Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E08295g2.289ON26626614010.0
NDAI0G006802.289ON2552568011e-107
NCAS0G03850singletonON2512427481e-99
NCAS0G037702.289ON2512427481e-99
Ecym_33282.289ON2542447482e-99
CAGL0M06897g2.289ON2482427272e-96
ADL212W2.289ON2512387272e-96
KLTH0G10428g2.289ON2512447161e-94
Suva_14.3232.289ON2532407133e-94
Kwal_27.115132.289ON2512457117e-94
Skud_14.3052.289ON2492407082e-93
YNL024C2.289ON2462407002e-92
SAKL0E07612g2.289ON2522516994e-92
Smik_14.3072.289ON2462416977e-92
KNAG0H019802.289ON2492416916e-91
KAFR0H032902.289ON2452396854e-90
NCAS0J021504.352ON3221741712e-13
KAFR0C042501.325ON3911421511e-10
NCAS0B074101.325ON4141251483e-10
KAFR0E042804.352ON3151951465e-10
Suva_4.5321.325ON4161341458e-10
KLLA0E21539g1.325ON400861422e-09
CAGL0I09438g1.325ON4061361403e-09
Skud_10.3524.352ON3361881376e-09
Kpol_1066.171.325ON435931378e-09
Kwal_47.166354.352ON3221431368e-09
YBR271W (EFM2)1.325ON4191291379e-09
Skud_2.4031.325ON4171321361e-08
KNAG0C018001.325ON421921323e-08
TPHA0L003404.352ON3411841324e-08
NDAI0J028604.352ON3471741314e-08
Smik_2.4141.325ON4171271324e-08
NDAI0B047301.325ON4321441315e-08
TBLA0D052001.325ON3991641281e-07
SAKL0D06798g1.325ON4211301271e-07
Suva_12.2204.352ON3371811271e-07
TPHA0I026501.325ON4211331272e-07
Smik_10.4224.352ON3401801235e-07
TDEL0D019401.325ON4051881201e-06
ZYRO0G20548g1.325ON3971241191e-06
KLTH0D17996g4.352ON3171711191e-06
ZYRO0B14916g4.352ON2981641182e-06
YJR129C4.352ON3391741182e-06
Ecym_55131.325ON396911173e-06
KLTH0H10560g1.325ON4171291173e-06
KNAG0B067204.352ON2831241163e-06
Kpol_1028.814.352ON3361501121e-05
SAKL0G18106g4.352ON3351461074e-05
AER240W1.325ON3901481059e-05
AER161C4.352ON3161451003e-04
Kwal_14.25501.325ON4181271005e-04
KLLA0B04444g4.352ON308147960.001
TDEL0D006404.352ON327151950.001
CAGL0M00572g4.352ON327176930.003
Ecym_11274.352ON320138920.003
KAFR0A049006.79ON248187750.36
TBLA0B061504.352ON316133750.42
NDAI0B026403.135ON33392711.6
CAGL0M09801g6.79ON256230701.9
Kpol_1036.253.111ON277146702.0
NDAI0E039607.430ON77746702.7
AGR245C7.177ON50968693.3
ADL289C2.320ON72651675.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08295g
         (266 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   544   0.0  
NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   313   e-107
NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               292   1e-99
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   292   1e-99
Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   292   2e-99
CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   284   2e-96
ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   284   2e-96
KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   280   1e-94
Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   279   3e-94
Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   278   7e-94
Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   277   2e-93
YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   274   2e-92
SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   273   4e-92
Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   273   7e-92
KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   270   6e-91
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   268   4e-90
NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {O...    70   2e-13
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    63   1e-10
NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa] ...    62   3e-10
KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON...    61   5e-10
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    60   8e-10
KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]...    59   2e-09
CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} simila...    59   3e-09
Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {...    57   6e-09
Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {O...    57   8e-09
Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}...    57   8e-09
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    57   9e-09
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    57   1e-08
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    55   3e-08
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    55   4e-08
NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {...    55   4e-08
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    55   4e-08
NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa] ...    55   5e-08
TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa] ...    54   1e-07
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    54   1e-07
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    54   1e-07
TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {O...    54   2e-07
Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {...    52   5e-07
TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.3...    51   1e-06
ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]...    50   1e-06
KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} simil...    50   1e-06
ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa] ...    50   2e-06
YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON} ...    50   2e-06
Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar...    50   3e-06
KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {...    50   3e-06
KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {...    49   3e-06
Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON} (1820...    48   1e-05
SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]...    46   4e-05
AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-synte...    45   9e-05
AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON} Sy...    43   3e-04
Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {O...    43   5e-04
KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar...    42   0.001
TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.35...    41   0.001
CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar ...    40   0.003
Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to...    40   0.003
KAFR0A04900 Chr1 complement(968999..969745) [747 bp, 248 aa] {ON...    33   0.36 
TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4....    33   0.42 
NDAI0B02640 Chr2 (654702..655703) [1002 bp, 333 aa] {ON} Anc_3.1...    32   1.6  
CAGL0M09801g Chr13 complement(970260..971030) [771 bp, 256 aa] {...    32   1.9  
Kpol_1036.25 s1036 (60891..61724) [834 bp, 277 aa] {ON} (60891.....    32   2.0  
NDAI0E03960 Chr5 complement(877738..880071) [2334 bp, 777 aa] {O...    32   2.7  
AGR245C Chr7 complement(1206536..1208065) [1530 bp, 509 aa] {ON}...    31   3.3  
ADL289C Chr4 complement(192283..194463) [2181 bp, 726 aa] {ON} S...    30   5.3  

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/266 (100%), Positives = 266/266 (100%)

Query: 1   MSLLEVLTRDRKERTVLETCKAFIMGDVPFSSCFEELVPARPIEHLGKIDMSFNGKLPSP 60
           MSLLEVLTRDRKERTVLETCKAFIMGDVPFSSCFEELVPARPIEHLGKIDMSFNGKLPSP
Sbjct: 1   MSLLEVLTRDRKERTVLETCKAFIMGDVPFSSCFEELVPARPIEHLGKIDMSFNGKLPSP 60

Query: 61  LIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVG 120
           LIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVG
Sbjct: 61  LIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVG 120

Query: 121 LCVGLMDQANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFVKK 180
           LCVGLMDQANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFVKK
Sbjct: 121 LCVGLMDQANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFVKK 180

Query: 181 PVDLVLAADCVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKI 240
           PVDLVLAADCVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKI
Sbjct: 181 PVDLVLAADCVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKI 240

Query: 241 VEIRDFINFDKYLKQRTHLFQLMREK 266
           VEIRDFINFDKYLKQRTHLFQLMREK
Sbjct: 241 VEIRDFINFDKYLKQRTHLFQLMREK 266

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  313 bits (801), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 157/256 (61%), Positives = 197/256 (76%), Gaps = 16/256 (6%)

Query: 25  MGDVPFSSCFEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLC 84
           M D+ F S F++LV ARP+EHLG  D+SF G+L +PL I+EDGGESGCGGKVWIAGELLC
Sbjct: 1   MDDI-FGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLC 59

Query: 85  EYILEKSDKEHLLSHLFPDG-NCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDID 143
           E+ILEKS+ + LL+    +      ++ELGSGTGLVGLC+GL+++ N + D + YI+DID
Sbjct: 60  EFILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDID 119

Query: 144 QLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFV--------------KKPVDLVLAAD 189
           Q++ LM+ NIQ+NG++++V AE LWWG PL   F               +K VDL+LAAD
Sbjct: 120 QIVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSRDKEEDFREEKKVDLILAAD 179

Query: 190 CVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINF 249
           CVYLE AFPLLEKTLL+LT+GE  P ILMAY+KRRKADKHFFQKIKKNF IVEI+DF  +
Sbjct: 180 CVYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKY 239

Query: 250 DKYLKQRTHLFQLMRE 265
           + YLKQRTHLFQL+R+
Sbjct: 240 EYYLKQRTHLFQLIRQ 255

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  292 bits (748), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 149/242 (61%), Positives = 183/242 (75%), Gaps = 11/242 (4%)

Query: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93
           FE LV  RP+EHLG  D+SF GKL SPL I+EDGGESGCGGKVWIAGELLC++ILEKS  
Sbjct: 8   FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKSGT 67

Query: 94  EHLLSHLFPDG--NCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMES 151
           E LL+    DG     +VLELGSGTGLVGLCVGL+++   + +  V+I+DIDQL+ LM+ 
Sbjct: 68  EDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQLVPLMQR 127

Query: 152 NIQVNGLDDKVHAEVLWWGNPLPDVFVKKPVD---------LVLAADCVYLEAAFPLLEK 202
           NI++NG+  +V AE LWWG PL + F    VD         L+LAADCVYLE AFPLLE+
Sbjct: 128 NIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFPLLER 187

Query: 203 TLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQL 262
           TLL+LT+ E  P+ILM+Y+KRRKADKHFF KIKKNF ++E++DF  ++ YLK RTHLFQL
Sbjct: 188 TLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTHLFQL 247

