRSVYLKKIQSQSKKPELTLKDA 780
           TQKLSLHLKPMRVPQRQFIKELASAYALYSESQDREPNRSVYLKKIQSQSKKPELTLKDA
Sbjct: 721 TQKLSLHLKPMRVPQRQFIKELASAYALYSESQDREPNRSVYLKKIQSQSKKPELTLKDA 780

Query: 781 SELYQLFKTLEKERMQEHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDN 840
           SELYQLFKTLEKERMQEHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDN
Sbjct: 781 SELYQLFKTLEKERMQEHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDN 840

Query: 841 IEPLVHDFLKYTLVKTPQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQ 900
           IEPLVHDFLKYTLVKTPQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQ
Sbjct: 841 IEPLVHDFLKYTLVKTPQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQ 900

Query: 901 MLATGVEMCQVDENLSLVSQA 921
           MLATGVEMCQVDENLSLVSQA
Sbjct: 901 MLATGVEMCQVDENLSLVSQA 921

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score =  980 bits (2534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/901 (52%), Positives = 612/901 (67%), Gaps = 18/901 (1%)

Query: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90
           ++ YYE+T++EI  GD YVCMICTVE+D TC+MYAC  CYRVFDY+C+REWA+KST KT+
Sbjct: 57  DMKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTV 116

Query: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150
           D+ WKCPNCY +N K+P + RSTCWCGKVVNP+ N L+PNSCGQTCNA  CVHGC+ +CH
Sbjct: 117 DRIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICH 176

Query: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVL-GNS-YNCGDVCGLLLPCGKHTCQKTCH 208
           LGPHPEC   + I C+CGKH K I C +SK   GNS + C D CGL L CG H C++ CH
Sbjct: 177 LGPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCH 236

Query: 209 TGFCGPCESIIKTE------LPCYCGSDVKSGIQCSDLRVLD---YSKDVSGKKWIGVYS 259
           +G CG C   ++        L CYCGS+ +  ++C D+++ +   YS D  G KWIGV++
Sbjct: 237 SGLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWIGVFA 296

Query: 260 CGEVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCT 319
           C E+RT+ Y CD H+++E+C+AP  +   +PCP+SPK LKTCPCGKT L++L KPR  CT
Sbjct: 297 CKEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPRTLCT 356

Query: 320 DTIPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPR 379
           D IPTC + C K L CGKH CPF CHTG CMDPCL I    C+C  ++FL PCQ   +P 
Sbjct: 357 DPIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFTGSPH 416

Query: 380 CNIKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKL 439
           CNIKCES MSCRRH+C+E CCSG+PAA+KR+KTLF  +DL +ETLVE EH+CLK+CNL L
Sbjct: 417 CNIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKECNLLL 476

Query: 440 SCGIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGP 499
           SCGIH C  KCHPGKCPPCLESD NDLVCPCGKT+V APVRCGTKLPPCP  CIK+    
Sbjct: 477 SCGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKVVRNE 536

Query: 500 APCGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLA 559
            PCGH   PH CHP    CPPCTA V K C+C K  ++RTLC   D  V+CG  CGLPL 
Sbjct: 537 YPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQND--VSCGKICGLPLK 594

Query: 560 TCHHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDC 619
            C HKC K+CH+ G+C+ KC + CG +R  C H C   CHGN+ CP+  C     +TC+C
Sbjct: 595 DCPHKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTCEC 654

Query: 620 NRRTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTK----EQL 675
            RR   V CGA  +  S   T  L CDEEC  L+RH +L EAFG+ E   ++     E+L
Sbjct: 655 GRRETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFERL 714

Query: 676 ESIVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQ 735
           + IV  A  F++L +P++E  L+++ +Q  WC QI  + +KF++D  + SLH KPMR PQ
Sbjct: 715 KDIVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRPPQ 774

Query: 736 RQFIKELASAYALYSESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKERM 795
           R FI EL+ AY LY ESQD EP RSV++KK  + S KP  +L     LYQ FK LEKER 
Sbjct: 775 RHFIHELSKAYNLYCESQDPEPKRSVFIKK-NTTSSKPSFSLSKVLPLYQTFKELEKERK 833

Query: 796 QEHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVK 855
            + +  + +K L+N+   E P        N  +I  +   + ++++E +   +LK TL+K
Sbjct: 834 LQEFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKSTLIK 893

Query: 856 TPQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENL 915
            PQY  L+D  S +I+PE+Y  IT N   D + ++       +D  ++ GVE+C++D+ L
Sbjct: 894 NPQYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKIDDVL 953

Query: 916 S 916
           S
Sbjct: 954 S 954

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/900 (51%), Positives = 601/900 (66%), Gaps = 16/900 (1%)

Query: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90
           ++ YYE+ ++EI  GD Y+CMICTVE+D TC+M+AC  CYRVFDY C+REWALKST KT+
Sbjct: 54  DLQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTV 113

Query: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150
           DK WKCPNCY +  K+P + R TCWCG VVNPD N+LDPNSCGQTCNA +CVHGC K+CH
Sbjct: 114 DKIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICH 173

Query: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210
           LGPHPEC   V+IKC CG+H K I C +SK +   +NC + CGL L CG H C+K CH+G
Sbjct: 174 LGPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHSG 233

Query: 211 FCGPCESII------KTELPCYCGSDVKSGIQCSDLRVLDY---SKDVSGKKWIGVYSCG 261
            CG C   I      K ++ CYCG+ +++ I+CS+ R       SKD SG +W GV++C 
Sbjct: 234 LCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFACA 293

Query: 262 EVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDT 321
           ++RT+ Y+C  H+++E CL+P  I   + CPF P  LKTCPCG+T L+EL KPR+ C D 
Sbjct: 294 DIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHDP 353

Query: 322 IPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCN 381
           IPTC++ C K L CGKH CPF+CH G CMDPCL I    C+C   TF  PC   ++PRCN
Sbjct: 354 IPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRCN 413

Query: 382 IKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSC 441
           IKCES MSCRRH+C++ CCSG+P+A +R+K+ F  +DL +E+LVE +H+CLK CNL LSC
Sbjct: 414 IKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLSC 473

Query: 442 GIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAP 501
           G+H C  KCHPGKCPPCLESD NDL+C CGKTVVPAPVRCGTKLP C +PCIK+  G + 
Sbjct: 474 GLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGESW 533

Query: 502 CGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATC 561
           CGH+  PH CHP+   CPPCT  V K CRC KK  +RT+C   D  V+CGT CG+PL+ C
Sbjct: 534 CGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQAD--VSCGTSCGIPLSGC 591

Query: 562 HHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNR 621
           +H CQK CH+ G+C+  C + CG KR  C H C + CHG + CP+  C   V ITC+C R
Sbjct: 592 YHTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGR 651

Query: 622 RTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKP----KNTKEQLES 677
             K + C A  DT S   +  L C+EEC  L+R  EL EAFG++E P    +N  + L  
Sbjct: 652 IKKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSE 711

Query: 678 IVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQ 737
           +V VAK F++L +P++E  L+VY KQ  WC QI  + +K ++   + SLH KPMR PQR 
Sbjct: 712 LVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRH 771

Query: 738 FIKELASAYALYSESQDREPNRSVYLKKIQS-QSKKPELTLKDASELYQLFKTLEKERMQ 796
           FI E+A AY LY+ESQDREP RSV++KK  +  SKKP L+L +A  LY+ FK  +KER  
Sbjct: 772 FIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKL 831

Query: 797 EHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856
           + +  + T  LIN    +          N  ++  +   + +++++      LK+TLV  
Sbjct: 832 QEFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVAN 891

Query: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLS 916
           PQY  L D  S LI+PENY   + NT  DME ++       ++  LA  + +C VDE + 
Sbjct: 892 PQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEIG 951

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/891 (52%), Positives = 608/891 (68%), Gaps = 9/891 (1%)

Query: 32  IPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLD 91
           +PYYE+T+ EI+ GD Y CMICT+E+D TC MYAC  CYRV+D+EC+REWALKS+ K+LD
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 92  KSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHL 151
           K+WKCPNCY +N +IP + R TCWCGKVV+P+ N +DPNSCGQTCNA  C HGCSK CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 152 GPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTGF 211
           GPHPEC+   ++KC CGKH K + C +S+    SY CG+ C LLLPCG H CQ+ CH+G 
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227

Query: 212 CGPCESIIKTELPCYCGSDVKSGIQCSDLRVLDYSKDVSGKKWIGVYSCGEVRTLHYSCD 271
           CG CE  I  ++ CYCG + +  I C D++ +  SK+ SG+ WIGV+SC  +R++ YSC 
Sbjct: 228 CGNCEETISGKIMCYCGMETREQIICKDVKSVAKSKNKSGEIWIGVFSCAHLRSVEYSCG 287

Query: 272 HHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTCSNVCGK 331
           HH++ E C AP        CPFSP+ LKTCPCG T LK L+ PR+KCTD IPTC N C K
Sbjct: 288 HHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNK 347

