Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E08273g2.290ON26126113800.0
SAKL0E07590g2.290ON2602618911e-121
NDAI0B035402.290ON2612588371e-113
Smik_9.862.290ON2642468361e-113
KLTH0G10450g2.290ON2612628251e-111
Suva_9.1062.290ON2642578241e-111
YIL093C (RSM25)2.290ON2642468241e-111
Skud_9.802.290ON2642468201e-110
Ecym_33292.290ON2582618191e-110
TBLA0B059602.290ON2662478071e-108
Kpol_1003.402.290ON2612637901e-106
Kwal_27.115092.290ON2612367901e-106
ZYRO0A01958g2.290ON2632617831e-105
TDEL0G022002.290ON2612637791e-104
NCAS0B062402.290ON2602417731e-103
KNAG0A054102.290ON2662427491e-99
KAFR0J013502.290ON2642477456e-99
CAGL0D04158g2.290ON2722577014e-92
TPHA0C034202.290ON2682556936e-91
ADL211C2.290ON2251916089e-79
TDEL0B046308.148ON16273682.3
KAFR0A067305.587ON120141667.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08273g
         (261 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   536   0.0  
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   347   e-121
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   327   e-113
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   326   e-113
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   322   e-111
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   322   e-111
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   322   e-111
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   320   e-110
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   320   e-110
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   315   e-108
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   308   e-106
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   308   e-106
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   306   e-105
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   304   e-104
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   302   e-103
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   293   1e-99
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   291   6e-99
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   274   4e-92
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   271   6e-91
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   238   9e-79
TDEL0B04630 Chr2 complement(824601..825089) [489 bp, 162 aa] {ON...    31   2.3  
KAFR0A06730 Chr1 (1362270..1365875) [3606 bp, 1201 aa] {ON} Anc_...    30   7.3  

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/261 (100%), Positives = 261/261 (100%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120
           PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI
Sbjct: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120

Query: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180
           LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI
Sbjct: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180

Query: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240
           QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS
Sbjct: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240

Query: 241 WTNETEEEQKPIDQDVEEIQL 261
           WTNETEEEQKPIDQDVEEIQL
Sbjct: 241 WTNETEEEQKPIDQDVEEIQL 261

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  347 bits (891), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 170/261 (65%), Positives = 215/261 (82%), Gaps = 1/261 (0%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MKVQ  AVN+LERTSAYL++G+L K PAWYNV+A VPP+K FAR P++T+P N K+  +L
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120
            +YS      +G YKTR +  ++K   +KLY++PKL Y EDKLR+LF+QQHPWELSRPK+
Sbjct: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120

Query: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180
           L+ENT E + YDWS IQQLGKPLDGESVVQRTL+LLK  ++  L++AYDQARFEFYR+R+
Sbjct: 121 LIENTGE-ESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRV 179

Query: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240
           QQEI +QVAQEEAEMFGSVF ++SIEYG+ KEQKVI+TWK+KA+QQ ELMAAR+S PSA+
Sbjct: 180 QQEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPSAA 239

Query: 241 WTNETEEEQKPIDQDVEEIQL 261
           W N  E  ++ ++QDVEE+QL
Sbjct: 240 WENAAEANEESVEQDVEELQL 260

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  327 bits (837), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 202/258 (78%), Gaps = 9/258 (3%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MK+Q  AVN++ERTSAYL SG+L+ TPAWY+V+A +PPTKKF R P++T+P  G+++T  
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60

Query: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120
            D    + N+ GLYKTR N +++KD A+ LY+ PKL+Y+ED+LR LFF+QHPWELSRPKI
Sbjct: 61  KD-DRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKI 119

Query: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180
           L+EN+LE + +DWSHIQQ  K LDGESVVQRTL+LLK+     ++ AY++ARFEFYRLRI
Sbjct: 120 LIENSLE-ENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRI 178

Query: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240
           QQ+I  QVAQEEAEMFGS+F  TS E+GI KEQKVI+ WK+KA+Q+ +LM  R+S+PS S
Sbjct: 179 QQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDS 238

Query: 241 WTNETEEEQKPIDQDVEE 258
           W         P +QD+EE
Sbjct: 239 WA-------APEEQDLEE 249

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  326 bits (836), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 147/246 (59%), Positives = 196/246 (79%), Gaps = 1/246 (0%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MK+Q  AVNVL+RTSAYLKSG+LK TPAWYNV+A +PP+ KF R P   +P NG +   L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  PDY-SNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPK 119
            D   N   NS+GLYKTRPN+ +K+ G  KLY+ PKL Y+ED+LR LF++QHPWELSRPK
Sbjct: 61  VDVIENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSRPK 120