Query: 263 MR 264
            R
Sbjct: 248 AR 249

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  292 bits (748), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 149/242 (61%), Positives = 183/242 (75%), Gaps = 11/242 (4%)

Query: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93
           FE LV  RP+EHLG  D+SF GKL SPL I+EDGGESGCGGKVWIAGELLC++ILEKS  
Sbjct: 8   FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKSGT 67

Query: 94  EHLLSHLFPDG--NCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMES 151
           E LL+    DG     +VLELGSGTGLVGLCVGL+++   + +  V+I+DIDQL+ LM+ 
Sbjct: 68  EDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQLVPLMQR 127

Query: 152 NIQVNGLDDKVHAEVLWWGNPLPDVFVKKPVD---------LVLAADCVYLEAAFPLLEK 202
           NI++NG+  +V AE LWWG PL + F    VD         L+LAADCVYLE AFPLLE+
Sbjct: 128 NIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFPLLER 187

Query: 203 TLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQL 262
           TLL+LT+ E  P+ILM+Y+KRRKADKHFF KIKKNF ++E++DF  ++ YLK RTHLFQL
Sbjct: 188 TLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTHLFQL 247

Query: 263 MR 264
            R
Sbjct: 248 AR 249

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  292 bits (748), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 150/244 (61%), Positives = 184/244 (75%), Gaps = 5/244 (2%)

Query: 25  MGDVPFSSCFEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLC 84
           M DV F+S FEELVP  PIEHLG  D+SF G+L  PL I EDGGESGCGGKVWIAGELLC
Sbjct: 1   MTDV-FASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLC 59

Query: 85  EYILEKSDKEHLLSHLFPDG-NCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDID 143
           +++LEKS    LLS    +G   N VLELGSGTGLVGLC+G+ +  +E +D +VYI+DID
Sbjct: 60  DFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDID 119

Query: 144 QLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFVKK--PVDLVLAADCVYLEAAFPLLE 201
            L  LM  N+++N L+ +VH   L+WG+ LP  F  K  PVDL+LAADCVYLE AFPLLE
Sbjct: 120 TLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKDSPVDLILAADCVYLEKAFPLLE 179

Query: 202 KTLLELTDGENV-PIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLF 260
             LLELT  + V P++LM+Y+KRRKADK FF KIKK+F I E+ DF  +D+Y+KQRTH+F
Sbjct: 180 MKLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRYDEYIKQRTHIF 239

Query: 261 QLMR 264
           QL+R
Sbjct: 240 QLVR 243

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  284 bits (727), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 145/242 (59%), Positives = 181/242 (74%), Gaps = 10/242 (4%)

Query: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93
           F +L+ +RP+EH+G+ D++FNG L   L I EDGGESGCGGKVWIAGELLCE+ILEKS  
Sbjct: 7   FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFILEKSRD 66

Query: 94  EHLLSHLFPDGNCN--SVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMES 151
             LL     D + +  +VLELGSGTGLVGLCVGL+ +       + YI+DIDQL+ LME 
Sbjct: 67  GELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYITDIDQLVPLMEK 126

Query: 152 NIQVNGLDDKVHAEVLWWGNPLPDVF--------VKKPVDLVLAADCVYLEAAFPLLEKT 203
           N+++N +D +V A+ L WG  LP  F            +DLVLAADCVYLE AFPLLEKT
Sbjct: 127 NVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLEKT 186

Query: 204 LLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLM 263
           LL+LT+ +N P+ILMAY+KRRKADKHFFQKI+KNF ++ I DF N+D+YLKQRTHLFQL+
Sbjct: 187 LLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQLV 246

Query: 264 RE 265
           R+
Sbjct: 247 RK 248

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  284 bits (727), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 147/238 (61%), Positives = 187/238 (78%), Gaps = 3/238 (1%)

Query: 30  FSSCFEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILE 89
           F++ FE+LV  RPIEHLG+ D+S+ G+L  PL I+EDGGESGCGGKVWIAG LLCE+ILE
Sbjct: 5   FTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILE 64

Query: 90  KSDKEHLLSHLFP--DGNCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLG 147
           KS    +LS  FP  +    +++ELGSGTGLVGLCVGL  + N  +D  VYI+DI+ L  
Sbjct: 65  KSKDGRVLSQ-FPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCP 123

Query: 148 LMESNIQVNGLDDKVHAEVLWWGNPLPDVFVKKPVDLVLAADCVYLEAAFPLLEKTLLEL 207
           LM+ N+++NGLD  VH   L+WG PL D F ++P+DLVLAADCVYLE AFPLLEKTLL+L
Sbjct: 124 LMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQPIDLVLAADCVYLEKAFPLLEKTLLDL 183

Query: 208 TDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMRE 265
           T GE+ P++LM+YKKRRKADK FF KIKK F I+EI+DF +++ Y +QRT+LFQL+R+
Sbjct: 184 TAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQRTYLFQLVRK 241

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  280 bits (716), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 144/244 (59%), Positives = 180/244 (73%), Gaps = 11/244 (4%)

Query: 30  FSSCFEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILE 89
           F++ F +LVP+RP+EH G  D++F G++   L I+EDGGESGCGGK+WIAGELLCEY+LE
Sbjct: 7   FTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLE 66

Query: 90  KSDKEHLLSH----LFPDGNCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQL 145
            SD   +LS     L  D    ++LELGSGTGLVGLC G + +AN   + +V+I+DIDQL
Sbjct: 67  NSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANG-GNAKVHITDIDQL 125

Query: 146 LGLMESNIQVNGLDDKVHAEVLWWGNPL-----PDVFVKKPVDLVLAADCVYLEAAFPLL 200
           + LME N+++NGL   V AE LWWG PL     PD    K  DLVLAADCVYLE AFPLL
Sbjct: 126 VRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNK-TDLVLAADCVYLETAFPLL 184

Query: 201 EKTLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLF 260
           EKTLL+LT GE  P++LM+Y+KRRKAD+ FF+ I+KNFK+V I  F   D +LKQRTHLF
Sbjct: 185 EKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLF 244

Query: 261 QLMR 264
           QL+R
Sbjct: 245 QLIR 248

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  279 bits (713), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 149/240 (62%), Positives = 181/240 (75%), Gaps = 9/240 (3%)

Query: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93
           FE+LV  R  EH G+ D+SF GKL   L I EDGGESGCGGKVWIAGELLCEYILEKSD 
Sbjct: 8   FEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSD- 66

Query: 94  EHLLSHLFPDGN-CNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMESN 152
           +HLLS    +      VLELGSGTGLVGLCVGL+++   + + +VY++DID+L+ LME N
Sbjct: 67  DHLLSETVHEKRPFMKVLELGSGTGLVGLCVGLLEKNKFHDNTKVYVTDIDRLVPLMERN 126

Query: 153 IQVNGLDDKVHAEVLWWGNPLPDVFVKKP-------VDLVLAADCVYLEAAFPLLEKTLL 205
           I+++ +  +V A  LWWG PL   F  +        VDLVLAADCVYLE AFPLLEKTLL
Sbjct: 127 IELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPLLEKTLL 186

Query: 206 ELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMRE 265
           +LT+  + P+ILMAYKKRRKADK FF KIK+NF ++EI+DFI FD YLKQ+THLFQL+R+
Sbjct: 187 DLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHLFQLVRK 246

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  278 bits (711), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 142/245 (57%), Positives = 187/245 (76%), Gaps = 13/245 (5%)

Query: 30  FSSCFEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILE 89
           F++ F +LVP+RP+EHLG  D+SF G++   L I+EDGGE+GCGGK+W+AGELLC+Y+LE
Sbjct: 7   FTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLE 66

Query: 90  KSDKEHLLSHLFPDGNCNS----VLELGSGTGLVGLCVGLMDQANEYSDR-EVYISDIDQ 144
            SD + +LS    + +  +    +LELGSGTGLVGLC G + Q   + DR +VYI+DID+
Sbjct: 67  NSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQL--HGDRTKVYITDIDR 124

Query: 145 LLGLMESNIQVNGLDDKVHAEVLWWGNPL-----PDVFVKKPVDLVLAADCVYLEAAFPL 199
           L+GLME+N+ +N L + V  E+L WG PL     PD    K VDLVLAADCVYLE AFPL
Sbjct: 125 LVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADK-VDLVLAADCVYLETAFPL 183

Query: 200 LEKTLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHL 259
           LEKTLL+LT+G+  P +LM+Y+KRRKADK+FF+ I+KNFKIV I +FI +D YLK++THL
Sbjct: 184 LEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHL 243

Query: 260 FQLMR 264
           FQL+R
Sbjct: 244 FQLVR 248

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  277 bits (708), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 148/240 (61%), Positives = 177/240 (73%), Gaps = 9/240 (3%)

Query: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93
           FE+LV  R  EHLG+ D+SF GKL   L I EDGGESGCGGKVWIAGELLCEYILEKS  
Sbjct: 8   FEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-L 66

