Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E08229g2.292ON70470433870.0
SAKL0E07546g2.292ON71870623050.0
Suva_9.1082.292ON72271222180.0
Skud_9.822.292ON72271022180.0
Smik_9.882.292ON72471422070.0
YIL091C (UTP25)2.292ON72171222060.0
KAFR0J013402.292ON72871421640.0
Ecym_33312.292ON70871021400.0
KNAG0A054002.292ON72173021400.0
KLTH0G10494g2.292ON74755621350.0
NDAI0B035302.292ON73971621280.0
Kwal_27.115032.292ON72755621090.0
TBLA0B059702.292ON71970621080.0
NCAS0B062302.292ON72371021030.0
TDEL0G022202.292ON71070421000.0
Kpol_1039.462.292ON70455820830.0
ZYRO0A02002g2.292ON70971120830.0
TPHA0D015202.292ON71671720730.0
ADL209C2.292ON70471520350.0
CAGL0D04180g2.292ON70055419680.0
Ecym_13958.469ON565208830.24
Kwal_23.51258.87ON59871800.50
YKR007W (MEH1)2.517ON184101713.6
Smik_4.4908.469ON587184733.6
TPHA0B017904.310ON207457734.6
Kwal_47.193133.578ON107165717.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08229g
         (704 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...  1309   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   892   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   858   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   858   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   854   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   854   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   838   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   828   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   828   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   827   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   824   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   816   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   816   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   814   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   813   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   806   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   806   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   803   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   788   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   762   0.0  
Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}...    37   0.24 
Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa] ...    35   0.50 
YKR007W Chr11 (451434..451988) [555 bp, 184 aa] {ON}  MEH1Compon...    32   3.6  
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...    33   3.6  
TPHA0B01790 Chr2 complement(396879..403103) [6225 bp, 2074 aa] {...    33   4.6  
Kwal_47.19313 s47 complement(1186091..1189306) [3216 bp, 1071 aa...    32   7.3  

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score = 1309 bits (3387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/704 (91%), Positives = 645/704 (91%)

Query: 1   MSKIRAGPKSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVE 60
           MSKIRAGPKSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVE
Sbjct: 1   MSKIRAGPKSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVE 60

Query: 61  QHRGQAYNALLTLLKSEHPERXXXXXXXXXXDSQRAEEDSPENDGINSEDEQQNIENALX 120
           QHRGQAYNALLTLLKSEHPER          DSQRAEEDSPENDGINSEDEQQNIENAL 
Sbjct: 61  QHRGQAYNALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPENDGINSEDEQQNIENALD 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTVKYKSSKT 180
                                          HFSKYSESRLYAFDKGFKDKTVKYKSSKT
Sbjct: 121 DVSGGVVDEEDMEDSLSDVDESEDESDPFESHFSKYSESRLYAFDKGFKDKTVKYKSSKT 180

Query: 181 DVSEEESLIYSKPCLDDEEVLPVKGKQTLSSYFIKQKLKLANDFQNNGLPLTEIQKELVD 240
           DVSEEESLIYSKPCLDDEEVLPVKGKQTLSSYFIKQKLKLANDFQNNGLPLTEIQKELVD
Sbjct: 181 DVSEEESLIYSKPCLDDEEVLPVKGKQTLSSYFIKQKLKLANDFQNNGLPLTEIQKELVD 240

Query: 241 PMFQYKXXXXXXXXXXXXXXXXXLYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQGF 300
           PMFQYK                 LYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQGF
Sbjct: 241 PMFQYKDMLYEYDDYADEDQYRDLYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQGF 300

Query: 301 TRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQ 360
           TRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQ
Sbjct: 301 TRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQ 360

Query: 361 GNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEVM 420
           GNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEVM
Sbjct: 361 GNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEVM 420

Query: 421 IIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTKYI 480
           IIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTKYI
Sbjct: 421 IIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTKYI 480

Query: 481 SPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPDYR 540
           SPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPDYR
Sbjct: 481 SPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPDYR 540

Query: 541 FKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQLT 600
           FKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQLT
Sbjct: 541 FKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQLT 600

Query: 601 SNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLG 660
           SNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLG
Sbjct: 601 SNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLG 660

Query: 661 NCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
           NCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK
Sbjct: 661 NCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/706 (63%), Positives = 534/706 (75%), Gaps = 11/706 (1%)

Query: 5   RAGPKSGRKQLREITRAGQKRVR--YDDEATVADLTPDNESDSDNAEPSVAAEREDVEQH 62
           +   K+GRK+LR ITRA  +      DD     D++ + E  +DN   S   E ED+E  
Sbjct: 18  KKAKKTGRKELRTITRANARHANESKDDFENEPDMSSEEEELADNKPRSDEEEEEDIETK 77

Query: 63  RGQAYNALLTLLKSEHPERXXXXXXXXXXDSQRAEEDSPENDGINSEDEQQNIENALXXX 122
           + + YNALLTLL+SEHP +          + Q   ++  E    + EDE++ IENAL   
Sbjct: 78  KQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVET--YSDEDEEEAIENAL--- 132

Query: 123 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTVKYKSSKTDV 182
                                        HF+  SE +       F+DK ++YKS K  V
Sbjct: 133 VETNDDEDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRDKKIRYKSVKVPV 192

Query: 183 SEEESLIYSKPCLDDEE---VLPVKGKQTLSSYFIKQKLKLANDFQNNGL-PLTEIQKEL 238
           +E+E  IYS+P ++ E+   V+    K++L SYFIKQKLK+ N+  ++    L  +QK L
Sbjct: 193 NEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDDKKEALAPLQKNL 252

Query: 239 VDPMFQYKXXXXXXXXXXXXXXXXXLYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQ 298
           VDPMFQY+                 LY+LH LNHVYKTRDRIL+N+QKLQ+N+D+ELLDQ
Sbjct: 253 VDPMFQYQDLLYEYRSYEQEEEYRDLYALHVLNHVYKTRDRILRNSQKLQDNSDQELLDQ 312

Query: 299 GFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHI 358
           GFTRPKVLIVVPTRD A++IV KI+EKSGLDQ DK+ KF+DQFF+ SLPP+SKPKSF+HI
Sbjct: 313 GFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLPPSSKPKSFKHI 372

Query: 359 FQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIE 418
           F+GNTNDFFVLG KFTRK+LK+YSNFYQSD+I CSPLGIQLILENTDKKKRQDDFLSSIE
Sbjct: 373 FKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKKRQDDFLSSIE 432

Query: 419 VMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTK 478
           +M+IDQLHSIEYQN  H+TTIFQHINKIP+QQ +ADFSRIRMWYINEQA  FRQT+VFTK
Sbjct: 433 LMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQATLFRQTMVFTK 492

Query: 479 YISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPD 538
           Y SPFANS++NGKCRN AGRWKNH  + PE+SSI QLGLKVRQIFQRFDL GG+A+DEPD
Sbjct: 493 YASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDLVGGSAMDEPD 552

Query: 539 YRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQ 598
           YRFKFFTSVI+ SI+KSTGYEDGILLYIPDYTD++RVRN+L+EKTT++FG+INEYS QKQ
Sbjct: 553 YRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLFGDINEYSEQKQ 612

Query: 599 LTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVF 658
           LTSNRA FQ GKVKVLLYTERLHHFRRYEIK VKSVIFYKPP NPEFY EVVR IGK+ F
Sbjct: 613 LTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYREVVRYIGKSAF 672

Query: 659 LGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
           LG+ D+NISTVRC+Y K+DGLSLERVVG+KRAAVL HGQNE+YEFK
Sbjct: 673 LGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/712 (60%), Positives = 534/712 (75%), Gaps = 15/712 (2%)

Query: 5   RAGPKSGRKQLREITRAGQKRVRYDDEATVADLTPDN-ESDSDNAEPSVAAERE----DV 59
           R   K GR+++R+I R   +R    D   V  +  ++ E+ +++A     +E +    D 
Sbjct: 14  RGHRKRGRQEMRKIKRTTARRTEDVDTNEVDHVAEESVETKAEDAISDAGSESDLDIGDE 73

Query: 60  EQHRGQAYNALLTLLKSEHPERXXXXXXXXXXDSQRAEEDSPENDGINSE--DEQQNIEN 117
           E+ + + Y+ALLT+LKSEHPE           +++ A + +  N+  +SE  D+Q  IEN
Sbjct: 74  EEKQEKVYDALLTILKSEHPEPKRKKTKATGENNE-AVDQTGVNENTDSEPVDDQLEIEN 132

Query: 118 ALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTVKYKS 177
            L                                HF++ SE  +      FK   +KYKS
Sbjct: 133 GLLSDQEDDSDDDGDENEQDEVDSEDEQDPFES-HFNQVSEKYVDDVSNAFKANNIKYKS 191

Query: 178 SKTDVSEEESLIYSKPCLDDEEVLPVK---GKQTLSSYFIKQKLKLANDFQNNGL-PLTE 233
            K+ + ++ES IYSKP ++ +E  PV+      ++ SYF+KQ+LK+ N   +  + PLT 
Sbjct: 192 VKSPLGDDESCIYSKPVVNGDET-PVERPYKSSSIYSYFLKQRLKIQNGLLDKKIDPLTS 250