Query: 332 QLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCESNMSCR 391
            L CGKH+CPF CH G CMDPC+ + K  C+CHSK+FL PCQ HD   CN KCES MSCR
Sbjct: 348 PLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCR 407

Query: 392 RHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCGIHDCTWKCH 451
           RH+C E CCSG+  A KREKT+FL RD  +E+LVE +H+CLK CNLKLSCGIH C  KCH
Sbjct: 408 RHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCH 467

Query: 452 PGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHRVGPHKC 511
           PGKC PCLESD NDL CPCGKTVVPAPVRCGTKLPPC +PCIK  +    CGH   PH+C
Sbjct: 468 PGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHEC 527

Query: 512 HPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKCQKKCHV 571
           H     CP CTA + KKC+C K   +RTLC   D  V+CG  CGLPL  C H C++ CH 
Sbjct: 528 HSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQND--VSCGKICGLPLKNCSHTCKRTCHE 585

Query: 572 EGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTKQVECGAT 631
            G+C+  C + CGL R  C H C  +CH    CP++ C  KV +TC C R+   + C A 
Sbjct: 586 PGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAH 645

Query: 632 HDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQLESIVLVAKKFDDLNMP 691
            D  S      LPCD++C + +RH  LMEAFG+ EK     E+L  +V  AK FD+L++P
Sbjct: 646 ADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAPVEELRDLVESAKSFDELHLP 705

Query: 692 YSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKELASAYALYSE 751
           ++E  L+VY KQ  WC+QI +   K + D  + SLH KPM++PQR+FI ELA+AYALYSE
Sbjct: 706 FTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSE 765

Query: 752 SQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKERMQEHYSTKVTKTLINIP 811
           SQDREP RSV++KK++++S  P L L +A  LY  FK L+KER  +      T+ L N  
Sbjct: 766 SQDREPKRSVFVKKVENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYT 825

Query: 812 ---ASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRFLKDLNSV 868
              A++ P  A +   N  ++ GV      D +   + ++L++TL++ P Y+ L++    
Sbjct: 826 VDDANDVPHNAEF---NCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLEN-GDF 881

Query: 869 LIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLSLVS 919
           LI+PE++  I++N  +D++++ P+I +  +++ ++ GV++ ++DENL   +
Sbjct: 882 LIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFT 932

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score =  953 bits (2464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/900 (51%), Positives = 600/900 (66%), Gaps = 16/900 (1%)

Query: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90
           ++ YYE+ ++EI  GD Y+CMICTVE+D TC+M+AC  CYRVFDY C+REWALKST KT+
Sbjct: 53  DMQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTV 112

Query: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150
           DK WKCPNCY I  K+P + R TCWCGKVVNPD N LDPNSCGQTCNA +CVHGCSK+CH
Sbjct: 113 DKIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKICH 172

Query: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210
           LGPHPEC   V+IKC+CGKH K I C +SK +   ++C + CGL L CG H C+K CH+G
Sbjct: 173 LGPHPECTRTVEIKCRCGKHSKSIFCYQSKAMKKHFDCQEECGLPLSCGIHKCKKKCHSG 232

Query: 211 FCGPCESIIKTE------LPCYCGSDVKSGIQCSDL---RVLDYSKDVSGKKWIGVYSCG 261
            CGPC  +I +E      + CYCG   K  I+C ++   +    SKD SG +WIGV++C 
Sbjct: 233 LCGPCPELIMSEDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGVFACK 292

Query: 262 EVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDT 321
           ++RT+ Y+C  H+++E C++P  ++  + CPF P  LKTCPCG+T L+EL KPR+ CTD 
Sbjct: 293 DIRTVDYACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKHCTDP 352

Query: 322 IPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCN 381
           IPTCS+ C K L CGKH+CPF CH G CMDPCL      C C   TFL PC   + P CN
Sbjct: 353 IPTCSSRCSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEKPHCN 412

Query: 382 IKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSC 441
           IKCES MSCRRH+C++ CCSG+P+A +R+K +F  +DL +E+LVE +H+CLK CNL LSC
Sbjct: 413 IKCESLMSCRRHRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCNLTLSC 472

Query: 442 GIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAP 501
           GIH C  KCHPGKCPPCLESD NDLVCPCGKTV+PAPVRCGTKLP C   CIK+  G + 
Sbjct: 473 GIHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVRGESE 532

Query: 502 CGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATC 561
           CGH+  PH CHP    CPPCT  V K C+C KK  +RT+C   D  V+CGT CG PL+ C
Sbjct: 533 CGHKPMPHTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTD--VSCGTTCGKPLSGC 590

Query: 562 HHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNR 621
           HH CQK CH+   C+  C + C  KR  C H C + CHG S CP+  C   V ITC C R
Sbjct: 591 HHTCQKTCHLPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKCGR 650

Query: 622 RTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGM----NEKPKNTKEQLES 677
             K+V CGA  +  S +E  +L C+EEC  L+R  EL EAFG+    NE   N  + L+ 
Sbjct: 651 IEKKVACGAKSNVVSVTEAPQLDCNEECEALKRLKELREAFGISEESNESTNNELDTLKK 710

Query: 678 IVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQ 737
           +V VA  F++L +P++E VL+VY KQ  WC QI  + +K + D  + SLH KPMR PQR 
Sbjct: 711 LVSVATTFEELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRH 770

Query: 738 FIKELASAYALYSESQDREPNRSVYLKK-IQSQSKKPELTLKDASELYQLFKTLEKERMQ 796
           FI+ELA AY LYSESQDREP RSV++KK   S+S +P L+L +A  LY+ FK L+KER  
Sbjct: 771 FIRELAKAYNLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKI 830

Query: 797 EHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856
           + +  + T  LIN    +          N  ++  + + + +D++       LK+TLV  
Sbjct: 831 QEFQARTTAKLINFEVRDAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLVVK 890

Query: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLS 916
           PQY  + D  + L++PENY  ++ NT  DM+ ++       ++  LA  + +C +DE L 
Sbjct: 891 PQYLIIDDGKTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSIDEELG 950

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score =  953 bits (2464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/899 (51%), Positives = 597/899 (66%), Gaps = 16/899 (1%)

Query: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90
           ++ YYE+ ++EI  GD YVCMICTVE+D TC+M+AC  CYRVFDY C+REWALKST KT+
Sbjct: 49  DMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTV 108

Query: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150
           D+ WKCPNCY ++ ++P + R TCWCGKVVNPD N LDPNSCGQTCNA +C+HGCSK+CH
Sbjct: 109 DRIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKICH 168

Query: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210
           LGPHPEC   V+I C CGKH K I C +SKV+  ++NC +VCGL L C  HTC+K CH G
Sbjct: 169 LGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHPG 228

Query: 211 FCGPCESII------KTELPCYCGSDVKSGIQCSDLRV---LDYSKDVSGKKWIGVYSCG 261
            CGPC  +I      K ++ CYCG+  ++ I+CS+ +       SKD +G +WIGV++C 
Sbjct: 229 LCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFACA 288

Query: 262 EVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDT 321
           + R + YSC  H+++E C++P  I+  + CPF P +LKTCPCG+T L+EL KPR+ C D 
Sbjct: 289 DNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDDP 348

Query: 322 IPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCN 381
           IPTC + CGK L CGKH+CPF+CH   CM+PCL I    C C   TF  PC     PRCN
Sbjct: 349 IPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRCN 408

Query: 382 IKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSC 441
           IKCES MSCRRH+C + CCSG+P+A +R+K LF  +DL +E+LVE +H+CLK CNL LSC
Sbjct: 409 IKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLSC 468

Query: 442 GIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAP 501
           GIH C  KCHPGKCPPCLESD NDLVCPCG TVVPAPVRCGTKLP C +PCIK+  G + 
Sbjct: 469 GIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGEST 528

Query: 502 CGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATC 561
           CGH+  PH CH     CPPCT  V K C+C KK  +RT+C   D  V+CG +CG+PL+ C
Sbjct: 529 CGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTD--VSCGIKCGIPLSYC 586

Query: 562 HHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNR 621
           +H CQK CH+ G C+  C + CG KR  C H C + CHG + CP+  C   V I C C R
Sbjct: 587 YHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGR 646

Query: 622 RTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTK----EQLES 677
             K V CGA  D  S +E+  L C+EEC  L+R  EL EAFG+ E+  N      + L+ 
Sbjct: 647 IKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKK 706

Query: 678 IVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQ 737
           +V VA  F++L +P++E  L+VY KQ  WC QI A+ +K ++D  + SLH KPMR PQR 
Sbjct: 707 LVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRH 766

Query: 738 FIKELASAYALYSESQDREPNRSVYLKK-IQSQSKKPELTLKDASELYQLFKTLEKERMQ 796
           FI+ELA AY LYSESQDREP RSV++KK     S KP L+L +A  LY+ FK L+KER  
Sbjct: 767 FIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKA 826

Query: 797 EHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856
           + +  + T  LIN    +T         N  ++  +   +  +++       LK+TLV  
Sbjct: 827 QEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVVN 886