Query: 120 ILVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLR 179
           ILVEN +  ++YDWSH+ QLGKPLDGESV+QRT++LLK+ + +  ++AYD AR+EFY LR
Sbjct: 121 ILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYALR 180

Query: 180 IQQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSA 239
           +Q+E Q QVA EEAEMFGS+F  ++IE+GI KEQ+V++ W++K +++ ELMAAR+S+P+ 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSSNPAG 240

Query: 240 SWTNET 245
           SW ++T
Sbjct: 241 SWKDDT 246

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  322 bits (825), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 207/262 (79%), Gaps = 2/262 (0%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MKVQQ AVNVLERTS+YLK+G+LKKTPAWY+V+A VPP+K+F R P+L +P   K    L
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120
            +++   +  +  YKTR +  E++   SKL+ +PKL Y EDKLR++F++QHPWELSRPK+
Sbjct: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120

Query: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180
           LVEN+  T +YDWS IQQLGKPLDGESVVQRTL+LL++   +EL+ AYDQARFEFYRLRI
Sbjct: 121 LVENS-GTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRI 179

Query: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240
           Q+E+Q+QVAQEEAEMFGSVF  ++I++G+ KEQK+ID WK+KA+ Q E+M+AR  +PS S
Sbjct: 180 QEEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSES 239

Query: 241 WT-NETEEEQKPIDQDVEEIQL 261
           W+  E++ +     +D +E+QL
Sbjct: 240 WSAQESQPQSDAKAEDTKELQL 261

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  322 bits (824), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 148/257 (57%), Positives = 203/257 (78%), Gaps = 5/257 (1%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MK+Q  AVNVL+RTSAYLKSG+LK TPAWYNV+A +PP+ KF R P+  +P NG+    L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 61  PDYS-NWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPK 119
            D +   +AN++GLYKTRPN  +++ G  KLY+ PKL Y+ED+LR LF++QHPWELSRPK
Sbjct: 61  VDVTERQQANANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSRPK 120

Query: 120 ILVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLR 179
           ILVEN +  + YDWSH+ QLGK LDGESV+QRT+ LLK+ + K++++AYD AR+EFY LR
Sbjct: 121 ILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYALR 180

Query: 180 IQQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSA 239
           +++E Q QVA EEAEMFGS+F  +SIE+GI KEQ+V+D W++K +++ ELMAAR+S+P+ 
Sbjct: 181 MEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSSNPAG 240

Query: 240 SW----TNETEEEQKPI 252
           SW    T +T ++++P+
Sbjct: 241 SWKDDATLDTAQDEEPV 257

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  322 bits (824), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 196/246 (79%), Gaps = 1/246 (0%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MK+Q  AVNVL+RTSAYLKSG+LK+TPAWYNV+A +PP+ KF R P+  +P NG     L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  PDYSNW-KANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPK 119
            D +    AN+ GLYKTRPNS +K+ G  +LY+ PKL Y+ED+LR LF++QHPWELSRPK
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 120 ILVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLR 179
           ILVEN +  + YDWSH+ Q+G+PLDGESV+QRT++L+K+ +  ++++AYD AR+EFY LR
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 180 IQQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSA 239
           +Q+E + QVA EEAEMFGS+F  ++IE+GI KEQ+V+D W++K +++ ELMAAR S+P+ 
Sbjct: 181 MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNPAG 240

Query: 240 SWTNET 245
           SW ++T
Sbjct: 241 SWKDDT 246

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  320 bits (820), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 144/246 (58%), Positives = 197/246 (80%), Gaps = 1/246 (0%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MK+Q  AVNVL+RTSAYLKSG+LK+TPAWYNV+A +PP+ KF R P+  +P NG +   L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  PDYSNWK-ANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPK 119
            D +  + AN +GLYKTRPN+ +K+    KLY+ PKL Y+ED+LR LF++QHPWELSRPK
Sbjct: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120

Query: 120 ILVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLR 179
           ILVEN +  ++YDW  + QLGKPLDGESVVQRT+ LLK+ + +++++AYD AR+EFY LR
Sbjct: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180