Query: 234 IQKELVDPMFQYKXXXXXXXXXXXXXXX-XXLYSLHALNHVYKTRDRILKNNQKLQENND 292
           +QK+LVDPMFQYK                  LY+LHALNH+YKTRDRILKNNQ+LQ+N D
Sbjct: 251 LQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHALNHIYKTRDRILKNNQRLQDNPD 310

Query: 293 EELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKP 352
            E LDQGFTRPKVLIVVPTRDAA+ +V KI++KSG+DQ DKK KF DQF +DSLPP+SKP
Sbjct: 311 TEHLDQGFTRPKVLIVVPTRDAAYHVVDKIIKKSGIDQVDKKGKFYDQFRDDSLPPSSKP 370

Query: 353 KSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDD 412
           KSFQHIF+GNT+DFFV+GLKFTRK++K+YSNFYQSDII+CSPLGIQ+ILENTDKKKRQDD
Sbjct: 371 KSFQHIFRGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDD 430

Query: 413 FLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQ 472
           FLSSIE+M+IDQLHSIEYQN  H+ TIF HINKIP+QQ EADFSRIRMWYINEQAK  RQ
Sbjct: 431 FLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQAKLLRQ 490

Query: 473 TIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGT 532
           T+VFTKYISP ANS++NG+CRNLAGRWKNH+ I+ E SSIGQLGLK+RQIFQRFD+ G +
Sbjct: 491 TMVFTKYISPAANSLINGRCRNLAGRWKNHKVIESETSSIGQLGLKIRQIFQRFDIIGNS 550

Query: 533 ALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINE 592
            ++EPDYRFKFFTSVI+PSIVKSTGYEDGIL+YIPDYTDFIR+RNY+KEKTTI+FG+INE
Sbjct: 551 IIEEPDYRFKFFTSVIIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINE 610

Query: 593 YSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRN 652
           YS+QKQL +NR+ FQ G+VKVLLYTERLHH+RRYEIK VK+VIFYKPP NPEFY+E VR 
Sbjct: 611 YSSQKQLNANRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVIFYKPPNNPEFYNETVRY 670

Query: 653 IGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
           IGKN FLGN D+NISTVRC+YSK+DGLSLER+VG+KRA VL+H Q EVYEFK
Sbjct: 671 IGKNAFLGNTDLNISTVRCVYSKLDGLSLERIVGTKRAGVLSHAQKEVYEFK 722

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/710 (59%), Positives = 519/710 (73%), Gaps = 11/710 (1%)

Query: 5   RAGPKSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVE---- 60
           R   K GR++LR+I R+  +R    D   +  +  +    +DN   S     +D++    
Sbjct: 14  RGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAVSDVGSEDDLDVGDE 73

Query: 61  -QHRGQAYNALLTLLKSEHPERXXXXXXXXXXDSQRAEEDSPENDGINSEDEQQNIENAL 119
            + + + Y+ALLT+LKSEHPE             +  + D  EN      D+Q  IEN L
Sbjct: 74  DEKKKKVYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEPVDDQLEIENGL 133

Query: 120 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTVKYKSSK 179
                                           HF++  E  +      FK K ++YKS K
Sbjct: 134 LGDREDESEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYKSVK 193

Query: 180 TDVSEEESLIYSKPCLDDEEVL---PVKGKQTLSSYFIKQKLKLANDFQNNGL-PLTEIQ 235
             ++ +ES IY++P +  EE     P K   ++ SYF+KQ+LK+ N  Q+  + PL  +Q
Sbjct: 194 APLNGDESYIYAQPVVVGEESSVESPYKS-SSIYSYFLKQRLKIQNGLQDKKIDPLNALQ 252

Query: 236 KELVDPMFQYKXXXXXXXXXXXXXXX-XXLYSLHALNHVYKTRDRILKNNQKLQENNDEE 294
           ++LVDPMFQYK                  LY+LH LNH+YKTRDRILKNNQ+LQ+N D E
Sbjct: 253 RKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRILKNNQRLQDNPDTE 312

Query: 295 LLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKS 354
            LDQGFTRPKVLIVVPTRD A+++V KI+ KSG+DQ DKK KF DQF +DSLPP SKP+S
Sbjct: 313 HLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPRS 372

Query: 355 FQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFL 414
           FQHIF+GNTNDFFV+GLKFTRK++K+YSNFYQSDII+CSPLGIQ+ILENTDKKKRQDDFL
Sbjct: 373 FQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFL 432

Query: 415 SSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTI 474
           SSIE+M+IDQLHSIEYQN  H+ TIF H+NKIP+QQ EADFSRIRMWYINEQAKFFRQT+
Sbjct: 433 SSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFFRQTM 492

Query: 475 VFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTAL 534
           VFTKYISP  NS++NG+CRN+AGRWKNHR I PE SSIGQLGLK+RQIFQRFD  G + +
Sbjct: 493 VFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGNSIV 552

Query: 535 DEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYS 594
           +EPDYRFKFFTSV++PSIVKSTGYEDGIL+YIPDYTDFIR+RNY+KEKTTI+FG+INEYS
Sbjct: 553 EEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYS 612

Query: 595 NQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIG 654
           +Q+QL +NR+ FQ G++KV+LYTERLHH+RRY+IK VKSVIFYKPP NPEFYSE VR IG
Sbjct: 613 SQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIG 672

Query: 655 KNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
           KN F GN D+NISTVRCIYSK+DG+SLER+VG+KRAAVL+H Q EVYEFK
Sbjct: 673 KNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/714 (60%), Positives = 525/714 (73%), Gaps = 17/714 (2%)

Query: 5   RAGPKSGRKQLREITRAGQKRVRYDDEATVADLTPDN--ESDSDNAEPSVAAERE--DVE 60
           R   K GR++LR+I R+  +R + D+     D   D    S  ++    + +E +  DVE
Sbjct: 14  RGYRKRGRQELRKIKRSSVRRTK-DESVNEVDHVADEIVHSTGEDKISDIGSEEDNLDVE 72

Query: 61  QHRGQ---AYNALLTLLKSEHPERXXXXXXXXXXDSQRAEEDSPENDGINSE--DEQQNI 115
              G+    Y+ALLT+LKSEHPE           +   A+    EN  +  E  DEQ  I
Sbjct: 73  DEEGKKEKVYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVNVEYEPVDEQLEI 132

Query: 116 ENALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTVKY 175
           EN L                                HF++ SE  +      FK K++KY
Sbjct: 133 ENGLLGDREDDNDDDSNENEKDDMDSEDEQDPFES-HFNQVSEKYVDDLSNAFKSKSIKY 191

Query: 176 KSSKTDVSEEESLIYSKPCLDDEEVL---PVKGKQTLSSYFIKQKLKLANDFQNNGL-PL 231
           KS K  + ++ES IY+KP +  EE L   P +   ++ SYF+KQ+LK+ N   +  + PL
Sbjct: 192 KSVKASLGDDESYIYAKPFMVGEEALVESPYRS-SSIYSYFLKQRLKVQNGLLDKKIDPL 250

Query: 232 TEIQKELVDPMFQYKXXXXXXXXXXXXXXX-XXLYSLHALNHVYKTRDRILKNNQKLQEN 290
           T +QK+L+DPMFQYK                  LY+LH LNH+YKTRDRILKNNQ+LQ+N
Sbjct: 251 TCMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYALHVLNHIYKTRDRILKNNQRLQDN 310

Query: 291 NDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTS 350
            D E LDQGFTRPKVLIVVPTR+ A+++V KI+ KSG+DQ DKK KF DQF +DSLPP S
Sbjct: 311 PDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPES 370

Query: 351 KPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQ 410
           KPKSFQHIF+GNT+DFFV+GLKFTRK++K+YSNFYQSDIIICSPLGIQ+ILENTDKKKRQ
Sbjct: 371 KPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQ 430

Query: 411 DDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFF 470
           DDFLSSIE+M+IDQLHSIEYQN  H+ TIF HINKIP+QQ EADFSRIRMWYINEQAK F
Sbjct: 431 DDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQAKLF 490

Query: 471 RQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAG 530
           RQT+VFTKYISP ANS++NG+C N+AGRWKNH+ I  E SSIGQLGLKVRQIFQRFD+ G
Sbjct: 491 RQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVRQIFQRFDIIG 550

Query: 531 GTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEI 590
            + ++EPDYRFKFFTSVI+PSIVKS GYEDGIL+YIPDYTDFIR+RNY+KEKTTI+FG+I
Sbjct: 551 NSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMKEKTTILFGDI 610

Query: 591 NEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVV 650
           NEYSNQ+QL +NR+ FQ G++KV+LYTERLHH+RRYEIK VKSV+FYKPP NPEFY+E V
Sbjct: 611 NEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNETV 670

Query: 651 RNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
           R IGKN FLGN D+NISTVRCIYSK+DGLSLER+VG+KRAAVL+H Q EVYEFK
Sbjct: 671 RFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEVYEFK 724