Query: 94  EHLLSH-LFPDGNCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMESN 152
            HLLS           VLELGSGTGLVGLCVGL+++   +   +VY++DID+L+ L+E N
Sbjct: 67  HHLLSEATHGRRQFKKVLELGSGTGLVGLCVGLLEKNTFHDGSKVYVTDIDKLVPLLERN 126

Query: 153 IQVNGLDDKVHAEVLWWGNPLPDVFVKKP-------VDLVLAADCVYLEAAFPLLEKTLL 205
           I+++ +  +V A  LWWG PL   F  +        VDLVLAADCVYLE AFPLLE+TLL
Sbjct: 127 IELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLERTLL 186

Query: 206 ELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMRE 265
           +LT+  + P+ILMAYKKRRKADKHFF KIK+NF ++EI DF  FD YLKQRTHLFQL+R+
Sbjct: 187 DLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHLFQLIRK 246

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  274 bits (700), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 147/240 (61%), Positives = 177/240 (73%), Gaps = 9/240 (3%)

Query: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93
           F +LV  RP EHLG+ D+SF GKL   L I EDGGESGCGGKVWIAGELLCEYILEKS  
Sbjct: 8   FGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-V 66

Query: 94  EHLLSHLF-PDGNCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMESN 152
           +HLLS           VLELGSGTGLVGLCVGL+++   +   +VY++DID+L+ L++ N
Sbjct: 67  DHLLSKTVNGTKQFKKVLELGSGTGLVGLCVGLLEKNTFHDGTKVYVTDIDKLIPLLKRN 126

Query: 153 IQVNGLDDKVHAEVLWWGNPLPDVFVKKP-------VDLVLAADCVYLEAAFPLLEKTLL 205
           I+++ +  +V A  LWWG PL   F  +        VDLVLAADCVYLE AFPLLEKTLL
Sbjct: 127 IELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPLLEKTLL 186

Query: 206 ELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMRE 265
           +LT   N P+ILMAYKKRRKADKHFF KIK+NF ++EI DF  F+ YLK+RTHLFQL+R+
Sbjct: 187 DLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHLFQLIRK 246

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  273 bits (699), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 151/251 (60%), Positives = 193/251 (76%), Gaps = 11/251 (4%)

Query: 25  MGDV-PFSSCFEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELL 83
           M DV  F++CF +LVP+RP EHLG  D+SF GKL  PL I+EDGGESGCGGKVWIAGELL
Sbjct: 1   MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL 60

Query: 84  CEYILEKSDKEHLLSHLFPDGNCNS----VLELGSGTGLVGLCVGLMDQANEYSDREVYI 139
           CE++LEKSD++ L S    D    S    ++ELGSGTGLVGLC+GL+++ N+  D ++Y+
Sbjct: 61  CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYV 120

Query: 140 SDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFV-----KKPVDLVLAADCVYLE 194
           +DIDQL+ LM+ NI++N L+  V  + LWWG PL   F      ++ VDL+LAADCVYLE
Sbjct: 121 TDIDQLVTLMDRNIKLNELE-HVFPKELWWGEPLKPEFAPTRSNQRQVDLILAADCVYLE 179

Query: 195 AAFPLLEKTLLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLK 254
            AFPLLE TLL+LT  ++ PIILM+YKKRRKADKHFF++IKKNF ++EI +F  FD YLK
Sbjct: 180 KAFPLLEVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLK 239

Query: 255 QRTHLFQLMRE 265
           Q+THLFQL+R+
Sbjct: 240 QKTHLFQLVRK 250

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  273 bits (697), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 149/241 (61%), Positives = 180/241 (74%), Gaps = 11/241 (4%)

Query: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93
           F +LV  RP EHLG+ D+SF+GKL   L I EDGGESGCGGKVWIAGELLCEYILEKS  
Sbjct: 8   FGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKS-V 66

Query: 94  EHLLSHLFPDG--NCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMES 151
           +HLLS    DG      VLELGSGTGLVGLCVGL+++   +   +VY++DID+L+ L++ 
Sbjct: 67  DHLLSKTV-DGKKRFKKVLELGSGTGLVGLCVGLLEKNVYHDGTKVYVTDIDKLVPLLKR 125

Query: 152 NIQVNGLDDKVHAEVLWWGNPLPDVFVKKP-------VDLVLAADCVYLEAAFPLLEKTL 204
           NI+++ +  +V A  L WG PL   F  +        VDLVLAADCVYLE AFPLLEKTL
Sbjct: 126 NIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLEKTL 185

Query: 205 LELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMR 264
           L+LTD  + P+ILMAYKKRRKADKHFF KIK+NF ++EI +F  FD YLKQRTHLFQL+R
Sbjct: 186 LDLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHLFQLIR 245

Query: 265 E 265
           +
Sbjct: 246 K 246

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  270 bits (691), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 177/241 (73%), Gaps = 10/241 (4%)

Query: 34  FEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDK 93
           F +LV ARPIEH G  DMSF G+L   L I+EDGGESGCGGKVW+AGELLC+YI+EKSD+
Sbjct: 8   FGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCDYIVEKSDE 67

Query: 94  EHLLSHLFPDG--NCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMES 151
           + LL++          +++ELGSGTGLVGLCV L+++   +   +V I+DIDQL+ LM+ 
Sbjct: 68  DDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDIDQLVPLMQK 127

Query: 152 NIQVNGLDDKVHAEVLWWGNPLPDVFVK--------KPVDLVLAADCVYLEAAFPLLEKT 203
           NI++N ++ ++ AE LWWG PL   F            VDL+LAADCVYLE AFPLLEKT
Sbjct: 128 NIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEKAFPLLEKT 187

Query: 204 LLELTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLM 263
           LL+LT+    P+ILMAY+KRR ADK FF+KI K+F + EI DF  +D+YLKQRTHLF+L+
Sbjct: 188 LLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQRTHLFELI 247

Query: 264 R 264
           R
Sbjct: 248 R 248

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  268 bits (685), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 174/239 (72%), Gaps = 14/239 (5%)

Query: 37  LVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHL 96
           L+  RPIEHLG  D+SF+G+L   + I EDGG SGCGGKVWIAGELLCEY++EKSD E+L
Sbjct: 11  LIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCEYLIEKSDSENL 70

Query: 97  LSHLFPDGNCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMESNIQVN 156
           L     DG+  ++LELGSGTGLVG+CVGLM++   + D +V I+DI  L+ LME NI +N
Sbjct: 71  LC----DGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGGLVPLMERNILLN 126

Query: 157 GLDDKVHAEVLWWGNPLPDVFVKKPVD----------LVLAADCVYLEAAFPLLEKTLLE 206
            + D   A+ L WG  LP  ++   VD          LV+AADCVY E AFPLLEK LL+
Sbjct: 127 KIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAEKAFPLLEKILLD 186

Query: 207 LTDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMRE 265
           LT+ +N PIILMAY+KRRKADK FF +I+KNF ++EI DF + +KY+KQRTHLF+L R+
Sbjct: 187 LTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMKQRTHLFELKRK 245

>NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {ON}
           Anc_4.352
          Length = 322

 Score = 70.5 bits (171), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 88/174 (50%), Gaps = 16/174 (9%)

Query: 70  SGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGLMDQA 129
           +  G + W A   L +Y+++  D       L  D +  ++LELG+GTGLV L +  MD+ 
Sbjct: 120 NTTGFRTWAASVYLSKYLVDHEDA------LINDDD--NILELGAGTGLVSLTIASMDKM 171

Query: 130 NEYSDREVYISDIDQLL--GLMESNIQVN--GLDDKVHAEVLWWGNPLPDVFVKKPVDLV 185
            +   R +Y++D D  L  G M+ N Q+N   +D+ +  + LWW +  PD  + + V++V
Sbjct: 172 KDNKLRRMYVTDGDSELVSGQMQDNFQMNEVNVDNHIKLQKLWWNS--PDQPIPERVNVV 229

Query: 186 LAADCVYLEAAFPLLEKTLLE-LTDGENVPIILMAYKKRRKADKHFFQKIKKNF 238
           + AD  Y    F  L   L + L + E    ++ +  +  K DK  FQ   ++F
Sbjct: 230 IGADVTYDSTCFTDLCSCLRQCLLESECYKCLIASTIRNVKTDK-LFQSTVEHF 282

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 77/142 (54%), Gaps = 17/142 (11%)

Query: 56  KLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSG 115
           KL  P + N++      G K W +  +L   + ++ D+  L S      N   +LELGSG
Sbjct: 182 KLFEPSLTNDN-----LGWKTWGSSLILSNILCDRIDENFLKSF-----NGKRILELGSG 231

Query: 116 TGLVGLCVGL-MDQANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLP 174
           TGLVG+ V   +++     + E+Y++D+ +++  +E NI +N L ++V ++VL W N  P
Sbjct: 232 TGLVGISVASKLEEIGVLDEYEIYLTDLPEIVTNLEKNISINQLANRVVSDVLDWTN--P 289