Query: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENL 915
           PQY  L D  + L++PENY   + NT  DME ++       ++  LA  + +C  +E L
Sbjct: 887 PQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEEL 945

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score =  946 bits (2446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/899 (51%), Positives = 600/899 (66%), Gaps = 18/899 (2%)

Query: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90
           ++ YYE+ ++EI  GD Y+CMICTVE+D TC+MYAC  C R+FDY+C+REWALKST KT 
Sbjct: 52  DMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTK 111

Query: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150
           ++ WKCPNCY +N K+P + R+TCWCGKVVNP+ N L+PNSCGQTCNA  C+HGCSK+CH
Sbjct: 112 ERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICH 171

Query: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLG---NSYNCGDVCGLLLPCGKHTCQKTC 207
           LGPHPECL  + +KC CGKH +QI C +SK      N ++C + CGL L CG HTC+K C
Sbjct: 172 LGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKC 231

Query: 208 HTGFCGPCESIIKTE------LPCYCGSDVKSGIQCSDLRV-LDYSKDVSGKKWIGVYSC 260
           H+G CG C  +++        + CYCG + K    C D++     S+D  G KW+GV+SC
Sbjct: 232 HSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWVGVFSC 291

Query: 261 GEVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTD 320
            ++R + YSC  H++VE C+AP  +  ++ CPFSP  LKTCPCG+T L  L KPR KCTD
Sbjct: 292 NKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRLKCTD 351

Query: 321 TIPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRC 380
            +PTC   C K L CGKH CPF+CH G CMDPC+ I K PC+CH   FLTPCQ    P C
Sbjct: 352 PVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEGEPHC 411

Query: 381 NIKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLS 440
           NIKCES MSCRRH+C E CCSG+P A+KR+KTLF   D+N+ETLVE +HVCLK+CNL LS
Sbjct: 412 NIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECNLMLS 471

Query: 441 CGIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPA 500
           CG H C  KCHPGKCPPCLESD NDLVCPCGKTVV APVRCGTKL PC  PCIK+    +
Sbjct: 472 CGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVIRNES 531

Query: 501 PCGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLAT 560
            CGH   PH CHP    CPPCTA V K C+C K+  +RT+C   D  V+CG  CGLPL T
Sbjct: 532 VCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKD--VSCGKICGLPLLT 589

Query: 561 CHHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCN 620
           CHHKCQK CH  GEC++KC + C  KR  C H C + CHG++ C +  C     I+C C 
Sbjct: 590 CHHKCQKVCHPNGECQVKCKQVCRKKRVNCVHECLKSCHGSTECSDSPCPVSTKISCPCG 649

Query: 621 RRTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEK--PKNT-KEQLES 677
           RR   V C AT    S +   +L C+EEC  ++RH EL EAFG+ EK  P+N   E+L+S
Sbjct: 650 RRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERLQS 709

Query: 678 IVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQ 737
               A  +DDL +PY+E  L  Y KQ NWC+QI  +  KF++D  + SLH KPMR PQR 
Sbjct: 710 FAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQRY 769

Query: 738 FIKELASAYALYSESQDREPNRSVYLKK-IQSQSKKPELTLKDASELYQLFKTLEKERMQ 796
           FI E+A A+ LY+ESQDREP RSV+LKK     S KP L L D   +YQ FK LEKER  
Sbjct: 770 FIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKERKA 829

Query: 797 EHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856
           + +  + T  L+NI   +T         N ++I  + +   ++ +    + F K TL+K 
Sbjct: 830 KQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKSTLIKN 889

Query: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENL 915
           PQY  ++  N+ LI+PE+++ IT+   +D++ ++      ++++++   VEMC ++  L
Sbjct: 890 PQYLIIE--NNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNIENEL 946

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/893 (52%), Positives = 595/893 (66%), Gaps = 17/893 (1%)

Query: 34  YYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLDKS 93
           YYE+ VKEI  GD YVCMICTVE+D TC+M+AC  CYRVFDY+C+REWALKST +T+DK+
Sbjct: 58  YYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMDKT 117

Query: 94  WKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHLGP 153
           WKCPNC   ++K+P++ R TCWCGKVVNPD N LDPNSCGQTC+A  C HGCSKVCHLGP
Sbjct: 118 WKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHLGP 177

Query: 154 HPECLIPVQIKCKCGKHCKQIPCSRSKVLGNS-YNCGDVCGLLLPCGKHTCQKTCHTGFC 212
           HPEC   + IKCKCG+H + + CS      N  + C + CGLLLPCG H C K CH+G C
Sbjct: 178 HPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSGLC 237

Query: 213 GPCESIIKTE------LPCYCGSDVKSGIQCSDLRVLDY-SKDVSGKKWIGVYSCGEVRT 265
           G C   + ++      + CYCG      I+C D+RV D  S D  G  WIGV+ C +VR 
Sbjct: 238 GGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVADRDSVDDQGNGWIGVFRCKDVRV 297

Query: 266 LHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTC 325
           + Y+C  H++VE C     + +   CPFSP  L++CPCG+T L +L + R KCTD IPTC
Sbjct: 298 VEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIPTC 357

Query: 326 SNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCE 385
            + CGK+L+CGKHTCP+ CH GDCMDPC+   KT C C +++FL PCQ  + PRCN KCE
Sbjct: 358 ESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTKCE 417

Query: 386 SNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCGIHD 445
           S MSCRRH+C E CCSGKP A++R+KT F  R+L +E+LVE EHVCLK CNL L+CG H 
Sbjct: 418 SLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCGRHK 477

Query: 446 CTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHR 505
           C  KCHPG+CPPCLESDPNDLVCPCGKTVV APVRCGTKLPPCP  CI +     PCGH 
Sbjct: 478 CQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCGHT 537

Query: 506 VGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKC 565
             PH CHP    CPPCTANV K C+C KK D+RTLC   D  V+CG  C  PL +C H C
Sbjct: 538 PMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQD--VSCGQICNKPLGSCRHTC 595

Query: 566 QKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTKQ 625
           QKKCH +G C++KC + CG KR  C H C + CHG  PCP+  C   VVI C C R+   
Sbjct: 596 QKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKEST 654

Query: 626 VECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQLESIVLVAKKF 685
             CG    T S S T +L CDEEC +++R  +L +A G+ E   ++ E   S  LVA  F
Sbjct: 655 EPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNALVASNF 714

Query: 686 DDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKELASA 745
           ++L +P+ E VL +Y +Q  +CD I +V + FI+D +K SLH KPM+  QR F+ ELA A
Sbjct: 715 EELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKA 774

Query: 746 YALYSESQDREPNRSVYLKK-IQSQSKKPELTLKDASELYQLFKTLEKERMQEHYSTKVT 804
           Y LYSESQD EP RSVY+KK +  +S KP +TL++A  +YQ FK  EKE     Y  +  
Sbjct: 775 YKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQNV 834

Query: 805 KTLIN-IPASETPLP-APYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRFL 862
             L+N +P  E  +  A Y   N  +I  + D +  ++++ +  + LK TLV+ P Y+ L
Sbjct: 835 TNLVNFVPKFEPTVELAKY---NGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKAL 891

Query: 863 KDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENL 915
            D N  LIFPE+YS +T NT  DME+++       ++  +  GVE+CQV E L
Sbjct: 892 PDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYL 944

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score =  934 bits (2413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/896 (52%), Positives = 611/896 (68%), Gaps = 22/896 (2%)

Query: 34  YYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLDKS 93
           YYE+ ++EI  GD YVCMICTVE+D TC+MYAC  CYRVFDYEC+REWALKST KT+D+ 
Sbjct: 52  YYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTVDRI 111

Query: 94  WKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHLGP 153
           WKCPNCY +N K+P + R TCWCGKVVNP+ N L+PNSCGQTCNA++CVHGCSK+CHLGP
Sbjct: 112 WKCPNCYHVNKKVPPKNRPTCWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSKICHLGP 171

Query: 154 HPECLIPVQIKCKCGKHCKQIPCSRSKVL--GNSYNCGDVCGLLLPCGKHTCQKTCHTGF 211
           HPEC   + IKC+CGKH K I C +S +L   + + C + CGL L CG H CQK CH+G 
Sbjct: 172 HPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCHSGL 231

Query: 212 CGPCESIIKTE------LPCYCGSDVKSGIQCSDLRV---LDYSKDVSGKKWIGVYSCGE 262
           CG C  I+ T+      + CYCGS  +  I+C D+ V      S+++ G+KW+GV+ C  
Sbjct: 232 CGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVFKCDN 291

Query: 263 VRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTI 322
           +R + Y C  H++VEQC+AP  ID ++PCPFSPK LKTCPCGKT LKEL + R+KCTD I
Sbjct: 292 IRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKCTDPI 351

Query: 323 PTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNI 382
           PTC + CGK L CG+HTCPF CH G CMDPCL I K  C+C+ ++FL PCQ H  P+C  
Sbjct: 352 PTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDPQCTT 411