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/712 (60%), Positives = 522/712 (73%), Gaps = 16/712 (2%)

Query: 5   RAGPKSGRKQLREITRAGQKRVRYDDEATVADLTPD--NESDSDNAEPSVAAEREDVEQH 62
           R   K GR++LR+I R+   R       T+ D+  D  + SD D      + +  D+E  
Sbjct: 14  RGYRKRGRQELRKIKRSSA-RTEGGSTETLEDVAEDIDHRSDEDEVSDVDSGDDFDIEDE 72

Query: 63  RGQ---AYNALLTLLKSEHPERXXXXXXXXXXDSQRAE--EDSPENDGINSEDEQQNIEN 117
            G+    Y+ALLT+LKSEHPE           +   AE  ED  EN      D+Q  IEN
Sbjct: 73  EGKKEKVYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEHGPVDDQLEIEN 132

Query: 118 ALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTVKYKS 177
            L                                HF++  E  +      FK K+VKYKS
Sbjct: 133 GLLGNHEDDNDDDSSGDEKDIDSEDEQDPFES--HFNQVPEKFVDKLSNAFKTKSVKYKS 190

Query: 178 SKTDVSEEESLIYSKPCLDDEEVL---PVKGKQTLSSYFIKQKLKLANDFQNNGL-PLTE 233
            K  +S+ ES IY+KP +  EE L   P +   ++ SYF+KQ+LK+ N   +    PLT 
Sbjct: 191 VKGSLSDSESYIYAKPVVIGEEALVESPYRS-SSIYSYFLKQRLKVQNGLLDKKTDPLTA 249

Query: 234 IQKELVDPMFQYKXXXXXXXXXXXXXXX-XXLYSLHALNHVYKTRDRILKNNQKLQENND 292
           +QK+LVDPMFQYK                  LY+LH LNH+YKTRDRILKNNQ+LQ+N D
Sbjct: 250 LQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRILKNNQRLQDNPD 309

Query: 293 EELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKP 352
            E LDQGFTRPKVLIVVPTR+ A+++V KI+ KSG+DQ DKK KF DQF +DSLPP SKP
Sbjct: 310 TEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKP 369

Query: 353 KSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDD 412
           KSFQHIF+GNTNDFFV+GLKFTRK++K+YSNFYQSDII+CSPLGIQ+ILENTDKKKRQDD
Sbjct: 370 KSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDD 429

Query: 413 FLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQ 472
           FLSSIE+M+IDQLHSIEYQN  H+ TIF H+NKIP+QQ EADFSRIRMWYINEQAK FRQ
Sbjct: 430 FLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLFRQ 489

Query: 473 TIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGT 532
           T+VFTKYISP ANS++NG+CRN+AGRWKNH+ I  E SSIGQ GLK+RQIFQRFD+ G +
Sbjct: 490 TMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGNS 549

Query: 533 ALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINE 592
            ++EPDYRFKFFTSVI+P IVKSTGYEDGIL+YIPDYTDFIR+RNY+KEKTTI+FG+INE
Sbjct: 550 IIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINE 609

Query: 593 YSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRN 652
           YS+Q+QL +NR+ FQ G++KV+LYTERLHH+RRYEIK VKSV+FYKPP NPEFY+EVVR 
Sbjct: 610 YSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVRF 669

Query: 653 IGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
           IGKN FLGN D+NISTVRCIYSK+DGLSLER+VG+KRAAVL+H Q E+YEFK
Sbjct: 670 IGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/714 (59%), Positives = 519/714 (72%), Gaps = 19/714 (2%)

Query: 9   KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDV--------- 59
           K GRK+LR I RAG ++ R D +     ++    +     EPS AA  +DV         
Sbjct: 16  KRGRKELRNIRRAGGRKPR-DAQENGNGISVSENTGEVEEEPSSAANGDDVGDEVGDEAS 74

Query: 60  ---EQHRGQAYNALLTLLKSEHPERXXXXXXXXXXDSQRAEEDSPENDGINSEDEQQNIE 116
              E+ + Q Y ALLT+LKSEHPE                E+    +     EDE Q IE
Sbjct: 75  DDEEEMKKQVYGALLTILKSEHPEPKKQKKEKVNKVLLDNEQQDESDASEEEEDETQQIE 134

Query: 117 NALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTVKYK 176
           NAL                                HF+   E      D  FK+  +KYK
Sbjct: 135 NALMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKLDVSFKNNDIKYK 194

Query: 177 SSKTDVSEEESLIYSKPCLDDEEV-LPVK---GKQTLSSYFIKQKLKLANDFQNNGL-PL 231
           S+K  +SE+E  I+SKP +  +E+  PV+    K ++ SYF+KQ+LK+ N+  +  + PL
Sbjct: 195 STKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRLKMQNNLMDPKVDPL 254

Query: 232 TEIQKELVDPMFQYKXXXXXXXXXXXXXXX-XXLYSLHALNHVYKTRDRILKNNQKLQEN 290
           T +QK+LVDPMFQYK                  LYSLH LNH+YKTRD+ILKNNQ+LQ+N
Sbjct: 255 TPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQRLQDN 314

Query: 291 NDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTS 350
           ND E LDQGFTRPKVLIVVPTRD A++++ KI+ KSG+DQ DKK KF+DQFFEDSLPP+S
Sbjct: 315 NDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDSLPPSS 374

Query: 351 KPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQ 410
           KPKSFQ IF+GNTNDFFVLG+KFTRK++K+YSNFYQSDIIICSPLGIQ+ILENTDKKKRQ
Sbjct: 375 KPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQ 434

Query: 411 DDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFF 470
           DDFLSSIE+MIIDQLHSIEYQN  H+ TI  HINKIP++Q +ADFSR+RMWYIN+QAK F
Sbjct: 435 DDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWYINDQAKLF 494

Query: 471 RQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAG 530
           RQT++FTKYISP ANS+LNGKC+N +GRWKNH+ I    SSI ++G+K+RQIFQRF+   
Sbjct: 495 RQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFETVN 554

Query: 531 GTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEI 590
           G+ +DEPDYRFKFFTSV VP+IVK+TGYEDG L+YIP+YTD+IRVRNYLK+KTTI+FG+I
Sbjct: 555 GSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTILFGDI 614

Query: 591 NEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVV 650
           NEYS+QKQL SNR+ FQ G+VKVLLYTERLHH+RRYEIK VK+V+FY+PP NPEFY+EVV
Sbjct: 615 NEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEFYTEVV 674

Query: 651 RNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
           R IGKN FLGN D+NISTVRC+YSK+D LSLE +VGSKRA VL H QNEVYEFK
Sbjct: 675 RYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/710 (59%), Positives = 510/710 (71%), Gaps = 19/710 (2%)

Query: 9   KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAERE-----DVEQHR 63
           K GRKQLR+ITR G  R R +D+A  + L     +D D        E E     D E+  
Sbjct: 4   KRGRKQLRKITRIG--RNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEERT 61

Query: 64  GQAYNALLTLLKSEHPERXXXXXXXXXXDSQRAEEDSPENDGINSE-DEQQNIENALXXX 122
              Y ALL++L S HPE                EE   +N   N E DE   I  +L   
Sbjct: 62  AHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEE--RKNGSRNYETDEVATISASLDDS 119

Query: 123 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTVKYKSSKTD- 181
                                        HF++ SE      D  FK+KTV+Y+S+K   
Sbjct: 120 VDKDEEVEEDDGVYSDGEDSEDERDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLPY 179

Query: 182 VSEEESLIYSKPCL------DDEEVLPVKGKQTLSSYFIKQKLKLANDFQNNGL-PLTEI 234
           + + E  I+SKP +      D     PV  K  + SYF+K+KLK+ N   ++   PLT +
Sbjct: 180 MHDNEGFIFSKPVIEGLKGSDAVNDTPV-CKGNIHSYFMKKKLKVHNGLLDDKKKPLTPL 238

Query: 235 QKELVDPMFQYKXXXXXXXXXXXXXXXXXLYSLHALNHVYKTRDRILKNNQKLQENNDEE 294
            K LVDP+FQY+                 LY+LH LNH+YKTRDRILKNN KLQEN+D+E
Sbjct: 239 SKTLVDPIFQYRDLLFEYEDFSQETEYRDLYTLHILNHIYKTRDRILKNNHKLQENDDQE 298

Query: 295 LLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKS 354
           LLDQGFTRPKVL+V PTR+ A+ I+ KI++KSGLDQ DKKSKF+DQF+EDSLPPTSKPKS
Sbjct: 299 LLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKS 358

Query: 355 FQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFL 414
           FQH+F+GNTNDFFVLG+KFTRK+LK+YSNFYQSD+I+CSPLGIQLILENTDKKKRQDDFL
Sbjct: 359 FQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFL 418

Query: 415 SSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTI 474
           SSIE++++DQLHS+E+QN  HV +IFQHINKIP++Q ++DFSRIRMWYIN+QA+ FRQT+
Sbjct: 419 SSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTL 478

Query: 475 VFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTAL 534
           +FTKY+SPFANS++NGKC N +GR+KN R I PE+S+I QLGLKVRQ+F RFDL  G+++
Sbjct: 479 IFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSV 538