Query: 175 DVFVKK----PVDLVLAADCVY 192
           + FV        D++L +D +Y
Sbjct: 290 ESFVSNYGDTRFDVLLISDPIY 311

>NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa]
           {ON} Anc_1.325 YBR271W
          Length = 414

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 67/125 (53%), Gaps = 11/125 (8%)

Query: 73  GGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLC-VGLMDQANE 131
           G K W A  +L + ++   +K     H+ P      VLELGSGTGLVG+       Q+  
Sbjct: 221 GWKTWGASLILSQKVVNLLEKNKDQKHIHP----LRVLELGSGTGLVGIAWASKWRQSFG 276

Query: 132 YSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFVKK----PVDLVLA 187
             + E++++D+  ++  ++ N+Q N L   V A++L W N  PD F++K      D++L 
Sbjct: 277 TENIEMFVTDLPDIVANLKKNVQTNDLTTFVEADILDWTN--PDDFIEKHGDEKFDVILV 334

Query: 188 ADCVY 192
           AD +Y
Sbjct: 335 ADPIY 339

>KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON}
           Anc_4.352 YJR129C
          Length = 315

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 91/195 (46%), Gaps = 23/195 (11%)

Query: 70  SGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGLMDQA 129
           S  G + W A   LC+YI    D E L         C++VLELG+GTGL  L   L+   
Sbjct: 113 STTGFRTWEAASYLCDYI-SNVDTESL-------NGCSTVLELGAGTGLCSL--TLLKGK 162

Query: 130 NEYSDREVYISDIDQLL--GLMESNIQVNGLDDKVHAEV-----LWWGNPLPDVFVKKPV 182
            +   ++VY++D D  L  G + SN ++N ++ ++  +V     LW  + +P+      +
Sbjct: 163 FQDDLKKVYVTDGDTELISGQLLSNFKLNEMEHEIGQKVKLQRLLWGEDSIPN-----DI 217

Query: 183 DLVLAADCVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRR-KADKHFFQKIKKNFKIV 241
           D V+ AD  Y +  F  L K L +  + E+  + L+A   R  + D+ F +    +   V
Sbjct: 218 DCVIGADVTYDDTLFDDLFKCLRQCFEIESCKMCLIASTIRNVETDRKFLEHCHDSDFKV 277

Query: 242 EIRDFINFDKYLKQR 256
           EI      D   K R
Sbjct: 278 EIIQSTELDPQSKAR 292

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 70/134 (52%), Gaps = 24/134 (17%)

Query: 73  GGKVW----IAGELLCEYILEKSDKEHLLSHLFPDGNCNS----VLELGSGTGLVGLC-V 123
           G K W    I  +LL +Y+       H  + + P  NC +    VLELGSGTGLVGL   
Sbjct: 218 GWKTWGSSLILSQLLVDYL-------HT-TGMPPAANCGTKRIKVLELGSGTGLVGLSWA 269

Query: 124 GLMDQANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFVKK--- 180
               +     + E+Y++D+ +++  ++ N+ +N L+D V AEVL W N  P  F+ +   
Sbjct: 270 AKWKELYGIHNIEIYVTDLPEIVTNLKKNVLLNNLEDFVQAEVLDWTN--PQNFINQFGH 327

Query: 181 --PVDLVLAADCVY 192
               D++L AD +Y
Sbjct: 328 EMDFDIILVADPIY 341

>KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 400

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 55/86 (63%), Gaps = 5/86 (5%)

Query: 109 VLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLW 168
           VLELGSGTGLVG+   L    N   D  ++++D+ ++L  ++ N+++N L+D V A+VL 
Sbjct: 240 VLELGSGTGLVGISYALTHSIN--GDSVIFLTDLPEILPNLQYNVRLNNLND-VTADVLD 296

Query: 169 WGNPLP--DVFVKKPVDLVLAADCVY 192
           W +PL   + +  +P D ++ AD +Y
Sbjct: 297 WTDPLSFTEKYGNEPFDTIVIADPIY 322

>CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} similar
           to uniprot|P38347 Saccharomyces cerevisiae YBR271w
          Length = 406

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 67/136 (49%), Gaps = 28/136 (20%)

Query: 71  GCGGKVW----IAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGLM 126
             G K W    I GE++  Y+         LS  F        LELG+GTGLVG+     
Sbjct: 209 NLGWKTWGSSLILGEIVVSYL-------ENLSSTFESNRKVRTLELGAGTGLVGIA---- 257

Query: 127 DQANEYSDR------EVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFVKK 180
             A ++ D+      E+Y++D+ +++  ++ N+++N L D   A+VL W N  PD F +K
Sbjct: 258 -WAAKWRDKFCNSKTEIYLTDLPEIVDNLKDNVKINNLQDIATADVLDWTN--PDTFTEK 314

Query: 181 ----PVDLVLAADCVY 192
                 D ++ AD +Y
Sbjct: 315 YGNERFDYIVIADPIY 330

>Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {ON}
           YJR129C (REAL)
          Length = 336

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 92/188 (48%), Gaps = 24/188 (12%)

Query: 67  GGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGLM 126
              S  G + W A   + ++++ K  ++  L         N VLE+G+GTG+V L   L+
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQQLALMQKEDRKKLN-VLEIGAGTGIVSLV--LL 183

Query: 127 DQANEYSDREVYISDIDQLLGLMESNIQVN-GLDDK-------VHAEVLWWG-NPLPDVF 177
           ++  E+ +R +Y++D D    L+E  ++ N  L+D        V  + LWWG + +PD  
Sbjct: 184 EKYREFVNR-MYVTDGDS--NLVERQLKRNFELNDALCENGPDVKLQRLWWGSDRIPD-- 238

Query: 178 VKKPVDLVLAADCVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRRKA-DKHFFQ---K 233
               +DLV+AAD  Y    FP L + L E        + L++   R ++ DK F Q   K
Sbjct: 239 ---DIDLVVAADVTYDSTIFPELCQCLAECLAISRCKMCLLSATIRSESTDKLFAQECNK 295

Query: 234 IKKNFKIV 241
           I  N+ +V
Sbjct: 296 IGLNYTVV 303

>Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {ON}
           complement(28462..29769) [1308 nt, 436 aa]
          Length = 435

 Score = 57.4 bits (137), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 52/93 (55%), Gaps = 9/93 (9%)

Query: 109 VLELGSGTGLVGLCVGL-------MDQANEYSDREVYISDIDQLLGLMESNIQVNGLDDK 161
           +LELG+GTGLVG+           +   N   + E+ ++D+ +++G ++ NI +N L+D 
Sbjct: 266 ILELGAGTGLVGISWSCKWKEMMKLTNGNNLPNTEIILTDLPEIVGNLQRNISINNLNDI 325

Query: 162 VHAEVLWWGNPLPDV--FVKKPVDLVLAADCVY 192
             A VL W NP   +  +  +  D++L AD +Y
Sbjct: 326 ARASVLDWTNPKSFIQEYSNEKFDIILVADPIY 358

>Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}
           YJR129C - Hypothetical ORF [contig 376] FULL
          Length = 322

 Score = 57.0 bits (136), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 71/143 (49%), Gaps = 28/143 (19%)

Query: 70  SGCGG-KVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGLMDQ 128
           SG  G + W A   L EY+++  ++E+     F     + +LELG+GTGLV L    + Q
Sbjct: 130 SGTTGFRTWEAALYLAEYLVQ--NQEYYAQDRF-----SRILELGAGTGLVSLVWSQLFQ 182

Query: 129 ANEYSDREVYISDIDQLL--GLMESNIQVNG--------LDDKVHAEVLWWG-NPLPDVF 177
           A     +E+Y++D D  L    +  N Q+N         LD +   + LWWG + +PD  
Sbjct: 183 ATM---KELYVTDGDSTLVEQAIRYNFQLNNVTAAPANTLDCQYKFQRLWWGEDVVPD-- 237

Query: 178 VKKPVDLVLAADCVYLEAAFPLL 200
               VD+VLAAD  Y  +  P L
Sbjct: 238 ----VDIVLAADVTYDASVVPSL 256

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 57.4 bits (137), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 70/129 (54%), Gaps = 11/129 (8%)

Query: 73  GGKVWIAGELLCEYILEKSDKEHLLS-HLFPDGNCNS--VLELGSGTGLVGLCVGL-MDQ 128
           G K W +  +L + +++  D  H  + ++  + +     VLELG+GTGLVGL   L   +
Sbjct: 218 GWKTWGSSLILSQLVVDHLDYLHTTNVNMLANSDIKQIKVLELGAGTGLVGLSWALKWKE 277

Query: 129 ANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFVKK-----PVD 183
                + E++++D+ +++  ++ N+ +N L D V AE+L W N  P  F+ K       D
Sbjct: 278 LYGTENIEIFVTDLPEIVTNLKKNVSLNNLGDFVQAEILDWTN--PHDFIDKFGHENEFD 335

Query: 184 LVLAADCVY 192
           ++L AD +Y
Sbjct: 336 VILIADPIY 344

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 70/132 (53%), Gaps = 20/132 (15%)