Query: 383 KCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCG 442
           KCES MSCRRH+C E CC+G+P A+ R+K LF  +DL +E+LVEP+H+CLK+CNL LSCG
Sbjct: 412 KCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLMLSCG 471

Query: 443 IHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPC 502
            H C  KCHPGKCPPCLESD NDLVCPCG+T++ APVRCGTKLPPCP PCIK+  G  PC
Sbjct: 472 KHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRGEYPC 531

Query: 503 GHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCH 562
           GH   PH CHP    CPPCTA+V K C+C K   +RTLC   D  V+CG  CGLPL  C+
Sbjct: 532 GHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQND--VSCGKICGLPLENCN 589

Query: 563 HKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRR 622
           H CQK+CH+ GEC+  C + C  KR  C H C + CHG + CP+  C   + ITC+C R+
Sbjct: 590 HTCQKRCHLLGECQKTCKQICKKKRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECGRK 649

Query: 623 TKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTK---EQLESIV 679
              V CGAT    S +    + CDEEC  L+RH +L EAFG+ +  ++T    E+L+ + 
Sbjct: 650 ETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLKDLA 709

Query: 680 LVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFI 739
            VA  F++L +PY+E  L++Y KQ  WCDQI  + +K ++D  + SLH KPMR PQR FI
Sbjct: 710 KVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQRHFI 769

Query: 740 KELASAYALYSESQDREPNRSVYLKKIQ-SQSKKPELTLKDASELYQLFKTLEKERMQEH 798
           +E A ++ LY+E+QDREP RSV++KK +   S KP ++L DA  LYQ FK LEKER  + 
Sbjct: 770 QEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKERKLKE 829

Query: 799 YSTKVTKTLINI--PASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856
           +  + T  LIN+  P  +    A Y G    +I  +   + +++++ +   FL  TL+  
Sbjct: 830 FEARTTTRLINVEAPQEDNVYHAKYSG---FLIKKISPGTTVEDLQRIFGQFLTSTLIVN 886

Query: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVD 912
           PQY  ++D    LI+PENY  ++     D+E ++       ++  +A GVE+C V+
Sbjct: 887 PQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVE 942

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score =  934 bits (2413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/900 (50%), Positives = 589/900 (65%), Gaps = 16/900 (1%)

Query: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90
           ++ YYE++++EI  GD Y+CMICTVE+D TC+M+AC  CYRVFDY C+REWA+KST KT+
Sbjct: 49  DMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTV 108

Query: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150
           D+ WKCPNCY +  K+P   R TCWCGKVVNPD N LDPNSCGQTC+A  C+HGCSK CH
Sbjct: 109 DRIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPICIHGCSKTCH 168

Query: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210
           LGPHPEC   V+I C CGKH + I C +SK +  ++ C + CGL L C  H C++ CHTG
Sbjct: 169 LGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHTG 228

Query: 211 FCGPCESIIKT------ELPCYCGSDVKSGIQCSDLRVLDY---SKDVSGKKWIGVYSCG 261
            CGPC  +I +      ++ CYCG+  ++ I+CS+ R       SKD +G +WIGV++C 
Sbjct: 229 LCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFACT 288

Query: 262 EVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDT 321
           ++RT+ +SC  H+++E CL+P  ++  + CPF P  LKTCPCG+T L EL KPR+ C D 
Sbjct: 289 DIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDDP 348

Query: 322 IPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCN 381
           IPTC++ C K L CGKH+CPF CH   CMDPCL I    C C   TF  PC     PRCN
Sbjct: 349 IPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRCN 408

Query: 382 IKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSC 441
           IKCES MSCRRH+C + CCSG+P+A KR K  F  +DL +E+LVE +H+CLK CNL LSC
Sbjct: 409 IKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLSC 468

Query: 442 GIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAP 501
           GIH C  KCHPGKCPPCLESD NDL+CPCGKTVVPAPVRCGT+LP C +PCIK+  G + 
Sbjct: 469 GIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGESS 528

Query: 502 CGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATC 561
           CGH+  PH CHP G  CPPCT  V K C+C KK  +RT+C   D  V+CGT+CGL L  C
Sbjct: 529 CGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKD--VSCGTKCGLLLHFC 586

Query: 562 HHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNR 621
            H CQK CH+ G C+  C + CG +R  C H C + CHG + CP+  C   V ITC C R
Sbjct: 587 RHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGR 646

Query: 622 RTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTK----EQLES 677
             K V C A       +E+  L CDEEC  L+R  EL EAFG+ E+  N      + L+ 
Sbjct: 647 NEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKK 706

Query: 678 IVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQ 737
           +V VA  F++L++P++E  L+VY KQ  WC QI  + +K ++D  + SLH KPMR PQR 
Sbjct: 707 LVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRH 766

Query: 738 FIKELASAYALYSESQDREPNRSVYLKK-IQSQSKKPELTLKDASELYQLFKTLEKERMQ 796
           FI+ELA AY LYSESQDREP RSV++KK     S KP L+L +A  LY+ FK L+KER  
Sbjct: 767 FIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKV 826

Query: 797 EHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856
           + + ++ T  LIN    +          N  ++  +   + +++++      LK+TLV  
Sbjct: 827 QEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVN 886

Query: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLS 916
           PQY  L D  + L++PENY   + NT  DME ++       ++  LA  + +C  DE + 
Sbjct: 887 PQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVG 946

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/904 (50%), Positives = 593/904 (65%), Gaps = 21/904 (2%)

Query: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90
           ++PYYE+ V+EI  GD Y CMICTVE+D TC+M+AC  CYRVFDY+CVREWA+KST+KT+
Sbjct: 50  DLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTV 109

Query: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150
           D+ WKCPNCY +N K+P + R TCWCGKVVNP+ N LDPNSCGQTC+A  C+HGCSK+CH
Sbjct: 110 DRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICH 169

Query: 151 LGPHPECLIPVQIKCKCGKHCKQIPC--SRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCH 208
           LGPHPECL    +KC+CGK  K+IPC  ++ +   N + C + C  LLPCG H CQK CH
Sbjct: 170 LGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICH 229

Query: 209 TGFCGPC-ESIIKTE-----LPCYCGSDVKSGIQCSDLRVLDY-SKDVSGKKWIGVYSCG 261
           +G CG C E++   E     + CYCG   ++ I+C D+ V    SK+ +G +WIGVY+C 
Sbjct: 230 SGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVYACK 289

Query: 262 EVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDT 321
           ++R++ YSC  H++ E+C+AP  +  ++ CPFSPK LKTC CGKT L+ L K RR+C D 
Sbjct: 290 DIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRCIDP 349

Query: 322 IPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCN 381
           IP C + C K L CGKHTCPF CH G CMDPC+ I K  C C   TFL PC     P C 
Sbjct: 350 IPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAPHCQ 409

Query: 382 IKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSC 441
           +KCES +SCRRHKC E CCSG+PAA++R K     +D+N+ETL+E EHVCLK CNL LSC
Sbjct: 410 LKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLTLSC 469

Query: 442 GIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAP 501
           G H C  KCHPGKCPPCLESD NDLVCPCGKT+VPAPVRCGTKLP C +PCIK+ EG + 
Sbjct: 470 GQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEGISE 529

Query: 502 CGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATC 561
           CGH+  PH CHP    CPPCTA V K C+C K   +RT+C   D  V+CG  CG PL  C
Sbjct: 530 CGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKD--VSCGQTCGKPLPNC 587

Query: 562 HHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNR 621
           HH CQK CH+ G+C+  C + C      C H C++ CHG   CP+ +C   V I C C R
Sbjct: 588 HHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCGR 647

Query: 622 RTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKE-------Q 674
           +  +V CGAT    S   TE+L CDEEC    RH +L EAFG+ +K  N          +
Sbjct: 648 KEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGTR 707

Query: 675 LESIVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVP 734
           LE +   A  F++L  P++E  ++ Y +Q  WC +I    + F+++  K SLH KPM+ P
Sbjct: 708 LEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPP 767

Query: 735 QRQFIKELASAYALYSESQDREPNRSVYLKK-IQSQSKKPELTLKDASELYQLFKTLEKE 793
           QR FI+ELA AY LYSE+QD EP RSV++KK     S KP  +L + + LYQ FK LEKE
Sbjct: 768 QRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEKE 827

Query: 794 RMQEHYSTKVTKTLINIPAS-ETPLPAPYEGP-NAIVISGVFDSSQIDNIEPLVHDFLKY 851
           R  + +  K T  LIN+  + +    A + G  NA +I  +   + + +++ L   +++ 
Sbjct: 828 RKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYMEK 887

Query: 852 TLVKTPQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQV 911
           TL++ PQY+ L + NS +++PE+Y  I+ N  +DME ++  I   + D  LA   E+C  
Sbjct: 888 TLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAELCDA 947

Query: 912 DENL 915
              L
Sbjct: 948 SSKL 951

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score =  925 bits (2391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/887 (51%), Positives = 583/887 (65%), Gaps = 9/887 (1%)