Query: 535 DEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYS 594
           DEPDYRFKFFTSV VP I KSTGYEDGILLYIPDYTDF+RVRNY K++T I+FGEI EYS
Sbjct: 539 DEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYS 598

Query: 595 NQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIG 654
           +Q+Q+TSNRA FQ GKVKVLLYTERLHHFRRY+IK VKSVIFYKPP NPEFY E++R IG
Sbjct: 599 DQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIG 658

Query: 655 KNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
           KN FLGN D+NISTVRC Y K+D LSLER+VGSKRAAVL   QNE+YEFK
Sbjct: 659 KNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/730 (58%), Positives = 526/730 (72%), Gaps = 42/730 (5%)

Query: 5   RAGPKSGRKQLREITRAGQKRVRYDD----EATVAD--LTPDNE--SDSDNAEPSVAAER 56
           R+G K GRK+LR + R   KR   DD     A V D  + P ++  + SD+AE    ++ 
Sbjct: 4   RSG-KRGRKELRHLKRT-TKRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGDGSD- 60

Query: 57  EDVEQHRGQAYNALLTLLKSEHPERXXXXXXXXXXDSQRAEEDSPENDGINSEDEQQ--- 113
            D E  +G+ Y ALLT+LKSEHPE              +   D  E D I   D+     
Sbjct: 61  SDAEARKGKVYGALLTILKSEHPEAKKRKT--------KKSSDGGEVDKILVHDDNHEEL 112

Query: 114 -------NIENALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDK 166
                   I+NA+                                HF+++ E+ +   D 
Sbjct: 113 EEENEEEQIDNAILDNRTQSDSEDEQDVAAEEFDSEDEQDPFES-HFNQFPETEINTLDA 171

Query: 167 GFKDKTVKYKS-----SKTDVSEEESLIYSKPCLDDEEVLPVK-----GKQTLSSYFIKQ 216
            FK K ++Y+S     +K    ++E LIYS+P +   + L  K      K ++ SYF+K+
Sbjct: 172 AFKSKQLQYRSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKK 231

Query: 217 KLKLANDF-QNNGLPLTEIQKELVDPMFQYKXXXXXXXXXXXXXXX-XXLYSLHALNHVY 274
           +LK+ ND  +N    L  IQKELVDPMFQYK                  LY+LHALNHVY
Sbjct: 232 RLKIQNDLLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVY 291

Query: 275 KTRDRILKNNQKLQENNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKK 334
           KTRDRILKNNQ+LQEN+D E LDQGFTRPKVLI+ PTRD A+ IV  I+ KSG+DQ DK+
Sbjct: 292 KTRDRILKNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKR 351

Query: 335 SKFEDQFFEDSLPPTSKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSP 394
            KF+DQF+EDSLPP+SKPKSFQ IF+GNTNDFFVLG+KFTRK++K+YSNFYQSDII+CSP
Sbjct: 352 GKFKDQFYEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSP 411

Query: 395 LGIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREAD 454
           LG+Q+I+ENTDKKKRQDDFLSSIE+ IIDQLHSIEYQN  H+ TIF+H+N IP++Q +AD
Sbjct: 412 LGLQMIVENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDAD 471

Query: 455 FSRIRMWYINEQAKFFRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQ 514
           FSRIRMWYIN+QA+FFRQT+VFTKYISP ANSI+NGKCRN +GRWKNHR +  E S IG+
Sbjct: 472 FSRIRMWYINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGK 531

Query: 515 LGLKVRQIFQRFDLAGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIR 574
           L L+VRQIFQRF++ GG+ +DEPDYRFKFFTSVI+P I+KSTGYEDGIL+YIP+YTD++R
Sbjct: 532 LSLRVRQIFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVR 591

Query: 575 VRNYLKEKTTIIFGEINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSV 634
           VRNYLKEKT I+FG+INEYS+QKQLT+NR+ FQ G++KVLLYTERLHH+RRYEIK VKSV
Sbjct: 592 VRNYLKEKTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSV 651

Query: 635 IFYKPPGNPEFYSEVVRNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLA 694
           IFYKPP +PEFY+EVVRNIG+N FLGN D+NISTVRCIYSK+D L+LE VVG++RA VL 
Sbjct: 652 IFYKPPSDPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLC 711

Query: 695 HGQNEVYEFK 704
           HGQNE+YEFK
Sbjct: 712 HGQNEIYEFK 721

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/556 (69%), Positives = 462/556 (83%), Gaps = 3/556 (0%)

Query: 152 HFSKYSESRLYAFDKGFKDKTVKYKSSKTDVSEEESLIYSKPCLDDEEVLPVK---GKQT 208
           HF+  SE    A D  FK K V+Y+S K  V + +  IYS+P L +E    V    G Q+
Sbjct: 192 HFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPASAVSAPDGSQS 251

Query: 209 LSSYFIKQKLKLANDFQNNGLPLTEIQKELVDPMFQYKXXXXXXXXXXXXXXXXXLYSLH 268
           L+SYFIKQ+LK+ ND  ++   LT +QK++VDPMFQY+                 LY+LH
Sbjct: 252 LNSYFIKQRLKIQNDLLDSQDKLTPLQKQIVDPMFQYQDLLYEYEDYDKETEYRDLYALH 311

Query: 269 ALNHVYKTRDRILKNNQKLQENNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGL 328
            LNH+YKTRDRILKNNQ+LQEN D+ELLDQGFTRPKVLIV PTRDAA+ I+ KI++KSGL
Sbjct: 312 VLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDILSKIIQKSGL 371

Query: 329 DQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSD 388
           DQ DKK+KF+DQFF+++LPP+ KPKSFQ +F+GNTNDFFVLG KFTRK++K+YSNFYQSD
Sbjct: 372 DQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTIKLYSNFYQSD 431

Query: 389 IIICSPLGIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPE 448
           IIICSPLGIQLILENTDKKKRQDDFLSSIE++++DQLHSIE+QN +H+T+IF+HINKIP+
Sbjct: 432 IIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTSIFEHINKIPQ 491

Query: 449 QQREADFSRIRMWYINEQAKFFRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPE 508
           QQ +ADFSRI+MWYIN+QAK FRQT++FTK+ SPFANS++NGKCRN AGRWKNHR I PE
Sbjct: 492 QQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRWKNHRVIFPE 551

Query: 509 QSSIGQLGLKVRQIFQRFDLAGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPD 568
            SS+GQLG++ R IFQRFDL G +  +EPD RFK F SVIVP+IVKSTGYEDGILLYIPD
Sbjct: 552 NSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYEDGILLYIPD 611

Query: 569 YTDFIRVRNYLKEKTTIIFGEINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEI 628
           YTDF+RVRNYL+EKTTI+FG+INEYS Q+QLTSNRA FQ G+VKVLLYTERLHHFRRYEI
Sbjct: 612 YTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTERLHHFRRYEI 671

Query: 629 KNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSK 688
           K VK+VIFYKPP NPEF+ EV R +GK+ FLG  D+NIS VRC++SK+DGLSLER+VG++
Sbjct: 672 KGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGLSLERIVGTE 731

Query: 689 RAAVLAHGQNEVYEFK 704
           RAAVL HG NE YEFK
Sbjct: 732 RAAVLTHGPNETYEFK 747

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 9  KSGRKQLREITRA-GQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVEQHRGQAY 67
          KSGRKQLR I +A G +R   ++ A   +   + E++   A P +    +D ++  G+AY
Sbjct: 21 KSGRKQLRTIRKASGPRRGLAEESANEENNGSETEAEDKLAAPELNEPAQD-QRAGGEAY 79

Query: 68 NALLTLLKSEH 78
           ALLTLLK+EH
Sbjct: 80 AALLTLLKAEH 90

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/716 (57%), Positives = 515/716 (71%), Gaps = 22/716 (3%)

Query: 9   KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAERE------DVEQH 62
           K GR++LR I R+  K+ RYD   T  + T +   +          + +      D ++ 
Sbjct: 26  KRGRQELRTIRRSAAKKSRYDSNVTEHNDTEELLQEESEEGEEDEEDDQSEQEEVDEDER 85

Query: 63  RGQAYNALLTLLKSEHPERXXXXXXXXXXDSQRAEEDSPEN-------DGINSEDEQQNI 115
           +G+ Y ALLT+L++EHPE             ++  + +  N       D I  EDE + I
Sbjct: 86  KGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRETEDSIIEEDETEQI 145

Query: 116 ENALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTVKY 175
           EN L                                HF+K +E  +      F+ + +KY
Sbjct: 146 ENGLLDRDDEQSDDDQLNDSNDVESDDEQDPFES--HFNKPTEQFVDKLHAAFESREIKY 203

Query: 176 KSSKTDVSEEESLIYSKPCLDDEEV-----LPVKGKQTLSSYFIKQKLKLANDFQNNGL- 229
           K++K  + +  S+I SKP +  EE+        K  Q++ SYFIKQ+LK+ N+  N  + 
Sbjct: 204 KATKIVIDDSHSVISSKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPKVD 263