Query: 73  GGKVW----IAGELLCEYILEKSDKEHLLSHLFPDGNCNS----VLELGSGTGLVGLCVG 124
           G K W    I  +LL +Y+       H +  +    +CN     VLELGSGTGLVGL   
Sbjct: 219 GWKTWGSSLILSQLLVDYL-------HTVG-VHITASCNQKKIKVLELGSGTGLVGLSWA 270

Query: 125 LMDQANEYSDR-EVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNP--LPDVF-VKK 180
              +    +D+ E++++D+ +++  ++ N+ +N L D V AE+L W NP    D F  + 
Sbjct: 271 SKWKELYGTDKMEIFVTDLPEIVTNLKKNVSLNNLQDFVQAEILDWTNPQDFIDRFGHEN 330

Query: 181 PVDLVLAADCVY 192
             D++L AD +Y
Sbjct: 331 EFDIILVADPIY 342

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (60%), Gaps = 10/92 (10%)

Query: 109 VLELGSGTGLVGL---CVGLMDQANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAE 165
           VLELGSGTGLVG+   C        E S+ ++Y++D+ +++  ++ N+Q+N L+  V A+
Sbjct: 256 VLELGSGTGLVGISWACKWRELYGIEDSNLQIYLTDLPEIVDNLKKNVQLNKLEHAVVAD 315

Query: 166 VLWWGNPLPDVFVKK-----PVDLVLAADCVY 192
           VL W NP    F+++       DL+L AD +Y
Sbjct: 316 VLDWTNPY--NFIERYNGEQSFDLILVADPIY 345

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 89/184 (48%), Gaps = 30/184 (16%)

Query: 59  SPLIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGL 118
           SP +I+  G     G + W A   L +Y+++            P+    + LELGSGTG+
Sbjct: 131 SPYLISAAGTT---GFRTWEAAVYLTKYLIDLG--------FPPETVMENTLELGSGTGM 179

Query: 119 VGLCVGLMDQANEYSDR--EVYISDID-QLL-GLMESNIQVNGLD--DKVHAEVLWWG-N 171
           V   +GL+    +Y D+   +YI+D D QLL G +  N+ +NG+D  D V  + L W  +
Sbjct: 180 VS--IGLV---KKYKDQITTLYITDGDSQLLEGQLSRNVMLNGIDSSDSVKLQKLRWNED 234

Query: 172 PLPDVFVKKPVDLVLAADCVYLEAAFPLLEKTLLELTDGEN--VPIILMAYKKRRKADKH 229
            +PD      +DL++AAD  Y  +  P L   +L+     N    +  +A  +R +    
Sbjct: 235 HIPD-----NLDLIVAADVTYDSSVIPSLCHCILDCFKSSNKCSTVCYLAATRRNQETIA 289

Query: 230 FFQK 233
            F++
Sbjct: 290 VFEQ 293

>NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {ON}
           Anc_4.352 YJR129C
          Length = 347

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 78/174 (44%), Gaps = 15/174 (8%)

Query: 67  GGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGLM 126
            G+S  G + W     L ++++   +K +L+           V+ELG+GTGLV LC+   
Sbjct: 136 SGKSTTGFRTWEGAVYLSKFLINNCEK-YLIEK-------TDVIELGAGTGLVSLCILEN 187

Query: 127 DQANEYSDREVYISDIDQLL--GLMESNIQVNGL---DDKVHAEVLWWGNPLPDVFVKK- 180
           D        +VY++D D  L   ++  N ++N +   D+ V    LWW +P   +  +  
Sbjct: 188 DLQKGIKRDKVYVTDGDSELVSSILNKNFELNNVNIEDENVILRKLWWNDPNEKIAGEDN 247

Query: 181 -PVDLVLAADCVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRRKADKHFFQK 233
             + LV+ AD  Y  +  P L   L +  D       +++   R     +FF++
Sbjct: 248 GKIGLVVGADITYDNSVIPDLCACLKQFMDKNRDCKAIISATVRNIDTINFFER 301

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 10/127 (7%)

Query: 73  GGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNS---VLELGSGTGLVGLC-VGLMDQ 128
           G K W +  +L + ++   D+ H     F          VLELGSGTGLVGL       +
Sbjct: 219 GWKTWGSSLILSQLVV---DRLHTADMDFVANRGTKRIKVLELGSGTGLVGLSWASKWKE 275

Query: 129 ANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNP--LPDVF-VKKPVDLV 185
                + E++++D+  ++  ++ N+ +N L D V AE+L W NP    D F  +   D++
Sbjct: 276 LYGIDNTEIFVTDLPDIVTNLKKNVSLNNLQDFVQAEILDWTNPQSFIDRFGYENEFDII 335

Query: 186 LAADCVY 192
           L AD +Y
Sbjct: 336 LIADPIY 342

>NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa]
           {ON} Anc_1.325 YBR271W
          Length = 432

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 74/144 (51%), Gaps = 19/144 (13%)

Query: 56  KLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSG 115
           +L  P +  ++ G    G  + ++ EL+ +    K++K+          +   VLELG+G
Sbjct: 221 QLYEPSLTADNLGWKTWGSSLILSQELVNDLETNKNNKKS--------KSIRRVLELGAG 272

Query: 116 TGLVGL---CVGLMDQANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNP 172
           TGLVG+   C       NE    E++++D+  ++  +  N+Q N LDD V A+VL W N 
Sbjct: 273 TGLVGIAWACKWRQLYGNE--SIEMFVTDLPDIVTNLRKNVQNNDLDDFVVADVLDWTN- 329

Query: 173 LPDVFVKK----PVDLVLAADCVY 192
            P+ F+KK      D +L AD +Y
Sbjct: 330 -PEDFIKKYSDEKFDTILIADPIY 352

>TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa]
           {ON} Anc_1.325 YBR271W
          Length = 399

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 82/164 (50%), Gaps = 39/164 (23%)

Query: 109 VLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMESNIQVNGLD--DKVHAEV 166
           VLELGSGTGLVG+   +   +NE+S  +V+++D+ +++  + +N ++N L   + V A+V
Sbjct: 237 VLELGSGTGLVGITYTI-SHSNEFS--QVFLTDLPEIVPNLRTNAKLNDLSTHNSVIADV 293

Query: 167 LWWGNPLPDVFVKK----PVDLVLAADCVYLEAAFPLLEKTLLELTDGENVPIILMAYKK 222
           L W N   D FV+K      D++L AD +Y                     PI LM   K
Sbjct: 294 LDWTN--HDSFVEKYGDIQFDIILIADPIY-----------------SPQHPIWLMDTVK 334

Query: 223 RRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMREK 266
           R      F +K  +    + IR      KY K+R  L++++ EK
Sbjct: 335 R------FLKKNGEVHLELPIR-----TKYNKERETLWRIIEEK 367

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 67/130 (51%), Gaps = 17/130 (13%)

Query: 73  GGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVG--LMDQAN 130
           G K W A  +L + I  + +     S     GN   VLELGSGTGLVG+       +   
Sbjct: 220 GLKTWGASLILSQKICNRFN-----SIFAGTGNLLRVLELGSGTGLVGITFSCKYKESKT 274

Query: 131 EYSDREVYISDIDQLLGLMESNIQVNGLDDK----VHAEVLWWGNPLPDVFVKK----PV 182
                E+Y++D+ +++  ++ N+++N L+ +    V A+VL W NP+   F +K      
Sbjct: 275 ALGSCEMYLTDLPEIVPNLQKNVEINNLNSQSGLAVCADVLDWTNPVS--FTEKYGDDKF 332

Query: 183 DLVLAADCVY 192
           D++L AD +Y
Sbjct: 333 DVILIADPIY 342

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 87/181 (48%), Gaps = 25/181 (13%)

Query: 67  GGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCN-SVLELGSGTGLVGLCVGL 125
              S  G + W A   + ++++     E LL  +  D     +VLE+G+GTG+V L   L
Sbjct: 129 SAASTTGFRTWEAALYMGDFLMH----EPLLELVHGDDKKKLNVLEIGAGTGIVSLV--L 182

Query: 126 MDQANEYSDREVYISDIDQLLGLMESNIQVN-GLDDK-------VHAEVLWWG-NPLPDV 176
           + +  EY  + +Y++D D    L+E+ ++ N  L+D        +  + LWWG + +PD 
Sbjct: 183 LHKYREYVSK-MYVTDGDS--DLVETQLRRNFELNDAWREQSPDIRLQRLWWGSDRVPD- 238

Query: 177 FVKKPVDLVLAADCVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRR-KADKHFFQKIK 235
                V+LV+AAD  Y    FP L + L E     +  + L++   R    DK F Q+  
Sbjct: 239 ----EVNLVVAADVTYDSTIFPELCQCLAECLAMSHCKVCLLSATIRSYSTDKEFAQECH 294

Query: 236 K 236
           K
Sbjct: 295 K 295

>TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {ON}
           Anc_1.325 YBR271W
          Length = 421