Query: 33  PYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLDK 92
           PYYE+T+KEI  GD+Y CMICTVE+D TC MYAC  CYRVFDYEC+REWA+KST K++ K
Sbjct: 62  PYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQKSVTK 121

Query: 93  SWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHLG 152
           +WKCPNCY     +P + R TCWCGK ++P+ N L+PNSCGQTC+A  CVHGCS  CHLG
Sbjct: 122 TWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSSTCHLG 181

Query: 153 PHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTGFC 212
           PHP C+  VQ KC+CGK  K + CS ++     + CG+ CGL LPCG H CQ+ CH G C
Sbjct: 182 PHPTCMRMVQTKCRCGKKSKDVFCSEARKHQELFRCGNPCGLTLPCGVHKCQRECHNGVC 241

Query: 213 GPCESIIKTELPCYCGSDVKSGIQCSDLRVLDYSKDVSGKKWIGVYSCGEVRTLHYSCDH 272
           G C   I  E+ CYCG +    I+C D+++   S+D SGKKWIG ++C  +RT+ YSC  
Sbjct: 242 GECPETIAKEINCYCGLESLPSIKCQDVKIQSKSQDGSGKKWIGAFACSRIRTVEYSCRE 301

Query: 273 HTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTCSNVCGKQ 332
           H++ E C AP  I    PCP+SPK LKTCPCG+T L+ ++ PR KCTD IPTC   CGK 
Sbjct: 302 HSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCTDPIPTCDATCGKL 361

Query: 333 LSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCESNMSCRR 392
           LSCG+H CPF CHTG CM+ C    K  C+C+S+ F+ PC+    PRCN KCES MSCRR
Sbjct: 362 LSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCNTKCESLMSCRR 421

Query: 393 HKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCGIHDCTWKCHP 452
           H+C E CC G+  A+ REK +FL RD  +E+LVE +H+CLK+CNLKLSCG H C  KCHP
Sbjct: 422 HRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKLSCGRHFCQRKCHP 481

Query: 453 GKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHRVGPHKCH 512
           G CPPCLESD NDLVCPCGKTV PAPVRCGT LPPC NPCIK  +GP  CGH   PH CH
Sbjct: 482 GNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLDCGHPPMPHACH 541

Query: 513 PAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKCQKKCHVE 572
                CP CTA V K+C+C K   +RTLC    + V+CG  CG  L +CHH C K CH E
Sbjct: 542 SLDEPCPSCTAPVFKQCKCGKNKKVRTLCF--QNNVSCGRVCGKQLVSCHHSCTKTCHRE 599

Query: 573 GECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTKQVECGATH 632
           GEC+  C + CG+ RS C H+C+ KCH  SPCP+  C+  V + C C  R+    C A H
Sbjct: 600 GECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRSSFATCAA-H 658

Query: 633 DTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQLESIVLVAKK---FDDLN 689
           + Q  ++   L C E+CA  +R +ELMEAFGMN +     E +  +  +A+K   F +L 
Sbjct: 659 EGQDPADQRPLECTEDCAAARRRLELMEAFGMNTETVQPTEGIVDLAALAEKVTTFQELM 718

Query: 690 MPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKELASAYALY 749
           +P++E  L+++ KQ NWC QI    ++ + D  K SLH KPM+ PQR FI ELA AY LY
Sbjct: 719 LPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRHFIHELAQAYKLY 778

Query: 750 SESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKERMQEHYSTKVTKTLIN 809
            ESQD+EP RSVY+KK    S+KP L+LK+A  LYQ FK  +KER  +      T  ++N
Sbjct: 779 CESQDKEPKRSVYVKKT-VDSRKPSLSLKEALPLYQSFKNAQKERKLKELERSTTTRILN 837

Query: 810 IPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRFLKDLNSVL 869
             ++    P P    N ++I  VF+ +    IE    D+LK+TL+K P Y  L D   V+
Sbjct: 838 YTSTGESSP-PVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPNYLKL-DSGDVM 895

Query: 870 IFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLS 916
           +F ENY+  + N   D+ +V+  +    +D  LA GV +C+V++ ++
Sbjct: 896 VFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVMA 942

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/895 (49%), Positives = 588/895 (65%), Gaps = 16/895 (1%)

Query: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90
           ++ YYE+ V+EI  GD+YVCMICTVE+D TC+MYAC+ CYRVFDYEC+REWALKST KTL
Sbjct: 37  DMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTL 96

Query: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150
           D+ WKCPNCYK+N ++P + R TCWCGK VNPD N LDPNSCGQTC+A  C HGCSK CH
Sbjct: 97  DRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCH 156

Query: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLG--NSYNCGDVCGLLLPCGKHTCQKTCH 208
           LGPHP+C+  +  KC+CGKH ++  C ++  +   + + C +VCGL L CG H C++ CH
Sbjct: 157 LGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCH 216

Query: 209 TGFCGPCESII-----KTELPCYCGSDVKSGIQCSDLRVL-DYSKDVSGKKWIGVYSCGE 262
           +G CGPC +++     K ++ CYCG + +   +C D+RV  D SKD  G  WIG + C  
Sbjct: 217 SGICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFGCSG 276

Query: 263 VRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTI 322
           +R + Y+C  H++VE+C     I     CPFSPK LKTCPCG+T LK L +PR+ CT  I
Sbjct: 277 IRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPI 336

Query: 323 PTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNI 382
           P C + CGK+L+CG+HTCPF+CH G CMDPC+ I    C+CH   +  PCQ  + PRC+ 
Sbjct: 337 PNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDT 396

Query: 383 KCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCG 442
           KCES MSCRRH+C E CC G+P A++R KT    R+L +E+ VE EH+CLK CNL LSCG
Sbjct: 397 KCESLMSCRRHRCTERCCCGRPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTLSCG 456

Query: 443 IHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPC 502
            H C  KCHPGKCPPCLESD NDLVCPCGKTVV APVRCGT+LPPC  PCI++ +    C
Sbjct: 457 CHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKC 516

Query: 503 GHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCH 562
           GH+  PH CHP    CP CTA V K C+C KK  +RTLC   D  V+CGT CG PL  C 
Sbjct: 517 GHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQND--VSCGTTCGKPLDNCP 574

Query: 563 HKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRR 622
           H CQK CH+ GEC+ KC + C  KR  C H C+  CHGN  CP+  C   V I C+C  +
Sbjct: 575 HMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVK 634

Query: 623 TKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGM---NEKPKNTK-EQLESI 678
              + CGA  +T S++ T  LPCDEEC + +RH++L EAFG+   ++ P  +K   LE++
Sbjct: 635 ESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLENL 694

Query: 679 VLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQF 738
             VA  F++L +P+SE  L  + KQ  WC QI  V + F+++ +K SLH KPMR  QR F
Sbjct: 695 AAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHF 754

Query: 739 IKELASAYALYSESQDREPNRSVYLKKIQSQSK-KPELTLKDASELYQLFKTLEKERMQE 797
           I ELA +Y LY ESQDREP RSV++KK  +    KP + LKD+  +YQ FK  EKE+  +
Sbjct: 755 IHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQ 814

Query: 798 HYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTP 857
            +  + T   +N    E P     +  NA  +  V   +  +++E +  D LK TLVK P
Sbjct: 815 RFEAQTTTEFVNFIPKEEPQLERAKN-NAFKLKNVSTGTTKEDLERIFADHLKPTLVKNP 873

Query: 858 QYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVD 912
           Q++      + LI+PE+Y+ I+ N   D+E ++       ++  +  G+E+C +D
Sbjct: 874 QFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHID 928

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/900 (50%), Positives = 585/900 (65%), Gaps = 16/900 (1%)

Query: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90
           ++ YYE+ V+EI  GD Y C+ICTVELD TC++YAC+ CYRV+DYEC+REWA KST+K  
Sbjct: 58  DMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRT 117

Query: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150
           DK W CPNC+     IPK+ R TCWCG+ VNP+ N L+PNSCGQTCNA  C HGCS++CH
Sbjct: 118 DKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICH 177

Query: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210
           LGPH EC   + IKC CGK  K I C + ++    +NC  VC  LLPCG H C + CHTG
Sbjct: 178 LGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHTG 237

Query: 211 FCGPC-ESII----KTELPCYCGSDVKSGIQCSDLRV---LDYSKDVSGKKWIGVYSCGE 262
            CG C E+II      ++ CYCG   K  I+C D+R      YSKD  G++WIGV+ C +
Sbjct: 238 LCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDK 297

Query: 263 VRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTI 322
           +R + Y C  H++ E+C AP  I     C FSPK LKTCPCGK  L +L KPR KCTD I
Sbjct: 298 IRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAI 357

Query: 323 PTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNI 382
           PTC  VCGK L CGKH CPF+CH GDCMDPC  I K  C C  K F  PC  +D  RCN+
Sbjct: 358 PTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNL 417