Query: 180 IQQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSA 239
           +Q+E Q QVA EEAEMFGS+F  ++IE+GI KEQ+V+D W++K +++ ELMAA++S+P+ 
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240

Query: 240 SWTNET 245
           SW ++T
Sbjct: 241 SWKDDT 246

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  320 bits (819), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 154/261 (59%), Positives = 201/261 (77%), Gaps = 3/261 (1%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MK+Q  A N+LERTS++L+ G+L +TP WY+VI K PP+ KFAR P+L +P  G     L
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120
            ++S+ + +SSG YKTR N  EK+   S +Y++PKL Y EDKLR LF++QHPWELSRPKI
Sbjct: 61  REFSDNRNSSSGTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRPKI 120

Query: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180
           LVEN  + +++DWS IQQLGKPLDGESVVQRTL+LL SGE   LIDAYDQARFEFYRLR+
Sbjct: 121 LVENQGD-EKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLRM 179

Query: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240
           QQE+++QVAQEEA M GSVF  +++E+G+ KEQ+VID WK+KAL+Q ELM+A+ S  SA+
Sbjct: 180 QQELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRSDQSAN 239

Query: 241 WTNETEEEQKPIDQDVEEIQL 261
           W   T E+      ++EE++L
Sbjct: 240 WG--TREDNANDAVEIEELEL 258

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  315 bits (807), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 147/247 (59%), Positives = 194/247 (78%), Gaps = 1/247 (0%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MK+QQ AVNVLERTSAYL++G++KK P WY+V+A  PP+KKF R P+  +P   K     
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120
               ++   ++GLYKTR NS++KK+  S LY+ PKL YIEDKLRKLF++QHPWEL+RPKI
Sbjct: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120

Query: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180
           ++EN  E   YDWS + QLGKPLDGESVVQRTLFLLK+ E ++LIDAY+QARFEFYRLR+
Sbjct: 121 VMENHGEVT-YDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRM 179

Query: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240
            +EIQ+QVAQEE+EMFG+VF +T+IE+GI KEQ++ID+WK +A+++ E+  A+ S  S S
Sbjct: 180 AEEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVS 239

Query: 241 WTNETEE 247
           W  ++ E
Sbjct: 240 WKTDSLE 246

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  308 bits (790), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 157/263 (59%), Positives = 209/263 (79%), Gaps = 4/263 (1%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MK+Q+ AVNVLERTSAYL++G+L K PAWYNV+A VPP KKF R P+LT+P N +    L
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120
               +  A ++G++KTR  + ++ + + +LY + KL YIED+LR++F++QHPWELSRPKI
Sbjct: 61  HSLDS-SAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119

Query: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180
           L+EN  + ++YDWSH+QQ+GKPLDGESVVQRTL+L+K+ E   L+ AYD AR+EFYRLR+
Sbjct: 120 LIENNGD-EKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRM 178

Query: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240
           QQ I++QVAQEEAEMFGSVF  ++IEYGI KEQKVIDTWKRKA+ Q E+MAAR  +PS S
Sbjct: 179 QQHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSES 238

Query: 241 WTNETEEEQK--PIDQDVEEIQL 261
           W  + ++ +K   I++DVEEI+L
Sbjct: 239 WATDEKDPKKNDDIEEDVEEIKL 261

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  308 bits (790), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 146/236 (61%), Positives = 191/236 (80%), Gaps = 1/236 (0%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MKVQQ AVNVLERTS+YL++GILKKTPAWY V+A++PP+K+F R P+L +P        L
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120
            ++       +  YKTR +  +K+   +KLY++PKL Y EDKLR+LFF+QHPWELSRPK+
Sbjct: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120

Query: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180
           LVEN+   Q+YDWS +QQLGKPLDGESVVQRTL+LLKS + +EL+ AYDQARFEFYRLRI
Sbjct: 121 LVENS-GIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRI 179

Query: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASS 236
           Q+E+Q+QVAQEEAEM GSVF  ++I++G+ KEQK+ID WK+KA+ Q+EL++AR ++
Sbjct: 180 QEEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTN 235

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  306 bits (783), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 145/261 (55%), Positives = 200/261 (76%), Gaps = 3/261 (1%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MK+Q  AVNVLERTSAYL+SG+L++TPAWY V+A VPPT KF R  +  +P  GK     
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120
            ++     N  G YKTR +S ++K   S+LY++PKL ++ED+LR++F+QQHPWE SRPK+
Sbjct: 61  KEFDE-GINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119