Query: 230 PLTEIQKELVDPMFQYKXXXXXXXXX-XXXXXXXXLYSLHALNHVYKTRDRILKNNQKLQ 288
           PLT +QKEL+DPMFQYK                  LY+LHALNHVYKTRDRILKNNQ+LQ
Sbjct: 264 PLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQRLQ 323

Query: 289 ENNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPP 348
           +N D E LDQGFTRPKVLIVVPTRD A+++  KI++KSGLDQ DKK KF DQF +DSLPP
Sbjct: 324 DNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFKDDSLPP 383

Query: 349 TSKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKK 408
           +SKPKSFQ IF+GNTNDFFVLGLKFTRK++K+YSNFYQSDII+CSPLG+Q+I+ENTDKKK
Sbjct: 384 SSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKK 443

Query: 409 RQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAK 468
           RQDDFLSSIE++I+DQLHS+EYQN  H+ TIF H+NKIP +Q +ADFSRIRMWYIN+QAK
Sbjct: 444 RQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQAK 503

Query: 469 FFRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDL 528
            FRQT+VFTKY+SP AN+I+N +CRN  GRWKNH+ + PE SSIG+LGLK++QIFQRFD+
Sbjct: 504 LFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRFDI 563

Query: 529 AGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFG 588
            GG+ +DEPDYRFK FTSVI+PSIVKST Y+DGIL+YIPDYTD++R+RNYLKEKT I+FG
Sbjct: 564 MGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRILFG 623

Query: 589 EINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSE 648
           +INEYS Q++L SNR+  Q G+VKVLLYTERLHH+RRYEIK VKSV+FYKPP NPEFY+E
Sbjct: 624 DINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFYNE 683

Query: 649 VVRNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
           VVR IGKN FLGN D+NISTVR +Y K+DGLSLER+VG+KRA +L H QNEVYEFK
Sbjct: 684 VVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/556 (67%), Positives = 464/556 (83%), Gaps = 3/556 (0%)

Query: 152 HFSKYSESRLYAFDKGFKDKTVKYKSSKTDVSEEESLIYSKPCLDDEEVLPVK---GKQT 208
           HF+   E    A D+ FK K V+Y+SSK  +S+ E  IYS+P L+ E   P++   G Q+
Sbjct: 172 HFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVPQGTQS 231

Query: 209 LSSYFIKQKLKLANDFQNNGLPLTEIQKELVDPMFQYKXXXXXXXXXXXXXXXXXLYSLH 268
           LS YFIKQ+LK+ ND  ++   LT +QK++VDP+FQY+                 LY+LH
Sbjct: 232 LSPYFIKQRLKIQNDLLDSKNNLTPLQKKIVDPIFQYQDLLYEYENYDQETEYRDLYALH 291

Query: 269 ALNHVYKTRDRILKNNQKLQENNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGL 328
           AL+H+YKTRDRILKNNQ+LQ+N D+E+LDQGFTRPKVLIVVPTRD A+ ++ KI+EKSGL
Sbjct: 292 ALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEKSGL 351

Query: 329 DQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSD 388
           DQ DKKSKF DQF++DSLPP  KPKSFQ +F+GNTNDFFVLG KFTRK++K+YSNFYQSD
Sbjct: 352 DQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFYQSD 411

Query: 389 IIICSPLGIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPE 448
           II+CSPLGIQLILENTDKKKRQDDFLSSIE+++IDQLHSIE+QN +H+T+IF+HINKIP+
Sbjct: 412 IIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHINKIPQ 471

Query: 449 QQREADFSRIRMWYINEQAKFFRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPE 508
           QQ +ADFSRI+MWYIN+QAK FRQT++FT++ +PFANS++NGKCRN AGRWKNH  +  E
Sbjct: 472 QQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGAE 531

Query: 509 QSSIGQLGLKVRQIFQRFDLAGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPD 568
           +SS+ QLG++ R +FQRFD+AGG A DEPD+RFK F SVIVP+IV+STGYEDGILLYIPD
Sbjct: 532 KSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYIPD 591

Query: 569 YTDFIRVRNYLKEKTTIIFGEINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEI 628
           YTDFIRVRNYL+EKTTI+FG+I+EYS Q+QLT+NRA FQ G+VKVLLYTERLHHFRRYEI
Sbjct: 592 YTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFRRYEI 651

Query: 629 KNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSK 688
           K VK+VIFYKPP NPEF+ E VR + K+ FLG  D+NIS VRC+YSK+DGL+LER+VG++
Sbjct: 652 KGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERIVGTE 711

Query: 689 RAAVLAHGQNEVYEFK 704
           RAA+L HG NE YEFK
Sbjct: 712 RAAILTHGPNETYEFK 727

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (54%), Gaps = 8/73 (10%)

Query: 9  KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDV---EQHRGQ 65
          K GRKQLR I +A     RYD +    +     E + +  E  V  ER +V   ++  G+
Sbjct: 21 KGGRKQLRSIRKAS----RYDSKKPEDEPVETPEEEINEVE-DVHEERTEVSRKQESNGE 75

Query: 66 AYNALLTLLKSEH 78
          AY ALLTLLK+EH
Sbjct: 76 AYAALLTLLKAEH 88

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/706 (58%), Positives = 513/706 (72%), Gaps = 12/706 (1%)

Query: 9   KSGRKQLREITRA-GQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVE--QHRGQ 65
           K GR Q R I ++ G KR + +D   V +   D  SD D +  S+  E E  E  + + Q
Sbjct: 16  KRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSIDKEAEVTEDLEKKKQ 75

Query: 66  AYNALLTLLKSEHPE-RXXXXXXXXXXDSQRAEEDSPENDGINSEDEQQNIENALXXXXX 124
            Y+AL+T+LKSEH E +          +    +ED  E++    E E+Q IEN L     
Sbjct: 76  VYDALVTILKSEHKEPKMRDNLNETSKEEHLTDEDLDEDEKF--ETEEQEIENNLLSIKD 133

Query: 125 XXXXXXXXXXXXXXXXXXXXXXXX-XXXHFSKYSESRLYAFDKGFKDKTVKYKSSKTDVS 183
                                       HF++ +E     F   FK+K +KY+S K  ++
Sbjct: 134 DEEEGENNDDNAGESDDESDNKSDPFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYKIN 193

Query: 184 EEESLIYSKPCLDDEEVLPVKG---KQTLSSYFIKQKLKLANDFQNNGLP-LTEIQKELV 239
           E ES IYS+P + ++E   VK    K ++ SY +K++LK+ ND  +  +  LT IQKELV
Sbjct: 194 EYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELV 253

Query: 240 DPMFQYKXXXXXXXXX-XXXXXXXXLYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQ 298
           DPMFQYK                  LY LH LNH+YKTRDRILKNN K+Q+N D E LDQ
Sbjct: 254 DPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQ 313

Query: 299 GFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHI 358
           GFTRPKVLIV PTRDA + IV +I++KSG+DQ DKKSKF DQF+E+SL P SKPKSFQ +
Sbjct: 314 GFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAV 373

Query: 359 FQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIE 418
           F+GN+ND+FVLG+KFTRK++K+YSNFYQSDII+CSPLG+ +ILENTDKKKRQDDFLSSIE
Sbjct: 374 FKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIE 433

Query: 419 VMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTK 478
           +MIIDQLHS+E+QN  HVT+IF+HINKIP++Q + DFSRI+MWYIN+QAK FRQT++FTK
Sbjct: 434 LMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTK 493

Query: 479 YISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPD 538
           YISP AN  LNGKC+N +GRWKNH+ I P +SSIGQLGL+V+Q+F RFD+ GG+ +DEPD
Sbjct: 494 YISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPD 553

Query: 539 YRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQ 598
           YRFK+FTSVIV SI KST YEDG+L+YI DYTD++RVRNYLKEKTTI+FG+INEYS+QKQ
Sbjct: 554 YRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQ 613

Query: 599 LTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVF 658
           + SNRA FQ  +VKVLLYTERLHHFRRYEIK VK+++FYK P NPEFY+EVVR IGKN F
Sbjct: 614 VNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAF 673

Query: 659 LGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
            GN DINIS VR IYSK+DGL+LER++G+KRAAVL HGQNE YEFK
Sbjct: 674 TGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/710 (57%), Positives = 515/710 (72%), Gaps = 16/710 (2%)

Query: 9   KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVEQHRGQAYN 68
           K GR++LR I R+   +V    E   + +  D E + + +  S   E  D E+ + + Y 
Sbjct: 16  KRGRQELRTIRRSAGAKVS-SQEVFNSSIVDDEEQELNESNESEQEEDIDEEEKKNKVYG 74

Query: 69  ALLTLLKSEHPERXXXXXXXXXXDSQRAEEDSPE---NDGINSE-DEQQNIENALXXXXX 124
           ALLT+LKSEHPE           DS+  E+   E   +DG + E DE Q IE+ L     
Sbjct: 75  ALLTILKSEHPE-LKKKKKKRVDDSKSGEDKGSELASDDGKDDEIDEAQQIEDGLARGSD 133