Query: 383 KCESNMSCRRHKCMEICCSGKPAAKKREKTLFLK-RDLNNETLVEPEHVCLKQCNLKLSC 441
           KCES MSCRRH+C E CC+G+P A++R KT+ +  RDL +E+ +EP H+CLK CNL LSC
Sbjct: 418 KCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSC 477

Query: 442 GIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAP 501
           GIH C  KCH GKCPPCLESD NDLVCPCGKT+V APVRCGTKLP CP PCI++  G   
Sbjct: 478 GIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETD 537

Query: 502 CGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATC 561
           CGH   PH+CHP    CP CTA V K C+C K+  +RT+C + D  V+CG  CG  L TC
Sbjct: 538 CGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKD--VSCGKVCGERLQTC 595

Query: 562 HHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNR 621
           +HKCQKKCH  G C+  C + C + R  C H C + CH    CP+  C   V ITC C R
Sbjct: 596 YHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGR 655

Query: 622 RTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQ----LES 677
             K+V CG     +   ++ ++ CDEECA LQRHM+L EAFG+ +KP+NT  +    LE 
Sbjct: 656 IEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQ 715

Query: 678 IVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQ 737
           ++  A  F DL++P++E V+  Y +  NWC  I    +K I+D  + SLH KPMR PQR 
Sbjct: 716 VISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRY 775

Query: 738 FIKELASAYALYSESQDREPNRSVYLKK-IQSQSKKPELTLKDASELYQLFKTLEKERMQ 796
           FI+ELA AY LYSESQD EPNRSV++KK +   S KP L++ +A+ LYQ +K LEKE+ Q
Sbjct: 776 FIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQ 835

Query: 797 EHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856
            ++ +  T  LIN     +P        N  +++ V + +  D+++ L   +LK TLV  
Sbjct: 836 ANFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVE 895

Query: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLS 916
           PQ++ L +    +I+P  Y  I+ N   DME ++      +++ +LA GVE+C ++  L+
Sbjct: 896 PQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLA 955

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score =  906 bits (2341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/899 (50%), Positives = 590/899 (65%), Gaps = 17/899 (1%)

Query: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90
           ++ YYE+ V+EI  GD Y CMICTVE+D TC+MYAC  CYRVFDY+C+REWALKST KT+
Sbjct: 68  DLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKTV 127

Query: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150
           DK+WKCPNCY  + K+P + R TCWCGKVVNPD N LDPNSCGQTCNA  C H C K CH
Sbjct: 128 DKTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANICPHKCLKQCH 187

Query: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210
           LG HPEC   ++I C+CG+  K I C  S+   + ++C   CGL LPCG H C++ CH+G
Sbjct: 188 LGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKCRRKCHSG 247

Query: 211 FCGPCESIIKTE-----LPCYCGSDVKSGIQCSDLRVLD---YSKDVSGKKWIGVYSCGE 262
            CG C  ++  E     + CYCG      + C D+        S++   K+W+G++ C E
Sbjct: 248 LCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFDCKE 307

Query: 263 VRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTI 322
           +R++ Y+C+ H +VE C+AP  +  +  CPFSP  LKTCPCGKT L+++D  R KCTD I
Sbjct: 308 MRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCTDPI 367

Query: 323 PTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNI 382
           PTC NVC K L CGKH CPF+CHTG CMDPC+ I K  C C  +TFL PCQ    P C  
Sbjct: 368 PTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPVCKF 427

Query: 383 KCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCG 442
           KCES MSCRRH+CME CCSG+P A++R+KT+    D N+ETLVE EHVCLK CNLKLSCG
Sbjct: 428 KCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKLSCG 487

Query: 443 IHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPC 502
           IH C  KCHPG CPPCLESD NDLVCPCGKTV+PAPVRCGT LPPC  PCIK+  G + C
Sbjct: 488 IHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGESDC 547

Query: 503 GHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCH 562
           GH+  PH CH     CP CTA V K C+C KK  +RT+C   D  V+CG  CGLPL  C+
Sbjct: 548 GHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQED--VSCGLPCGLPLKDCY 605

Query: 563 HKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRR 622
           HKCQK+CH+ GEC+  C + C  KRS C H C ++CH N+PCP+  C   V + CDC RR
Sbjct: 606 HKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTVPVTVVCDCGRR 665

Query: 623 TKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGM-----NEKPKNTKEQLES 677
                C +T    S + T  L CDEEC  L R MEL  AFG+     ++K     E++++
Sbjct: 666 KLVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGLGDDKTSVAIERIQN 725

Query: 678 IVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQ 737
            + VAK +++L +P+ E VL VY KQ  WC QI  + +KF+++  K SLH K M+ PQR 
Sbjct: 726 RISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQRS 785

Query: 738 FIKELASAYALYSESQDREPNRSVYLKKI-QSQSKKPELTLKDASELYQLFKTLEKERMQ 796
           F+  LA AY +YSESQD EP RSV++KK+    S KP LTL++A  LY+ FK ++KE+ +
Sbjct: 786 FVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQKEKKK 845

Query: 797 EHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856
           + Y  +  KTLIN+ A ET         N  +I  +   +  +++E +  + LK TLVK 
Sbjct: 846 QEYEARTHKTLINVEA-ETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVKD 904

Query: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENL 915
           PQY  + + +   I P +Y+ I+ N   DME++I F  +  ++  +   VE+C +DE L
Sbjct: 905 PQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEAL 963

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/898 (51%), Positives = 583/898 (64%), Gaps = 13/898 (1%)

Query: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90
           ++ +YE+ +K+I  GD Y CMICT+ELDST +MYAC  CYRVFDY+C+REWA+KS+ K+L
Sbjct: 65  DLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSL 124

Query: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150
           DK WKCPNC   ++KIP Q R TCWCGK VNPD N   PNSCGQTCNA SC+H CS  CH
Sbjct: 125 DKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCH 184

Query: 151 LGPHPECLIPVQIKCKCGKHCKQIPC---SRSKVLGNSYNCGDVCGLLLPCGKHTCQKTC 207
           LGPHP+C     I C+CGKH K + C      K     +NCG+ C + L CG H C + C
Sbjct: 185 LGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVC 244

Query: 208 HTGFCGPCESIIKTELPCYCGSDVKSGIQCSDLRVLDY---SKDVSGKKWIGVYSCGEVR 264
           H+G CGPC  +I  ++ CYCGS     I+CS++++ D    SKD  G  WIGV+ C ++R
Sbjct: 245 HSGSCGPCPELITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKCNKIR 304

Query: 265 TLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPT 324
           T+ Y+C +H++ E C +P  I  ++ CP+SPK LKTCPCGKT L + +  R+KCTD I T
Sbjct: 305 TVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTDPIST 364

Query: 325 CSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKC 384
           C N C K L CGKH CPF+CH G CMDPC  I    C+C+ K F  PCQ H+ PRCN+KC
Sbjct: 365 CENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRCNMKC 424

Query: 385 ESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCGIH 444
           ES MSCRRH+C   CCSGKP A KR+K LF + DL +E+LVE EH+CLK CNLKLSCGIH
Sbjct: 425 ESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLSCGIH 484

Query: 445 DCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGH 504
           +CT KCH GKCPPCLESD +DLVCPCGKTVV APVRCGTKLP C  PCIK  EG  PCGH
Sbjct: 485 NCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSYPCGH 544

Query: 505 RVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHK 564
           + G H CHPA   CPPCT  V K C+C K+   + LC       +CG  C   L  CHH 
Sbjct: 545 KPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCF--QETASCGKLCEKKLDGCHHY 602

Query: 565 CQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTK 624
           CQ KCH+ GEC+ KC + C  +R  C H C +KCHG+S CP+  C  K  + C C RR +
Sbjct: 603 CQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRRKE 662

Query: 625 QVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGM---NEKPKNTKEQLESIVLV 681
            + CGAT  TQS   T+ LPCD+ C K QR  EL  AFGM   +E P++  E+L+ IV  
Sbjct: 663 LLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKIVEK 722

Query: 682 AKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKE 741
              +++L +P+SE VL+VY KQ NWC+QI  + +KF+ D  K SLH KPM  PQR FI  
Sbjct: 723 VTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFIHA 782

Query: 742 LASAYALYSESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKERMQEHYST 801
           L  AY +YSESQDREP RSVYLKK    ++ P ++L++A  LYQ +K +EKER  + + +
Sbjct: 783 LVEAYEMYSESQDREPKRSVYLKK-NKYTRIPNISLEEALPLYQSYKKIEKERKVQSFES 841

Query: 802 KVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRF 861
           K   T +N    E  L  P    N  +I G+   +  D++  L    LK TL+K  QY  
Sbjct: 842 KKNVTYLNYQPPERSL-TPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQYSI 900

Query: 862 LKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLSLVS 919
           L D  S +++P++Y  I++N   D+E +        ++ ML   VEMC + + L   S
Sbjct: 901 LPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDILQTES 958

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/892 (48%), Positives = 579/892 (64%), Gaps = 6/892 (0%)