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 64/133 (48%), Gaps = 19/133 (14%)

Query: 73  GGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCN----SVLELGSGTGLVGLCVG---- 124
           G K W +  +L +Y++   +K           NC+     VLELG+GTGLVG+  G    
Sbjct: 215 GWKTWGSSLVLSQYLINNFNK------YINVNNCHVRKVRVLELGAGTGLVGISWGCKWK 268

Query: 125 --LMDQANE-YSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNP--LPDVFVK 179
             +    NE   + E++++D+ ++   +  N+  N L D    +VL W +P    +   +
Sbjct: 269 EEVTSAGNENLQNMELFLTDLPEITNNLAKNVSTNELSDFCKVDVLNWTDPTSFTNTHTE 328

Query: 180 KPVDLVLAADCVY 192
           +P   +L AD +Y
Sbjct: 329 EPFQYILIADPIY 341

>Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {ON}
           YJR129C (REAL)
          Length = 340

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 82/180 (45%), Gaps = 18/180 (10%)

Query: 67  GGESGCGGKVWIAGELLCEYILEKSDKEHLLSH--LFPDGNCNSVLELGSGTGLVGLCVG 124
              S  G + W A   + ++++ K  +E  L+      D    +VLE+G+GTG+V L   
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQELALTQEEQEEDKKKLNVLEIGAGTGIVSL--- 183

Query: 125 LMDQANEYSDREVYISDID------QLLGLMESNIQVNGLDDKVHAEVLWWG-NPLPDVF 177
           ++ Q       ++Y++D D      QL    E N  ++     +  + LWWG + +PD  
Sbjct: 184 VLSQNYRNFVNKMYVTDGDSDLVERQLKKNFELNDALSEHKPDIRFQRLWWGSDKVPD-- 241

Query: 178 VKKPVDLVLAADCVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRRKA-DKHFFQKIKK 236
               +DLV+ AD  Y    FP L K L E        + L++   R ++ DK F Q+  K
Sbjct: 242 ---DIDLVVGADVTYDSTIFPELCKCLAECLAINRCKMCLLSATIRSESTDKLFAQECSK 298

>TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.325
           YBR271W
          Length = 405

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 83/188 (44%), Gaps = 29/188 (15%)

Query: 21  KAFIMGDVPFSSCFEELVPARPIEHLGKI-------DMSFNGKLPSPLIINEDG-GESGC 72
           K F   D P      + V  R  E+ G+          +F G LPSP+ I E        
Sbjct: 155 KHFENSDCPLRDEILKQVSLRIAENCGRTAQPAMSRKFTFEG-LPSPIEIYEPSLTADNL 213

Query: 73  GGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCN---SVLELGSGTGLVG---LCVGLM 126
           G K W A  +L + ++          ++  +   N    VLELGSGTGL G   LC  + 
Sbjct: 214 GWKTWGASFILSQKLI----------NVLAESTFNFKPRVLELGSGTGLAGISWLCKWVQ 263

Query: 127 DQANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNP--LPDVFVKKPVDL 184
              N ++  E++++D+  ++  ++ N++VN ++       L W +P    + +     D+
Sbjct: 264 KYGNGHT--EIFLTDLPVIVANLQKNVEVNKVESFATVSALDWTDPTDFINSYTDDEFDI 321

Query: 185 VLAADCVY 192
           ++ +D +Y
Sbjct: 322 LIVSDPIY 329

>ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 397

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 66/124 (53%), Gaps = 12/124 (9%)

Query: 73  GGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGLMD--QAN 130
           G K W +  +L + +++      ++ H  P    + VLELGSGTGL G+   LM   + +
Sbjct: 205 GWKTWGSSFILSQKLIK------IVPHFNP-TKLHRVLELGSGTGLAGIS-WLMKWIEIH 256

Query: 131 EYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNP--LPDVFVKKPVDLVLAA 188
             S+ E++ +D+ +++  +  N+++NG+ D    + L W  P    D +  +  D+++ +
Sbjct: 257 GNSNIEMFFTDLQEIVPNLRKNVEINGISDNSVVDTLDWTCPEDFVDKYSSEKFDIIIVS 316

Query: 189 DCVY 192
           D +Y
Sbjct: 317 DPIY 320

>KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} similar
           to uniprot|P47163 Saccharomyces cerevisiae YJR129C
           Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 317

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 75/171 (43%), Gaps = 27/171 (15%)

Query: 73  GGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGLMDQANEY 132
           G + W +   L EY+ E   +       F  G  +  LELG+GTGLV +    + +    
Sbjct: 124 GFRTWESALYLSEYLAENFPE-------FSAGKFSRALELGAGTGLVSIAWAKLFKG--- 173

Query: 133 SDREVYISDIDQLL--GLMESNIQVNGLDDK-VHAEV------LWWG-NPLPDVFVKKPV 182
             +E+ ++D D  L       N ++NG+D +  H +       LWWG + +P+      V
Sbjct: 174 YIKELIVTDGDSSLVEQAARVNFKLNGIDTRECHGDCAYKFQRLWWGEDAVPE------V 227

Query: 183 DLVLAADCVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRRKADKHFFQK 233
           D+VLAAD  Y  +  P L    L+    +     L+A   R K     F++
Sbjct: 228 DIVLAADVTYDSSVIPSLTH-CLKTALSQGTQFALVAATVRNKCTTMAFER 277

>ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa]
           {ON} weakly similar to uniprot|P47163 Saccharomyces
           cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 298

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 70/164 (42%), Gaps = 34/164 (20%)

Query: 73  GGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGLMDQANEY 132
           G + W A   LC+Y+     ++  L  +      N VLE+G+GTGLV   + L       
Sbjct: 117 GHRTWEASLYLCQYLF----RQDWLPQV------NEVLEIGAGTGLVSTALALAGHQVTS 166

Query: 133 SDRE-VYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFVKKP--VDLVLAAD 189
           +D + + +  + +   L E NI+         A+VL WG       ++KP   DLV+AAD
Sbjct: 167 TDGDPMVVEQLRKTFNLNEVNIE---------AQVLEWG-------LQKPPKSDLVVAAD 210

Query: 190 CVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRRKADKHFFQK 233
             Y  A  P L   L E          L+A   R      FFQ+
Sbjct: 211 VTYDTAVIPSLGNCLRECKT-----TALVACTIRNSETITFFQE 249

>YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON}
           Putative protein of unknown function; predicted
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 339

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 81/174 (46%), Gaps = 14/174 (8%)

Query: 67  GGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCN-SVLELGSGTGLVGLCVGL 125
              S  G + W A   + ++++ K  +E        DG    +VLE+G+GTG+V L +  
Sbjct: 127 SAASTTGFRTWEAALYMGDFLIHKPLQELAPVQGQDDGKKKLNVLEVGAGTGIVSLVI-- 184

Query: 126 MDQANEYSDREVYISDID------QLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFVK 179
           + + +E+ ++ +Y++D D      QL    E N +V   +  +  + LWWG+      V 
Sbjct: 185 LQKYHEFVNK-MYVTDGDSNLVETQLKRNFELNNEVRENEPDIKLQRLWWGSDR----VP 239

Query: 180 KPVDLVLAADCVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRRKADKHFFQK 233
           + +DLV+ AD  Y     P L + L E    +   + L++   R ++    F +
Sbjct: 240 EDIDLVVGADVTYDPTILPDLCECLAECLALDRCKLCLLSATIRSESTVQLFSQ 293

>Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar to
           Ashbya gossypii AER240W
          Length = 396

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 52/91 (57%), Gaps = 10/91 (10%)

Query: 106 CNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAE 165
           C  VLELG+GTGLVG+   +  QA   S  ++ ++D+  ++  + SNI++N L + VHA 
Sbjct: 237 CEKVLELGAGTGLVGISYAIAHQA---STPQIILTDLPDIVPNLRSNIKLNNLKN-VHAA 292

Query: 166 VLWWGNPLPDVFVKK----PVDLVLAADCVY 192
            L W +     F+ +      D++L +D +Y
Sbjct: 293 ELDWTD--HSTFIAQHGGDKFDMILVSDPIY 321

>KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 417

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 68/129 (52%), Gaps = 18/129 (13%)

Query: 73  GGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGL-MDQANE 131
           G K W A  +L   + E   K      L        +LELG+GTGLVG+ + L M ++N 
Sbjct: 217 GLKTWGASLVLARKLCENFSKFERQRDL-------RILELGAGTGLVGISLVLKMLESNS 269

Query: 132 YSDREVYISDIDQLLGLMESNIQVNGL----DDKVHAEVLWWGNPLPDVFVKK----PVD 183
             +  ++++D+ +++  ++ N+++N      D KV+A+VL W N  PD F K       D
Sbjct: 270 GHNCSMHLTDLPEIVTNLKENVKINCCNSRSDLKVYADVLDWTN--PDSFEKTYGAHKFD 327

Query: 184 LVLAADCVY 192
           ++L AD VY
Sbjct: 328 VLLIADPVY 336

>KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {ON}
           Anc_4.352 YJR129C
          Length = 283