Query: 125 XXXXXXXXXXXXXXXXXXXXXXXXX---XXHFSKYSESRLYAFDKGFKDKTVKYKSSKTD 181
                                         HF++ SE      +  F   +VKYKS+K+ 
Sbjct: 134 GQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGSVKYKSTKSV 193

Query: 182 VSEEESLIYSKPCL-----DDEEVLPVKGKQTLSSYFIKQKLKLANDFQNNGL-PLTEIQ 235
           + + +++I S P +      +EE        ++ SYF+KQ+L++AND  ++   PL  +Q
Sbjct: 194 IGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDMLDSKKDPLGPLQ 253

Query: 236 KELVDPMFQYKXXXXXXXXXXXXXXX-XXLYSLHALNHVYKTRDRILKNNQKLQENNDEE 294
           KELVDPMFQY+                  LY+LHALNHVYKTRDRILK+N +LQ+N+D E
Sbjct: 254 KELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHALNHVYKTRDRILKDNGRLQDNSDTE 313

Query: 295 LLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKS 354
             DQGFTRPKVLIVVPTRD A++++ KI+ KSGLDQ DKK KF DQF +++LPP+SKPKS
Sbjct: 314 YFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDETLPPSSKPKS 373

Query: 355 FQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFL 414
           FQHIF+GNTNDFFVLG+KFTRK++K+YSNFYQSDII+CSPLG+Q+I+ENTDKK RQDDFL
Sbjct: 374 FQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKNRQDDFL 433

Query: 415 SSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTI 474
           SSIEV+IIDQLHSIEYQN  HV TIF H+NKIPEQQ EADFSRIRMWYIN+QA+ FRQT+
Sbjct: 434 SSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYINDQARLFRQTM 493

Query: 475 VFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTAL 534
           +FTKY++P AN+++N +CRN AGRWKNH  I+PE S+I QLGLKV+Q FQRFD+ GG+ +
Sbjct: 494 IFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQRFDMMGGSVI 553

Query: 535 DEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYS 594
           DEPDYRFK F+SVI+PSIVKST Y DGIL+YIPDYTD++R+RNYLKEKTT++FG+INEYS
Sbjct: 554 DEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTLLFGDINEYS 613

Query: 595 NQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIG 654
            Q++L SNR+ FQ G+VKVLLYTERLHH+RRYE+K VKSV+FYKPP NPEFY+EVVR IG
Sbjct: 614 EQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEFYNEVVRYIG 673

Query: 655 KNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
           K+ FLGN D+NISTVR +Y K+DGLSLER+VGSKRA +L H QNEVYEF+
Sbjct: 674 KSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/704 (58%), Positives = 508/704 (72%), Gaps = 19/704 (2%)

Query: 9   KSGRKQLREITRAGQKRVRYD----DEATVADLTPDNESDSDNAEPSVAAEREDVEQHRG 64
           K GRK+LR I R  + +   +    +E++  ++   +     N E  +A   ED E  R 
Sbjct: 18  KRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQHNEE--IANVEEDEENKRR 75

Query: 65  QAYNALLTLLKSEHPERXXXXXXXXXXDSQRAEEDSPENDGINSEDEQQNIENALXXXXX 124
           + Y ALLT+L SEHP+             Q  +EDS  +   +  DE + +E+ L     
Sbjct: 76  KVYGALLTILNSEHPKPKPKQEVTV----QSRKEDSESDVEEDERDEVEQLEDNLARVDE 131

Query: 125 XXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTVKYKSSKTDVSE 184
                                      HF++  E+ +   D  FK++ +KYKS+K  + E
Sbjct: 132 NPSEDDLSEDADEESDDEQDTFDS---HFNQVPENVVDKLDAAFKERQLKYKSAKVPIGE 188

Query: 185 EESLIYSKPCL--DDEEVLPVKGK-QTLSSYFIKQKLKLANDFQNNGLPLTEIQKELVDP 241
            ES++YSKP L  D  + L +  + ++L SY  KQ+LK+ ND ++  L  T  Q+ LVDP
Sbjct: 189 NESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDLEHENL--TSTQRTLVDP 246

Query: 242 MFQYKXXXXXXXXXXXXXXX-XXLYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQGF 300
           M QY                   LY+LH LNHVYKTRD+ILKNNQ++ +N D + LDQGF
Sbjct: 247 MLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNPDADYLDQGF 306

Query: 301 TRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQ 360
           TRPKVLIVVPTRD A++++ KI++KSG+DQ DKK KF DQFFE+SLPP+SKPKSFQH+F+
Sbjct: 307 TRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLPPSSKPKSFQHVFK 366

Query: 361 GNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEVM 420
           GNTNDFFVLG+KFTRK++K+YSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIE+ 
Sbjct: 367 GNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEIS 426

Query: 421 IIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTKYI 480
           I DQLHSIEYQN  HV TIF H+N IP++Q + DF R+R+WYINEQAK FRQT++FTKY+
Sbjct: 427 IFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIFTKYV 486

Query: 481 SPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPDYR 540
           SP AN+++N KC+N+ GRWKNH  I+P QSSIG+LGLKVRQIFQR DL   + L+E D+R
Sbjct: 487 SPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEESDFR 546

Query: 541 FKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQLT 600
           FKFFTSVI+PSI+KSTGYEDGIL+YIPDY DFIRVRNY+KEKTTIIFG+INEYSNQKQL 
Sbjct: 547 FKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQKQLN 606

Query: 601 SNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLG 660
           SNRA FQ G+ KVLLYTERLHHFRRYEIK VKSV+FY+PP NPEFYSEVVR I K+  LG
Sbjct: 607 SNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAALG 666

Query: 661 NCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
             D+NISTVR IYSK+DG+SLER+VG+KRAA+L HGQNEVYEFK
Sbjct: 667 TTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/558 (68%), Positives = 461/558 (82%), Gaps = 5/558 (0%)

Query: 152 HFSKYSESRLYAFDKGFKDKTVKYKSSKTDVSEEESLIYSKPCL---DDEEVLPVKGKQT 208
           HF+  S+  +     GFKDK +KYKS K  + ++ES I+ KP L    DE +       +
Sbjct: 147 HFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDETIDNPVLTSS 206

Query: 209 LSSYFIKQKLKLANDFQNNGLP-LTEIQKELVDPMFQYKXXXXXXXXXXXXXXX-XXLYS 266
             SYFIKQ+LK+ ND  ++    LT ++K+L+DPMFQYK                  LYS
Sbjct: 207 YDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYS 266

Query: 267 LHALNHVYKTRDRILKNNQKLQENNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKS 326
           LH LNH+YKTRD+ILK+NQ+LQEN+D E LDQGFTRPKVLIVVPTRD A+++V  I+EKS
Sbjct: 267 LHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKS 326

Query: 327 GLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQ 386
           GLDQ DKK KF+DQFF+DSLPPTSKPKSF+H+F+GNTNDFFVLG+KFTRK++K+YSNFYQ
Sbjct: 327 GLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQ 386

Query: 387 SDIIICSPLGIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKI 446
           SDIIICSPLGIQ+ILENTDKKKRQDDFLSSIEVMI+DQLHSIEYQN  HV TI +HINKI
Sbjct: 387 SDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKI 446

Query: 447 PEQQREADFSRIRMWYINEQAKFFRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIK 506
           P+QQREADFSRIRMWYIN+QAKF RQT++FT+YISP AN+I+NGKC N+AGRWKN++ I 
Sbjct: 447 PQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIIS 506

Query: 507 PEQSSIGQLGLKVRQIFQRFDLAGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYI 566
            E SSIGQLG+K++QIFQRFDL GGT +DE DYRFK+FTSV++ +IVKSTGYEDGIL+YI
Sbjct: 507 SEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYI 566

Query: 567 PDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRY 626
           P+YTD++R+RNY+KEKTTI+F EINEYS QKQL SNR+ FQ G+ KVLLYTERLHH+RRY
Sbjct: 567 PEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRY 626

Query: 627 EIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVG 686
           E+K +KSVIFYKPP NPEFY+EV+R   KN FLG  DINIST+R +YSK+DGL+L+R+VG
Sbjct: 627 ELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVG 686

Query: 687 SKRAAVLAHGQNEVYEFK 704
           SKRAA+L HGQNE Y+FK
Sbjct: 687 SKRAAILCHGQNESYDFK 704

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 7  GPKS-GRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVEQHRGQ 65
          GPK  GR +LR I R  + +    D+  V +   ++  +S + +    A+ E     R +
Sbjct: 10 GPKKRGRTELRSIRRPNRSQHSKHDQQVVHESENEDSLESSSDDDEDIAQAEAENSDRKE 69

Query: 66 -AYNALLTLLKSEHPER 81
            Y ALLT+L SEHPER
Sbjct: 70 KVYGALLTILNSEHPER 86

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/711 (58%), Positives = 510/711 (71%), Gaps = 23/711 (3%)