Query: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90
            +PYYE+ +K+I++G  Y C+ICTVE+DSTCRMYAC +CYRV+DYEC+ EWA KS+ ++ 
Sbjct: 27  GLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKRSA 86

Query: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150
           D +WKCPNCY   +K+  +KRSTCWCGK +NP+ N   PNSCGQTC A  C HGC+  CH
Sbjct: 87  DSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCASTCH 146

Query: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210
           LGPHP+C++PV +KCKCGK  +QI C ++K +    +C   CGL LPCG HTCQK CH+G
Sbjct: 147 LGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKICHSG 206

Query: 211 FCGPCESIIKTELPCYCGSDVKSGIQCSDLRVLDYSKDVSGKKWIGVYSCGEVRTLHYSC 270
            CG C +++  +  CYCGS+    I C D+ V   S+    KKWIGV+SC  +R + Y C
Sbjct: 207 PCGRCNTVMSGKFKCYCGSNHLDSIICKDVAVTKMSRSGKHKKWIGVFSCKNIREVRYRC 266

Query: 271 DHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTCSNVCG 330
             H++ E C      D    CP+SP   KTC CG T L ++ + R KCTD IPTC   CG
Sbjct: 267 KEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIPTCDQRCG 326

Query: 331 KQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCESNMSC 390
           K LSCGKHTCP +CH G CMDPCL I +  C+C  +TFLTPCQ    P CNIKCE+ MSC
Sbjct: 327 KPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIKCENLMSC 386

Query: 391 RRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCGIHDCTWKC 450
           RRH+C++ CCSGKP A  R  T+    D N+E+L+E EH+C K CN KLSCG+H CT KC
Sbjct: 387 RRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCGLHHCTNKC 446

Query: 451 HPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHRVGPHK 510
           HPGKCPPCLESD NDLVCPCGK+V+ APVRCGT  P C  PCI    G  PCGHR   HK
Sbjct: 447 HPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPCGHRAPFHK 506

Query: 511 CHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKCQKKCH 570
           CHP+  DCPPCTA V K C+C K    RT+C   D  ++CG +C   L  CHH CQK+CH
Sbjct: 507 CHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQND--ISCGRKCAAKLTNCHHLCQKQCH 564

Query: 571 VEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTKQVECGA 630
             GEC   C + CGLKRS C HLC   CHG+  CP+  C E+VV++C C RR+ +V CGA
Sbjct: 565 PPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSLKVPCGA 624

Query: 631 THDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQLESIVLVAKKFDDLNM 690
             D +S + T+ L CD++CAK+Q+H  L++    +E     +    S++     ++DL +
Sbjct: 625 YKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSESTNKAEHGSSSVINKPTSYEDLGL 684

Query: 691 PYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKELASAYALYS 750
           PYSE ++ V+ KQ  WC  I     + +ED  + SLH KPM+ PQRQF+ EL+ A+ LYS
Sbjct: 685 PYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHELSKAFGLYS 744

Query: 751 ESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKERMQEHYSTKVTKTLINI 810
           ESQDREP RSV++K +++ SK P + L +A  LYQ  KT +KER         TK LI+I
Sbjct: 745 ESQDREPKRSVFVKILKT-SKIPAIGLSEALLLYQRMKTFQKERRDLELQHNTTKILISI 803

Query: 811 PASETPLPAPYEGP-NAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRFLKDLNSVL 869
           P  +       E   NAI+I+GV  +  ++NI+    + LK TL+K PQ+R +   ++  
Sbjct: 804 PIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQFRLIN--SNAY 861

Query: 870 IFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLSLVSQA 921
           I+P N+  I+ N  +D+++++P+     + + +   V   ++  + +  SQA
Sbjct: 862 IYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLTADFNKTSQA 913

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/886 (49%), Positives = 577/886 (65%), Gaps = 8/886 (0%)

Query: 33  PYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLDK 92
           PYYE+TVKEI+ GD+Y CMICTVE+D TC MYAC  CYRVFD+EC+REWALKST K++ K
Sbjct: 44  PYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSK 103

Query: 93  SWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHLG 152
           +WKCPNCY    ++P + R TCWCGK V P+ N L+PNSCGQTC+A  C HGCS +CHLG
Sbjct: 104 TWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLG 163

Query: 153 PHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTGFC 212
           PHP C+  VQ+KC CGK  K + C  +    +S+ C   CGL LPCG H CQ+ CH+G C
Sbjct: 164 PHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHSGIC 223

Query: 213 GPCESIIKTELPCYCGSDVKSGIQCSDLRVLDYSKDVSGKKWIGVYSCGEVRTLHYSCDH 272
           G C   I   + CYC  + K  ++C+++R+   S+D SG KW+G +SC  +RT+ +SC  
Sbjct: 224 GECPESIYGTINCYCKLESKPSLKCTEVRIEGRSRDSSGNKWVGAFSCENIRTVEHSCKK 283

Query: 273 HTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTCSNVCGKQ 332
           H++ E C AP  I    PCPFSP+TLKTCPCG++ L+E+D  R +CTD IPTC +VCGK 
Sbjct: 284 HSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDSVCGKM 343

Query: 333 LSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCESNMSCRR 392
           L CGKH CPF CHTG CM+ CL   K  C+CH++ F+ PC+  +  RCN KCE+ MSCRR
Sbjct: 344 LRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEALMSCRR 403

Query: 393 HKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCGIHDCTWKCHP 452
           H+C+E CC G+  A+ REK +FL RD  +E+LVE +H+CLKQCNLKLSCG H C  KCHP
Sbjct: 404 HRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCKRKCHP 463

Query: 453 GKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHRVGPHKCH 512
           G C PCLESD NDLVCPCGKTVVPAPVRCGT LP C +PCIK  +GPAPCGH   PH CH
Sbjct: 464 GNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGPAPCGHPPMPHPCH 523

Query: 513 PAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKCQKKCHVE 572
           P    CP CTA V K C+C K   +RTLC   D  V+CG  CG  LA C H CQK CH E
Sbjct: 524 PLEEPCPSCTAPVFKSCKCRKNDKVRTLCFQND--VSCGRVCGKQLAGCQHICQKACHKE 581

Query: 573 GECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTKQVECGATH 632
           GEC+  C +PCG  R  C H C+  CH  +PCP+K C   V I C+C  R+  V CGA  
Sbjct: 582 GECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCGANE 641

Query: 633 DTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQLESIVLVAKK---FDDLN 689
           +     ET  L C+ +C   +RH ELMEAFG+        + LE +  +A+K   F +L 
Sbjct: 642 NRAPAEET-ALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEALAEKVSTFQELL 700

Query: 690 MPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKELASAYALY 749
           +P+SE  L+++ KQ  WC QI    ++ + D  K SLH KPMR PQR FI EL  AY LY
Sbjct: 701 LPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAYHLY 760

Query: 750 SESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKERMQEHYSTKVTKTLIN 809
            ESQD+EP RSV++KK  + S++P ++LK A  LY  FK+ ++E+  +      T  +IN
Sbjct: 761 CESQDQEPKRSVFVKKT-ADSQRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRIIN 819

Query: 810 IPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRFLKDLNSVL 869
              ++     P    N +++  V +      I+    ++LK+TL+K P Y  L     VL
Sbjct: 820 YAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLLAS-GDVL 878

Query: 870 IFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENL 915
           ++ ++YS  + N  +D+E+++  +   +++Q+LA GV   +V   L
Sbjct: 879 VYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFL 924

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  864 bits (2232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/890 (47%), Positives = 572/890 (64%), Gaps = 9/890 (1%)

Query: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90
            IPYYEQTV E++DG+ Y C+ICTVE+D++C MYAC  CYRV+DYEC+R WALK+T+ T+
Sbjct: 15  GIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTTV 74

Query: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150
           D++WKCPNCY +N K+P + R TCWCGK VN D N ++PNSCGQTC A  C HGCSK+CH
Sbjct: 75  DRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLCH 134

Query: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210
           LGPH EC++ +  KC+CGK  ++IPC  +K    +++C   CGL +PCG H C++ CH G
Sbjct: 135 LGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHNG 194

Query: 211 FCGPCESIIKTELPCYCGSDVKSGIQCSDLRVLDYSKDVSGKKWIGVYSCGEVRTLHYSC 270
            CGPC+  I  ++ CYCG   ++ + CS++ V+  SK    K WIG ++C  +R + YSC
Sbjct: 195 PCGPCKEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKYKSWIGAFACDRMREVPYSC 254

Query: 271 DHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTCSNVCG 330
             H++ E+C+AP  + +  PCP+SP+   TCPCGKT L EL   R  CTD I +C  VCG
Sbjct: 255 GKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHISSCGKVCG 314

Query: 331 KQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCESNMSC 390
           KQLSCG HTCP +CH G+CMDPCL+IT+  C C  + FL PCQ   +P C  KCES MSC
Sbjct: 315 KQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAKCESLMSC 374