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 10/124 (8%)

Query: 108 SVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQ--LLGLMESNIQVNGLDDKVHAE 165
           +VLELG GTGL  + VG++D   EY  +++Y++D D   L  +   N+ +N ++  V  +
Sbjct: 132 TVLELGCGTGLSSITVGVLD---EY--KKLYVTDGDTGILSEVTTPNLSLNKVERDVQCQ 186

Query: 166 VLWWGNPLPDVFVKKPVDLVLAADCVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRRK 225
            L W +   +  V   +D+V+ AD  Y    FP L   L E          ++A  +R +
Sbjct: 187 RLVWAS---EDRVPGDIDVVVGADITYDPTVFPELCTCLDECLQQPKCQCAILACTERNR 243

Query: 226 ADKH 229
              H
Sbjct: 244 ETVH 247

>Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON}
           (182083..183093) [1011 nt, 337 aa]
          Length = 336

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 75/150 (50%), Gaps = 22/150 (14%)

Query: 59  SPLIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGL 118
           +P +++  G     G + W A   +  + +E    + +        +  ++LELG+GTGL
Sbjct: 129 TPYVVSAAGT---TGFRTWEAALFMTSFFVETGYLDTM--------SKKNILELGAGTGL 177

Query: 119 VGLCVGLMDQANEYSDREVYISDIDQLL--GLMESNIQVNGL--DDKVHAEVLWWGNPLP 174
           V   +GL  Q  +  D+ +Y++D D  L  G +  N   N L  +D+V  + LWW   + 
Sbjct: 178 VS--IGLCKQYEDSIDK-IYVTDGDSQLVEGQLLKNFNENELSHNDRVILQKLWWN--VD 232

Query: 175 DVFVKKPVDLVLAADCVYLEAAFPLLEKTL 204
           DV +   +DL++AAD  Y  +  P L +T+
Sbjct: 233 DVPLD--LDLIVAADVTYDSSVVPDLCETI 260

>SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]
           {ON} similar to uniprot|P47163 Saccharomyces cerevisiae
           YJR129C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 335

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 71/146 (48%), Gaps = 20/146 (13%)

Query: 59  SPLIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGL 118
           +P +I   G     G + W A   L +++ + SD+  ++  L  D    +V+ELG+GTG+
Sbjct: 131 TPYLICASGT---TGFRTWEAALYLSQHLCKNSDE--IMDELGKDQI--TVVELGAGTGI 183

Query: 119 VGLCVGLMDQANEYSDREVYISDIDQLL--GLMESNIQVNGL-DDKVHAEVLWW-GNPLP 174
           V +    + Q N     ++Y++D D  L    M  N Q+N +   K   + LWW  + +P
Sbjct: 184 VSMTWAKL-QHNRL--EKLYVTDGDSSLVENQMHRNAQLNNVGGPKYCFQKLWWNSDDVP 240

Query: 175 DVFVKKPVDLVLAADCVYLEAAFPLL 200
           D       DL+LAAD  Y  +  P L
Sbjct: 241 D------NDLILAADVTYDSSVIPDL 260

>AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR271W
          Length = 390

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 72/148 (48%), Gaps = 21/148 (14%)

Query: 60  PLIINEDGGES-GCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGL 118
           P++++E    S   G K W A  LL   +   + K+              VLELG+GTGL
Sbjct: 195 PIVLHEPALTSDNLGLKTWGASLLLSRRVAGFTGKKR-------------VLELGAGTGL 241

Query: 119 VGLCVGLMDQANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFV 178
           VG+   L   AN  +D +V+++D+ +++  +  N+ +N L + V A VL W +P   +  
Sbjct: 242 VGIAYAL---ANIDAD-DVFVTDLPEIVPNLRHNLALNNLTN-VRASVLDWSDPTSFLHE 296

Query: 179 KKPV--DLVLAADCVYLEAAFPLLEKTL 204
              +  D +  AD +Y      LL +T+
Sbjct: 297 HGELQFDAIFVADPIYSPNHPQLLVQTV 324

>AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR129C
          Length = 316

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 59/145 (40%), Gaps = 31/145 (21%)

Query: 59  SPLIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGL 118
           +P +I   G     G + W A   L +Y+     ++ +             LELG+GTGL
Sbjct: 118 TPGVIAAAGT---TGHRTWEAALYLADYLCRVPLRQSV------------ALELGAGTGL 162

Query: 119 VGLCVGLMDQANEYSDREVYISDIDQLL--GLMESNIQVNGLDDKVHAEV--LWWG-NPL 173
           V L            +   YI+D D  L  G +  N+ +NGL     A +  LWW  + +
Sbjct: 163 VSLA-----WLRSRPESSAYITDGDSALLEGHLAENLALNGLRSSPRASLRRLWWNVDEV 217

Query: 174 PDVFVKKPVDLVLAADCVYLEAAFP 198
           P        D+VLAAD  Y     P
Sbjct: 218 PQ------NDIVLAADVTYDSTVLP 236

>Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {ON}
           YBR271W - Hypothetical ORF [contig 224] FULL
          Length = 418

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 14/127 (11%)

Query: 73  GGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLC-VGLMDQANE 131
           G K W A  +L   I +K      LS   P  N   +LELG+GTGLVG+  +  + +   
Sbjct: 221 GLKTWGASLVLARKICQK------LSTFEPSENLR-ILELGAGTGLVGIAFIQKILEVGS 273

Query: 132 YSDREVYISDIDQLLGLMESNIQVNGLDD----KVHAEVLWWGNP--LPDVFVKKPVDLV 185
                V+++D+  ++  ++ N+ +N  +     +V  +VL W +P    + +  K  D++
Sbjct: 274 TQKFRVHLTDLPDIVPNLQKNVDLNKCNREPNVEVAVDVLDWTDPSSFQEKYGYKKFDVL 333

Query: 186 LAADCVY 192
           L AD +Y
Sbjct: 334 LIADPIY 340

>KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 308

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 65/147 (44%), Gaps = 17/147 (11%)

Query: 68  GESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGLM- 126
            +   G + W A   LC Y+ +          LF   + + +LELG GTG++ +   ++ 
Sbjct: 110 AQGTTGFRTWEAALFLCHYMTQHPG-------LFVTHD-SLMLELGCGTGIISILYKMIK 161

Query: 127 DQANEYSDREVYISDID-QLLGLMESNIQVNGL-----DDKVHAEVLWWGNPLPDVFVKK 180
           D   +     + ++D D  LL  + +N Q+NG      D  +  + L W     ++    
Sbjct: 162 DSQGDCKAGTIIVTDGDSNLLQQVSTNFQLNGSLSNDGDVNIGFQRLRWNED--ELSNYN 219

Query: 181 PVDLVLAADCVYLEAAFPLLEKTLLEL 207
            +DL+LAAD  Y  +  P L K L + 
Sbjct: 220 EIDLILAADVTYDTSVIPDLVKCLSQF 246

>TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.352
           YJR129C
          Length = 327

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 65/151 (43%), Gaps = 24/151 (15%)

Query: 59  SPLIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGL 118
           +P +I+  G     G + W A   L  Y          L+   P    + VLELG+GTG+
Sbjct: 125 TPYLISASGT---TGFRTWEAALYLSLY----------LATSCPITEGSKVLELGAGTGM 171

Query: 119 VGLCVGLMDQANEYSDREVYISDID-QLLGLMESNIQVNGLD-DKVHAEVLWWG-NPLPD 175
           V   + L    N     ++Y++D D  L      N  +NG++    + E L W  +P+P 
Sbjct: 172 VSATLAL---TNPGRLDKLYVTDGDWHLTQQARKNFSLNGIETSNTYFEQLRWNEDPVP- 227

Query: 176 VFVKKPVDLVLAADCVYLEAAFPLLEKTLLE 206
                 +D V+AAD  Y     P L K + +
Sbjct: 228 ----TKLDYVVAADVTYDSTVVPDLCKCIAQ 254

>CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129c
          Length = 327

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 73/176 (41%), Gaps = 15/176 (8%)

Query: 68  GESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGLMD 127
                G + W A   L  Y++++     + +        + +LELGSGTGLV L   L  
Sbjct: 126 ANGSTGNRTWEAAVYLGLYLIDQCASNVVAAP-------SRILELGSGTGLVSL---LYQ 175

Query: 128 QANEYSDREVYISDIDQLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFVKK-PVDLVL 186
           Q   +    +   D D +   +  N+ +N L   +  + L WG    +    +   DL+L
Sbjct: 176 QLYPFDKLTMTDGDWDVVRKRIPGNLSLNDLKPGLEVKQLVWGPRDANSGDNQWDYDLIL 235

Query: 187 AADCVYLEAAFPLLEKTLLEL--TDGENVPIILMAYKKRRKADKHFFQKIKKNFKI 240
            +D  Y +     L + L  L  TDG N    L+    R +A    F+K  + +K+
Sbjct: 236 GSDLTYDDRILEPLCQALQWLLKTDGSNEA--LLGATVRNEATTALFEKYMREYKL 289

>Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to
           Ashbya gossypii AER161C
          Length = 320

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 64/138 (46%), Gaps = 30/138 (21%)

Query: 68  GESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGLMD 127
                G + W A   LC Y+ E   +              ++LELG+GTG+V L    + 
Sbjct: 126 ASGSTGFRTWEAALYLCHYLCESRPR------------FGTMLELGAGTGIVSLTWHKL- 172

Query: 128 QANEYSDREVYISDIDQ-LLG--LMESNIQVNGLD-DK--VHAEVLWWG-NPLPDVFVKK 180
           Q+ ++     Y +D D+ ++G  L E+ I  NG+D DK  VH + L W  + +P      
Sbjct: 173 QSGQFM---TYATDGDKNIIGKQLKETFIS-NGVDLDKGNVHLQRLLWNVDSIP------ 222

Query: 181 PVDLVLAADCVYLEAAFP 198
             D++LAAD  Y   A P
Sbjct: 223 KNDIILAADVTYDHTAIP 240

>KAFR0A04900 Chr1 complement(968999..969745) [747 bp, 248 aa] {ON}
           Anc_6.79 YLR285W
          Length = 248

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 71/187 (37%), Gaps = 42/187 (22%)

Query: 67  GGESGCGGKVWIAGELLCEYILEKSDKEHLLSH--LFPDGNCNSVLELGSGTGLVGLCVG 124
           G     G  +W AG         K    HL SH  L  D N   VLELG+   L  +   
Sbjct: 53  GSSPLWGHLLWNAG---------KYTAMHLESHPDLLLDKN---VLELGAAGALPSIISS 100

Query: 125 LMDQ----ANEYSDREVYISDIDQLLGLMESNIQVNGLD-DKVHAEVLWWGNPLPDVFVK 179
           L+        +Y D E+             SNI+ N  D      E   WGN   D+   
Sbjct: 101 LVGAKETVVTDYPDPELI------------SNIKHNCRDLSNARVEGYIWGNSYEDIL-- 146

Query: 180 KPVD------LVLAADCVYLEAAFPLLEKTLLELTDGENVPIILMAYKKRRKADK--HFF 231
            P D      L++ +D V+       L KT  +L D     +++ +  + +  D   HFF
Sbjct: 147 -PSDGSGKFQLIILSDLVFNHTEHYKLLKTTKDLLDKNGKALVVFSPHRPKLLDDDLHFF 205

Query: 232 QKIKKNF 238
           +K +K F
Sbjct: 206 EKAEKEF 212

>TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4.352
           YJR129C
          Length = 316

 Score = 33.5 bits (75), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 26/133 (19%)

Query: 67  GGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGLM 126
            G    G + W A   +  Y+LE   +          GN   V+E+G+GTG+V + +  M
Sbjct: 120 SGNGTTGLRTWEAALYMILYLLEHPVR----------GN---VVEIGAGTGMVSIGIMKM 166

Query: 127 DQANEYSDREVYISDIDQLLG--LMESNIQVNGL--DDKVHAEVLWWGNPLPDVFVK--- 179
              N  S   V ++D D+ +    +  N Q+NG+  D +V  + + W     D  V    
Sbjct: 167 QGQNISS---VLVTDGDEYVANKQLPKNFQLNGIVDDTRVKFQKIRWNE---DHLVNGDG 220

Query: 180 KPVDLVLAADCVY 192
             VD ++ AD  Y
Sbjct: 221 PNVDYLVGADVTY 233

>NDAI0B02640 Chr2 (654702..655703) [1002 bp, 333 aa] {ON} Anc_3.135
           YOL073C
          Length = 333

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 44/92 (47%), Gaps = 1/92 (1%)

Query: 50  DMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILEKSDKEHLLSHLFPDGNCNSV 109
           D  F   L   LI+N+D     CG   W+ G  + +++L   +K   L +++   N    
Sbjct: 174 DHFFLNTLIFILILNQDFVGIICGFVSWLCGVFVDKHLLPGLNKWR-LPYIWRYFNEYKS 232

Query: 110 LELGSGTGLVGLCVGLMDQANEYSDREVYISD 141
           ++  SGT  V   VG++  +N Y++ + + S 
Sbjct: 233 VQYTSGTNNVDPTVGIIMSSNTYNNGQQFSST 264

>CAGL0M09801g Chr13 complement(970260..971030) [771 bp, 256 aa] {ON}
           similar to uniprot|Q05874 Saccharomyces cerevisiae
           YLR285w
          Length = 256

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 95/230 (41%), Gaps = 31/230 (13%)

Query: 35  EELVPARPIEHLG---KIDMSFNGKLP-SPLIINEDGGESGCGGKVWIAGELLCEYILEK 90
           E+  P +P EH     +ID+    K   + L +   G     G  +W AG     ++   
Sbjct: 18  EDFRPEKPKEHYANYERIDVPDISKSKITNLKLQLVGSSPLWGHLLWNAGIYTARHL--- 74

Query: 91  SDKEHLLSHLFPDGNCN-SVLELGSGTGLVGLCVGLMDQANEYSDREVYISDID-QLLGL 148
            DK       +P+   N +VLELG+ + L  L  GL+      + R V     D  L+  
Sbjct: 75  -DK-------YPELVSNKNVLELGAASALPSLVAGLIG-----AKRAVVTDYPDADLMAN 121

Query: 149 MESNIQV---NGLDDKVHAEVLWWGNPLPDVFVK----KPVDLVLAADCVYLEAAFPLLE 201
           ++ N+     + L + V  E   WGN    + +     K  DL++ +D V+       L 
Sbjct: 122 IQYNVNTIIPDELKENVRVEGYIWGNEYDPLTIHLDGDKKFDLIILSDLVFNHNQHDKLL 181

Query: 202 KTLLEL--TDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINF 249
           +T  +L  T+G+ + +         +AD  FF+  K+     E  + +N+
Sbjct: 182 QTTKDLLATNGKALVVFSPHRPHLLEADLQFFETCKEYGLTPEKIEMVNW 231

>Kpol_1036.25 s1036 (60891..61724) [834 bp, 277 aa] {ON}
           (60891..61724) [834 nt, 278 aa]
          Length = 277

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 61/146 (41%), Gaps = 13/146 (8%)

Query: 23  FIMGDVPFSSCFEELVPARPIEHLGKIDMSFNGKLPSP-LIINEDGGESGCGGKVWIAGE 81
           FI G+ P S    + V  + +  LG+I      +  SP   +N +      G + +   +
Sbjct: 108 FIKGETPSSDV--DGVDPQELSFLGRIVQKITDRFKSPSWQVNPERITEFKGRRDFDGLK 165

Query: 82  LLCEYILEKSDKEHLLSHLFPDGNCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISD 141
              E +  +  KEH++S +  DG+CN       G         L D  N  S ++     
Sbjct: 166 NFIETVKGQVKKEHMISTILNDGDCNESELCKIGKAY------LHDTLNNISTKKA---- 215

Query: 142 IDQLLGLMESNIQVNGLDDKVHAEVL 167
           +DQ    +E+ I+ N +D++   + L
Sbjct: 216 VDQERMKLENIIKNNKVDEEAEQKAL 241

>NDAI0E03960 Chr5 complement(877738..880071) [2334 bp, 777 aa] {ON}
           Anc_7.430
          Length = 777

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 22/46 (47%)

Query: 44  EHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILE 89
           E L ++D+   GK+   LI  ED   SGCG  +  A  +    I E
Sbjct: 609 ECLARLDVCMGGKIAEELIFGEDNVTSGCGSDLRTATNMARAMITE 654

>AGR245C Chr7 complement(1206536..1208065) [1530 bp, 509 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR255W
          Length = 509

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 191 VYLEAAFPLLEKTLLELTDGENV-------PIILMAYKKRRKADKHFFQKIKKNFKIVEI 243
           VYLE  + LL K++     G +        P+  +  +K RK  KH+   I+    I+ I
Sbjct: 80  VYLEIYYLLLNKSVTRGDAGSSAGVEGVYNPLQTIRNRKLRKVYKHYPSAIQVGSPIIAI 139

Query: 244 RDFINFDK 251
           +DF + +K
Sbjct: 140 KDFSHSNK 147

>ADL289C Chr4 complement(192283..194463) [2181 bp, 726 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL116W
           (NUP84)
          Length = 726

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 96  LLSHL--FPDGNCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQ 144
           +L+HL  F D  C  V+E G  + LV   V L++   +Y    VYIS +D+
Sbjct: 389 ILTHLVIFLDKACPGVIEEGDKSKLVTTYVSLLNLYEQYDLVPVYISCLDE 439

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.141    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,819,927
Number of extensions: 1392393
Number of successful extensions: 3318
Number of sequences better than 10.0: 68
Number of HSP's gapped: 3357
Number of HSP's successfully gapped: 68
Length of query: 266
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 158
Effective length of database: 41,097,471
Effective search space: 6493400418
Effective search space used: 6493400418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)