Query: 4   IRAGPKSGRKQLREITRA-GQKRVRYDDEATVA-----DLTPDNESDSDNAEPSVAAERE 57
           I    K GRK LR I RA   K    + E  VA     +L+ D+E D+ N       E +
Sbjct: 12  IDGSRKRGRKDLRSIRRARNDKEPVEEPEIPVASEEDGELSEDSEEDATN-------EVQ 64

Query: 58  DVEQHRGQAYNALLTLLKSEHPERXXXXXXXXXXDSQRAEEDSPENDGINSEDEQQNIEN 117
           + E  + +AY ALLT+LKSEHPE           D Q    D   +D   SEDE+  +E 
Sbjct: 65  EQEDSKEKAYGALLTILKSEHPEDRQRERRKKKQDLQ----DPSSSDDELSEDEKGEVEA 120

Query: 118 ALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTVKYKS 177
            L                                HF+  SES + + D+ +K K +  KS
Sbjct: 121 NLVDTPGEEEPQSEEELSEGDEDESEDERDPFESHFNMQSES-IDSLDEAWKQKKIVNKS 179

Query: 178 SKTDVSEEESLIYSKPCLD--DEEVLPVKGKQTLSSYFIKQKLKLANDF-QNNGLPLTEI 234
            K  V ++ESLIY+K       E  LP   K  LSSY +K+KLK+ N+  ++    LT +
Sbjct: 180 GKIRVDDDESLIYTKTLAGKGQEFELP-SHKGHLSSYPLKRKLKIQNNLLESQDDVLTPL 238

Query: 235 QKELVDPMFQYKXXXXXXXXXXXXXXX-XXLYSLHALNHVYKTRDRILKNNQKLQENNDE 293
           Q+++VDP+FQY+                  LY LH LNH+YKTRDRILK+NQ+L  N D 
Sbjct: 239 QRKIVDPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYKTRDRILKDNQRLATNPDG 298

Query: 294 ELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPK 353
           E LDQGFTRPKVLIV PTRD A++IV K++EKSGLDQ DKKSK  DQFFED LPP+SKPK
Sbjct: 299 EFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPK 358

Query: 354 SFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDF 413
           SF+H F+GNTNDFFVLG+KFTRK++++YSNFYQSD+I+CSPLG+QLILENTD+KKRQDDF
Sbjct: 359 SFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDF 418

Query: 414 LSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQT 473
           LSSIE+MIIDQL+SIE+QN  H+ TIF H+NKIP++Q + DF R+RMWYINEQAK  RQT
Sbjct: 419 LSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQT 478

Query: 474 IVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTA 533
           ++FT+Y++P AN +LNGKCRN+ GRWKNH +I  EQSS+ +LG +VRQIFQR DL G + 
Sbjct: 479 LIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASV 538

Query: 534 LDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEY 593
           +DEPDYRF+FFTSVIVPSI KSTGYEDGILLYIPDY DFIRVRNYLK+KTTI+FG+INEY
Sbjct: 539 VDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEY 598

Query: 594 SNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNI 653
           S+ +QLTS R+ FQ G++KVLLYTERLHHFRRYEIK VKSVIFY+PP NPEFY+EVVR I
Sbjct: 599 SDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYI 658

Query: 654 GKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
           GK+ FLG+ D+NISTVRC+YSK+DGL+LER+V SKRAAVL HGQNE+YEFK
Sbjct: 659 GKSAFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/717 (57%), Positives = 522/717 (72%), Gaps = 30/717 (4%)

Query: 9   KSGRKQLREITRA--GQKR---------VRYDDEATVAD-LTPDNESDSDNAEPSVAAER 56
           K GR QLR I R+   +KR          +++DE+  AD L    E++S++ +   A + 
Sbjct: 9   KRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGEEAESESDD---AKDE 65

Query: 57  EDVEQHRGQAYNALLTLLKSEHPERXXXXXXXXXXDSQRAEEDS--PENDGINSEDEQQN 114
           EDV + R Q Y ALLT+LKSEHPE+             + +ED+    +D  N  D+Q+ 
Sbjct: 66  EDVGKKRNQVYGALLTILKSEHPEKKKQKKK-----FNQEKEDAYNASDDEYNVSDKQE- 119

Query: 115 IENALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXHFSKYSESRLYAFDKGFKDKTV 173
           IEN L                                 HF++  E+ +     GF +K +
Sbjct: 120 IENGLEDQQDDNEDENENDMENMENDDESDDDTDLFDIHFNQVPENVVDKISNGFDNKKI 179

Query: 174 KYKSSKTDV--SEEESLIYSKPCLDDEEVLPVKG---KQTLSSYFIKQKLKLANDFQNNG 228
           KY S K  +   E++  IYSKP +DD     V+    K +L SYFIK++L++ N+  +  
Sbjct: 180 KYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEITNNLLDGK 239

Query: 229 LPLTEIQKELVDPMFQY-KXXXXXXXXXXXXXXXXXLYSLHALNHVYKTRDRILKNNQKL 287
             LT++QK LVDPMFQY                   LY+LH LNH+YKTRD++LK+NQ+L
Sbjct: 240 DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKDNQRL 299

Query: 288 QENNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLP 347
           QENN+ E LDQGFTRPKVLIVVPTRD A+ +V  I+ KSGLDQ +KK KF+ QFFEDSLP
Sbjct: 300 QENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFEDSLP 359

Query: 348 PTSKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKK 407
           P+SKPKSFQ IF+GNTNDFFVLGLKFTRK+LK+YSNFYQSD+IICSPLG+ +I ENTDKK
Sbjct: 360 PSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITENTDKK 419

Query: 408 KRQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQA 467
           K+QDDFLSSIE+ I+DQLHS+EYQN  H+  IF+H+NKIP +Q +ADFSRIRMWYIN+QA
Sbjct: 420 KKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYINDQA 479

Query: 468 KFFRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFD 527
           + FRQT++FTKY+SP AN+++NGKCRN+AGRW+N  ++  E+SS+G+LGLK+RQIFQRFD
Sbjct: 480 RLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRFD 539

Query: 528 LAGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIF 587
           L GGT  DEPD+RFKFF SV++ SI+KSTGYEDGIL+YIP+Y+D++RVRNY+KEKTT++F
Sbjct: 540 LVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKTTLLF 599

Query: 588 GEINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYS 647
           G+INEYS+Q++L SNR+ FQ G+VKVLLYTERLHH+RRYEIK VKSVIFY PP NPEFY+
Sbjct: 600 GDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFYN 659

Query: 648 EVVRNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
           EVVR IGKN FLGN DINI+TVR +YSK+D LSLER+VG++RAAVL+  +NEVYEFK
Sbjct: 660 EVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEFK 716

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/715 (56%), Positives = 507/715 (70%), Gaps = 42/715 (5%)

Query: 9   KSGRKQLREITRAGQKRVRYDDEAT-----VADLTPDNESDSDNAEPSVAAEREDVEQHR 63
           K GRKQLR ITR G+     +DEA        +     E  S+    +  AE +D     
Sbjct: 13  KRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAE-DDGGARE 71

Query: 64  GQAYNALLTLLKSEHPERXXXXXXXXXXDSQRAEED----------SPENDGINSEDEQQ 113
            Q+Y ALLTLL +EH ++          ++  A E           + EN   ++ED + 
Sbjct: 72  SQSYGALLTLLSAEHGKQRKKRLRKAEAEAAEAAEAGEDPEEAITAALENSAQDAEDAED 131

Query: 114 NIENALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHFSKYSESRLYAFDKGFKDKTV 173
             +++                                 HF++ S + +   D  FK+   
Sbjct: 132 AFDDS---------------------GESDEEQDHFDVHFNRVSAADVAQLDAAFKNGRA 170

Query: 174 KYKSSKTDVSEEESLIYSKPCLDDEEV-LPVK-GKQTLSSYFIKQKLKLANDFQNNG--L 229
           +Y+  K    EEE ++YSKP    E    PV+   ++L  Y IKQ+L++ N    +    
Sbjct: 171 QYRVQKEARGEEE-ILYSKPVASSEGTEGPVRVPARSLRGYAIKQRLRMHNGLTADDPEK 229

Query: 230 PLTEIQKELVDPMFQYKXXXXXXXXXXXXXXXXXLYSLHALNHVYKTRDRILKNNQKLQE 289
           PLT  QK L+DPMFQY+                 LY+LH LNHVYKTRDRILKNNQKLQ+
Sbjct: 230 PLTPQQKVLLDPMFQYQDILYEYEGYDREREYRELYTLHILNHVYKTRDRILKNNQKLQD 289

Query: 290 NNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPT 349
           N D+ELLDQGFTRPK L+VVPTR  A+ +V  ++++SG++Q DKKSKF+DQF++ SLPP 
Sbjct: 290 NPDQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPA 349

Query: 350 SKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKR 409
           SKPKSFQH+F+GNTNDFFVLG+KFTRK++++YSNFYQSD+I+CSPLG+QLI+ENTDKKKR
Sbjct: 350 SKPKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKR 409

Query: 410 QDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKF 469
           QDDFLSSIEVM++DQLHSIE+QN  HV+ IF HINKIP+QQR+ADFSRIRMWYI +QAK 
Sbjct: 410 QDDFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKL 469