Query: 391 RRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCGIHDCTWKC 450
           RRH+C E CCSG+P + KR  +   +   ++E+ VE +HVCLK CN  L CGIH C +KC
Sbjct: 375 RRHRCAERCCSGRPHSVKR-NSRRRRESPDDESEVEAQHVCLKDCNRVLLCGIHMCNYKC 433

Query: 451 HPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHRVGPHK 510
           H GKCPPCLESD NDL+CPCGKT+VPAPVRCGTKLP C +PC        PCGH    H 
Sbjct: 434 HAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCGHSPPSHN 493

Query: 511 CHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKCQKKCH 570
           CHP    CPPCT  V K CRC  K+++RT C   D  V+C   C  PL+ C+H CQ  CH
Sbjct: 494 CHPLDEPCPPCTITVKKTCRC-GKNEIRTFCYNDD--VSCSRPCKKPLSYCNHFCQVPCH 550

Query: 571 VEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTKQVECGA 630
            +G+C+  C + CGL R  C H+CK KCHG++ CPE  C EK  ITC C  ++    C  
Sbjct: 551 SDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSSTKICSE 610

Query: 631 -THDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQLESIVLVAKKFDDLN 689
                     ++ L CDE+CAK QRH +LM AFG+ EK  + +++   +   ++ FDDL+
Sbjct: 611 YAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLAQRSQSFDDLH 670

Query: 690 MPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKELASAYALY 749
           +P++E VL+V+ KQ  WC QI     K ++D+   +LH KPMR  QR+F+ EL+S++ LY
Sbjct: 671 LPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHELSSSFGLY 730

Query: 750 SESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKERMQEHYSTKVTKTLIN 809
           SESQD EP RSVY+KK    S+ P + L  A+ LY  FK LE+E  + +  + VTK L++
Sbjct: 731 SESQDPEPKRSVYVKKT-GISRVPAIGLSKAAPLYTSFKKLERE-FKANSESAVTKKLVS 788

Query: 810 IPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRFLKDLNSVL 869
           +   ++P        NAI++SG+   +    +     D+   TL+  PQY  +       
Sbjct: 789 VHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQY--VVRGTEGY 846

Query: 870 IFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLSLVS 919
           IFP +Y  ++ N   D+ K+  + +   Q+Q L T +  C++D NL+ + 
Sbjct: 847 IFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNRIG 896

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/906 (46%), Positives = 584/906 (64%), Gaps = 23/906 (2%)

Query: 32  IPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLD 91
           + YYEQT+++I  GD+Y CMICT+E+D TC+MYAC SCYRVFDYEC++EWA KS +KT+D
Sbjct: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104

Query: 92  KSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHL 151
           K WKCPNC   + +IP + R TCWCGKV+NPD NEL PNSCGQTCN  +CVHGC   CHL
Sbjct: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164

Query: 152 GPHPECLIPVQIKCKCGKHCKQIPCSRSKVLG--NSYNCGDVCGLLLPCGKHTCQKTCHT 209
           GPH EC +   +KCKCG++ K I C + K     N Y C +VC L L CG H C++ CH+
Sbjct: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224

Query: 210 GFCGPCESIIKTE------------LPCYCGSDVKSGIQCSDLRVLD-YSKDVSGKKWIG 256
           G CG C  I+ +E              CYCG + K+ I C  L +   +SK+  G KWIG
Sbjct: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWIG 284

Query: 257 VYSCGEVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRR 316
            ++C   R + Y+C+ H+++E C A   I   + CP++PK L +CPCGKT LK+L + R+
Sbjct: 285 TFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKRK 344

Query: 317 KCTDTIPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHD 376
           KCTD IPTC N CGK L CGKHTCP+ CH G CMDPC+ +  T C+C  K FL PC    
Sbjct: 345 KCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFEQ 404

Query: 377 TPRCNIKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCN 436
           TP+C  KCES MSCRRH+C + CC+GKP A KR+K L  + +LN+E+LVE  H+CLK+CN
Sbjct: 405 TPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKECN 464

Query: 437 LKLSCGIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKIS 496
           LKLSCGIHDCT KCHPG+CP CL SD NDLVCPCGKTV+ APVRCG+KLPPCP  CIK+ 
Sbjct: 465 LKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKVI 524

Query: 497 EGPAPCGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGL 556
           E   PCGH+  PH+CHP+   CPPCTA V + C+C K H ++ +C       +CG  C  
Sbjct: 525 ERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCF--QEFGSCGEICNK 582

Query: 557 PLATCHHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVIT 616
            L  CHHKCQ KCH  G+C+  C + C   R+ C H CK KCHG+SPCP+  C+E   ++
Sbjct: 583 ELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVS 642

Query: 617 CDCNRRTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQLE 676
           C C R+ +  +C AT D  S S  E LPCDE+C    RH++L +AFG +     + + ++
Sbjct: 643 CKCGRKQEYRKCYATLDNSSAS-IELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQ 701

Query: 677 SIVLVAKK---FDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRV 733
            I  + +K   +++L +PY + V++ Y KQ+ WC QI  +  KF+ D  K +LH KPM+ 
Sbjct: 702 DIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKP 761

Query: 734 PQRQFIKELASAYALYSESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKE 793
            QR F++EL++++ LYSESQD EP RSV++K+ +  ++ P ++L++   L+  FK LEKE
Sbjct: 762 AQRHFVRELSTSFNLYSESQDPEPKRSVFVKR-KVDTRIPNISLEEVLPLWTGFKKLEKE 820

Query: 794 RMQEHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTL 853
           R  +H+ +   +  IN    E  + +  +  N   I  +      +++  +    LK TL
Sbjct: 821 RKIQHFESTSQRKYINYEPKEVIVKSSNDT-NGFFIKKISPGITEEDLSEVFGKALKSTL 879

Query: 854 VKTPQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDE 913
           +K   Y+ L + +  +I+PE Y+ IT++   D+E ++       ++ ++   + +C V+ 
Sbjct: 880 IKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEG 939

Query: 914 NLSLVS 919
            ++ +S
Sbjct: 940 YINQIS 945

>Ecym_7456 Chr7 complement(935231..938503) [3273 bp, 1090 aa] {ON}
           similar to Ashbya gossypii ADL307W
          Length = 1090

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 8/126 (6%)

Query: 673 EQLESIVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIED-TQKLSLHLKPM 731
           + L+S  L   K DDL + Y   ++ +Y++  NW D++    DK+  D  Q+L   ++  
Sbjct: 417 QNLQSFELALSKVDDLPIVYGLYLIELYRRD-NWFDEV----DKYYRDHHQELQGIIQKE 471

Query: 732 RVPQRQFIKELASAYALYSESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLE 791
              + +++ +  S   ++    D+    SV+LK    +SKK      D  E Y    TL 
Sbjct: 472 MAYRDKWLSDFLSFTDIFKWDDDKLQLPSVFLKGSTGESKKRIKITIDMIEEY--ISTLS 529

Query: 792 KERMQE 797
           K+   E
Sbjct: 530 KQNFSE 535

>TBLA0B09540 Chr2 (2264713..2265536) [824 bp, 274.666666666667 aa]
           {ON} Anc_2.323 YDL114W
          Length = 274

 Score = 33.1 bits (74), Expect = 2.8,   Method: Composition-based stats.
 Identities = 11/45 (24%), Positives = 25/45 (55%)

Query: 662 FGMNEKPKNTKEQLESIVLVAKKFDDLNMPYSELVLNVYKKQVNW 706
           F  +  P+    ++ S ++ +  F  ++MPY   ++ ++KK +NW
Sbjct: 212 FAPDVDPRRLANKIVSTIITSNNFKIISMPYYTRLIPIFKKNLNW 256

>KAFR0D00640 Chr4 (107585..108289) [705 bp, 234 aa] {ON} Anc_1.71
           YER018C
          Length = 234

 Score = 31.6 bits (70), Expect = 7.1,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 58/127 (45%), Gaps = 7/127 (5%)

Query: 672 KEQLESIVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPM 731
           +EQ++   L+  K ++    ++EL+ N    ++N        F+      Q  S  ++  
Sbjct: 2   EEQIDQFHLLKGKMEN----FAELIHNDMNLKMNTALNTVKTFENEKNKLQIESDSIRRQ 57

Query: 732 RVPQRQFIKELASAYALYSESQDREPNR--SVYLKKIQSQSKKPELTLKDASELYQLFKT 789
                Q  KELA   +L     D   NR  +  ++K Q  ++K +L LK++SEL  + K+
Sbjct: 58  IKELEQSEKELAEDISLNESETDEVKNRLQTYQIRKKQLIAQKEQL-LKESSELDNMIKS 116

Query: 790 LEKERMQ 796
            E E  +
Sbjct: 117 KETEAQE 123

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.454 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 99,947,199
Number of extensions: 4465718
Number of successful extensions: 12026
Number of sequences better than 10.0: 67
Number of HSP's gapped: 11293
Number of HSP's successfully gapped: 78
Length of query: 921
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 802
Effective length of database: 39,836,145
Effective search space: 31948588290
Effective search space used: 31948588290
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)