Query: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180
           LVEN +  + +DWS++ QLGKPLDGESVVQRT++LL+   +  +IDAYD+ RFEFYRLR+
Sbjct: 120 LVENEI-NENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRM 178

Query: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240
           Q+EI+ QVAQEEAEMFGSVF +++I+YG+ +EQ+VID WK+KA+++ EL+AAR +SP+ S
Sbjct: 179 QEEIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAES 238

Query: 241 WTNETEE-EQKPIDQDVEEIQ 260
           W  E +E E    D+D +E +
Sbjct: 239 WGQEKQEGEPNKSDEDGQETE 259

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  304 bits (779), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 153/263 (58%), Positives = 213/263 (80%), Gaps = 4/263 (1%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MK+Q  AVNVLERTSAYL+SG+L+ TPAWY+V+A +PP  KF R P+L +P N K    L
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120
            D+++ + N+ G +KTR ++L+KK   +KLY++PKL ++ED+LR++F++QHPWELSRPK+
Sbjct: 61  KDHAD-EPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119

Query: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180
           LVEN  E +E+DWSHIQQL KPLDGESV+QRTLFLLK+ E K L +AYDQARFEFYRLR+
Sbjct: 120 LVENDAE-EEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRM 178

Query: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240
           QQE++ QVAQEE+EMFGS++  ++I++G+ +EQK ID WK+KA+++ +L+AAR ++PS +
Sbjct: 179 QQEVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEA 238

Query: 241 W-TNETEEEQKPI-DQDVEEIQL 261
           W   E + ++K + DQD+EEI L
Sbjct: 239 WAAGEEQPDKKDLEDQDIEEIVL 261

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  302 bits (773), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 156/241 (64%), Positives = 196/241 (81%), Gaps = 3/241 (1%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           M+VQ  A+N++ERTSAYLKSG+LK TPAWY V+AK+PPTKKF R P+L +P   +    L
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60

Query: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120
            D +    N  G YKTRPN L++K  ++KLY+ PKL Y+ED+LR LFF QHPWELSRPKI
Sbjct: 61  RD-NREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKI 119

Query: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180
           LVEN+LE + +DWSHIQQLGKPLDGESVVQRT++LLK+ +K ++I AY+QARFEFYR RI
Sbjct: 120 LVENSLE-ERFDWSHIQQLGKPLDGESVVQRTMYLLKT-DKMDMITAYNQARFEFYRFRI 177

Query: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240
           QQE+++QVAQEEAEMFGSVF+ + I++GI KEQKVI  WK+KA Q+ EL+AAR ++PS S
Sbjct: 178 QQEVEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDS 237

Query: 241 W 241
           W
Sbjct: 238 W 238

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  293 bits (749), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 136/242 (56%), Positives = 184/242 (76%), Gaps = 1/242 (0%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MK+Q  AVN+LERTSA+L+SG+++K PAWYNV+A  PP KKF R P   +P  GK+R  L
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120
             + + K N+  +YKTR +  +K+   + LY+ PKLVY+ED+LR+LF+ QHPWE SRP I
Sbjct: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120

Query: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180
           L+EN + T ++DWS IQQLGK LDGESVVQR LFLL+ G    L  AYD+ARFEFYR+R+
Sbjct: 121 LIENNV-TPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRM 179

Query: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240
           QQE+++Q++QEEA M+GSV+  ++IE+G+ KE KVI+TWKR+ +++ E M AR +SPS S
Sbjct: 180 QQELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPSES 239

Query: 241 WT 242
           W 
Sbjct: 240 WN 241

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  291 bits (745), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 133/247 (53%), Positives = 187/247 (75%), Gaps = 7/247 (2%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRT-- 58
           MK+Q  A N+LERTSAYL++G+L+  PA+Y+VIA+VPP+ KF R P+L +P  G+ RT  
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 59  -ALPDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSR 117
             L D  NW+    GLYKTR  + ++    S+LY++ +L Y+ED LR+LF+ QHPWELSR
Sbjct: 61  RELTDKVNWR----GLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSR 116

Query: 118 PKILVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYR 177
           PKI++EN ++    DWS+IQQLGKP+DGESVVQRTLFL+K+ +   L D YDQARFEFY+
Sbjct: 117 PKIVIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQ 176

Query: 178 LRIQQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSP 237
           +R+Q++ ++Q+A EEA MFGS+F  T++EYGI +EQ VI  WK++A+++ EL+ A+ ++P
Sbjct: 177 VRMQRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANP 236

Query: 238 SASWTNE 244
           S SW  E
Sbjct: 237 SDSWAQE 243

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  274 bits (701), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 141/257 (54%), Positives = 191/257 (74%), Gaps = 2/257 (0%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MK+Q  AVNVLERTSAYL++G++K+TPAWYNV+A +PP  KF R P   +P   K  + L
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120
            D      N +GLYKTR N+LE+K    ++Y+ PKLVY+EDK+R LF++QHPWEL+RPKI
Sbjct: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120

Query: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180
           + EN + T   DW ++ QLG+PLDGE+VVQRTL+LLK+ E+  + DAYDQAR EFYRLR+
Sbjct: 121 VSENEINTNP-DWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRM 179

Query: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPS-A 239
           QQE+++QVA EEAEMFGSVF  ++IE+G+ KEQ+VI+ WKR A  Q+EL++A+  + S A
Sbjct: 180 QQELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASKA 239

Query: 240 SWTNETEEEQKPIDQDV 256
           +        +K ++ DV
Sbjct: 240 AGDASAVSSEKQVEDDV 256

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  271 bits (693), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 191/255 (74%), Gaps = 12/255 (4%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MK+QQ AVNVLERTS+YL+SG+L K PAWYNV+A++PP+KKF RTP+ T+P N K    L
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  PDYSNWKA---NSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSR 117
                      N + L+K+R N L+KK  +  +Y+  KL YIED+LR++F+ QHPWELSR
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 118 PKILVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQ----ARF 173
           PKI+VEN  + + YDWSHIQQLGK LDGE+VVQR ++L+K    K+LI  + +    AR+
Sbjct: 121 PKIVVENNGD-ETYDWSHIQQLGKALDGENVVQRAMYLMK----KKLIMIFQKHTIKARY 175

Query: 174 EFYRLRIQQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAAR 233
           EFYR+R+Q EI++QVAQEEAEMFGSVF  ++IE+G+ +EQKVID WKRKA+ + ELM A+
Sbjct: 176 EFYRVRMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAK 235

Query: 234 ASSPSASWTNETEEE 248
            ++PS +W  E EE+
Sbjct: 236 RTNPSETWAQEKEED 250

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  238 bits (608), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 114/191 (59%), Positives = 151/191 (79%), Gaps = 3/191 (1%)

Query: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60
           MK+Q  AVNVL+RTS YL++G+LKKTPAWYNV+A++PP  KFAR P+L  P++GK +  L
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120
              ++    ++  YKTR  S +++  A  +++  KL +IEDKLR LFFQQHPWELSRPK+
Sbjct: 61  DIMTDRLNRNTETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118

Query: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180
           LVEN +  ++YDWS + QLGKPLDGESVVQRTL+LLKSG  +E++ AYDQARFEFYRLR+
Sbjct: 119 LVEN-MGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRM 177

Query: 181 QQEIQDQVAQE 191
           QQE+++Q+A E
Sbjct: 178 QQELEEQIAYE 188

>TDEL0B04630 Chr2 complement(824601..825089) [489 bp, 162 aa] {ON}
           Anc_8.148 YGL187C
          Length = 162

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 8/73 (10%)

Query: 78  PNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKILVENTLETQEYD-WSHI 136
           P  LE+  G  +L    KL  IE       F Q P + SR K  +EN +  + YD + ++
Sbjct: 64  PTDLEQATGLERLELLGKLEGIE------IFDQKPLDSSR-KGTMENPIVVESYDDYRYV 116

Query: 137 QQLGKPLDGESVV 149
              G P D  SV+
Sbjct: 117 GCTGSPADSHSVM 129

>KAFR0A06730 Chr1 (1362270..1365875) [3606 bp, 1201 aa] {ON}
           Anc_5.587 YDR464W
          Length = 1201

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 4   QQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFAR 44
           QQ +++  E  S   K GI  K   W++ I K+ PTK+  R
Sbjct: 810 QQISISNTEDNSRDTKQGIASKEDPWHDNIGKIVPTKEIVR 850

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,143,028
Number of extensions: 1209852
Number of successful extensions: 3264
Number of sequences better than 10.0: 73
Number of HSP's gapped: 3280
Number of HSP's successfully gapped: 73
Length of query: 261
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 154
Effective length of database: 41,212,137
Effective search space: 6346669098
Effective search space used: 6346669098
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)