Query: 470 FRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLA 529
           FRQT+VFT+YISPFAN++LN KC N AGR K+HR +  E+S IGQLGLK+RQIFQRF++ 
Sbjct: 470 FRQTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVL 529

Query: 530 GGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGE 589
           GG+ +DEPD+RFKFFTSV+VP I K+TGY+ GILLYIP+YTDFIRVRNYLK+KT I+FG+
Sbjct: 530 GGSTVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGD 589

Query: 590 INEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEV 649
           INEYS+Q+QLTSNRA FQ G++KVLLYTERLHHFRR+E+K VKSVI YKPP NPEFY E+
Sbjct: 590 INEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQEL 649

Query: 650 VRNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704
           +R IGK+ FLG  D+NI+TVRC+YSKMD L+LER+VG+KRAAVL HGQNEVYEFK
Sbjct: 650 LRYIGKSAFLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/554 (64%), Positives = 447/554 (80%), Gaps = 14/554 (2%)

Query: 163 AFDKGFKDKTVKYKSSKTDVSE------EESLIYSKPCLDDE--EVLPVKGKQTLSSYFI 214
           A     KD  ++YKS K  V        +E  I+S P ++ E  ++   K K +LSSYF+
Sbjct: 149 ALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGETPKIEDPKLKCSLSSYFL 208

Query: 215 KQKLKLAN---DFQNNGLPLTEIQKELVDPMFQYKXXXXXXXXX-XXXXXXXXLYSLHAL 270
           K++L++ N   D ++N L  T++Q+++VDPM QYK                  LY+LH L
Sbjct: 209 KKRLRIQNNLLDTESNAL--TDLQRKIVDPMMQYKDILYEYDTYGKDEDEYRDLYTLHVL 266

Query: 271 NHVYKTRDRILKNNQKLQENNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQ 330
           NHVYKTRD+I+KNNQKLQ+N D E LDQGFTRPKVLI+ PTRD+A++IV K++EKSGLDQ
Sbjct: 267 NHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDSAYQIVTKLIEKSGLDQ 326

Query: 331 FDKKSKFEDQFFEDSLPPTSKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDII 390
            DKK KF DQF++ S PP+SKPKSFQHIF+GNTND+FVLG+KFTRK++K+YSNFYQSDII
Sbjct: 327 VDKKGKFRDQFYDPSFPPSSKPKSFQHIFKGNTNDYFVLGVKFTRKAIKLYSNFYQSDII 386

Query: 391 ICSPLGIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQ 450
           +CSPLG+Q+I+ENTDKKKRQDDFLSS+EV IIDQ HSIEYQN  H+ TIF H+NKIP++Q
Sbjct: 387 VCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYTHLFTIFDHLNKIPQEQ 446

Query: 451 READFSRIRMWYINEQAKFFRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQS 510
            +ADFSRIRMWYIN+QAKFFRQT++FTKYISP ANS+LN KCRNL GRWKNH+ +  E S
Sbjct: 447 HDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRNLEGRWKNHKIVSSEDS 506

Query: 511 SIGQLGLKVRQIFQRFDLAGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYT 570
           S+G +GLKVRQIFQRF++ G +  DEPDYRFKFFTSV++ +I KSTGY+DG L+YIP+Y+
Sbjct: 507 SVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITKSTGYDDGTLIYIPEYS 566

Query: 571 DFIRVRNYLKEKTTIIFGEINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKN 630
           D++RVRNY+KEKT+I+FG+INEYS Q+ LTSNR  F  G++KVLLYTERLHHFRRYE+K 
Sbjct: 567 DYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVLLYTERLHHFRRYELKG 626

Query: 631 VKSVIFYKPPGNPEFYSEVVRNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRA 690
           VK+V+FYKPP +PEFY EVVR IGK VFLG+ D+NISTVRC YSK+DGL+LE++VG+KR 
Sbjct: 627 VKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYSKLDGLALEKIVGTKRT 686

Query: 691 AVLAHGQNEVYEFK 704
            VL HGQNE YEFK
Sbjct: 687 GVLTHGQNETYEFK 700

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 9  KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAERED---VEQHRGQ 65
          K GRK+LR I RA  KR + + EA   D   ++      A P+V  + +D    E  + Q
Sbjct: 3  KRGRKELRSIRRA--KRTKIEPEA---DAGVESSGSVLEAGPAVEEKVQDDGEKEDDKEQ 57

Query: 66 AYNALLTLLKSEHPE 80
           YNALLT+LKSEH E
Sbjct: 58 VYNALLTILKSEHKE 72

>Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii AFR452C
          Length = 565

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 92/208 (44%), Gaps = 49/208 (23%)

Query: 471 RQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGL--KVRQIFQRFDL 528
           +QT++FT  +S     I NG  RN            P   +IG  G   +++QI +    
Sbjct: 349 KQTLMFTATMSSSIERIANGYLRN------------PGFVTIGGSGSAPQIQQIIEY--- 393

Query: 529 AGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDY---TDFIRVRNYLKE---K 582
               A DE   RFK  T  I+P+      Y   ++++I +Y    D++ +R + +E   +
Sbjct: 394 ---VATDE--QRFKMLTQDILPN------YRPPVIIFI-NYKVTADWL-LRKFQEESKFR 440

Query: 583 TTIIFGEINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGN 642
            TI+ G  ++   +  L +    F+ GKV +++ T+     R  +I NV  V+ ++ P  
Sbjct: 441 VTILHGSKSQTQREHSLKA----FREGKVDIMVATDVAG--RGIDIPNVSLVVNFQMPSK 494

Query: 643 PEFYSEVVRNIGKN-------VFLGNCD 663
            + Y   +   G+         FLG+ D
Sbjct: 495 LDDYIHRIGRTGRANQKGTTLTFLGDKD 522

>Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa]
           {ON} YFL002C (SPB4) - ATP-dependent RNA helicase [contig
           7] FULL
          Length = 598

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 9/71 (12%)

Query: 568 DYTDFIRVRNYLKEKTTIIFGEINEYSN--QKQLTSNRARFQHGKVKVLLYTERLHHFRR 625
           DY DF+ V+N   ++ T  F  I+++ +  +K + ++RARF+H  VK  +       F R
Sbjct: 381 DYVDFLEVKNIELKEMTCAFTPIDQFESLFRKWILADRARFEHS-VKAYV------AFIR 433

Query: 626 YEIKNVKSVIF 636
           Y  K+  S IF
Sbjct: 434 YYSKHSASSIF 444

>YKR007W Chr11 (451434..451988) [555 bp, 184 aa] {ON}  MEH1Component
           of the EGO complex, which is involved in the regulation
           of microautophagy, and of the GSE complex, which is
           required for proper sorting of amino acid permease
           Gap1p; loss results in a defect in vacuolar
           acidification
          Length = 184

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 46/101 (45%), Gaps = 10/101 (9%)

Query: 307 IVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQGNTNDF 366
           IV+   D    + ++  E+ G  + D++S  +D     S+P +   ++  H     TN F
Sbjct: 82  IVIQGTDLQEALDKRQQEEGGDSREDERSAGDDNLSGHSVPSSGSAQATTHQTAPRTNTF 141

Query: 367 FVL----GLKFTRKSL-KIYSN-----FYQSDIIICSPLGI 397
            +L      K +++ L K++SN     F QS +    PL +
Sbjct: 142 TLLTSPDSAKISKEQLKKLHSNILNEIFSQSQVNKPGPLTV 182

>Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON}
           YDR243C (REAL)
          Length = 587

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 78/184 (42%), Gaps = 42/184 (22%)

Query: 463 INEQAKFFRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQI 522
           +N  +   RQT++FT  ++P    I  G  R            KP  ++IG        I
Sbjct: 363 VNVDSATNRQTLMFTATMTPVIEKIAAGYMR------------KPVYATIGLDTGSEPLI 410

Query: 523 FQRFDLAGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKE- 581
            Q  + A     D  + +FK   SV++        YE  I+++I    ++ +  ++L E 
Sbjct: 411 RQVVEYA-----DNEEEKFKKLKSVVIK-------YESPIIIFI----NYKQTADWLAER 454

Query: 582 -------KTTIIFGEINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSV 634
                  K TI+ G      +Q+Q   +   F+ GKV++++ T      R  +I NV  V
Sbjct: 455 FQTETNMKVTILHGS----KSQEQREHSLQLFRTGKVQIMIATNVAA--RGLDIPNVSLV 508

Query: 635 IFYK 638
           + ++
Sbjct: 509 VNFQ 512

>TPHA0B01790 Chr2 complement(396879..403103) [6225 bp, 2074 aa] {ON}
            Anc_4.310 YLR430W
          Length = 2074

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 267  LHALNHVYKTRDRILKNNQKLQ-ENNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKI 322
            L  + H+  T+D + KN  K+  E N    L+Q   R KVLI  P+  A  +I  ++
Sbjct: 1373 LGIVGHILTTQDALPKNIIKVPGEQNSSPALEQTLKRKKVLICAPSNAAVDEICLRL 1429

>Kwal_47.19313 s47 complement(1186091..1189306) [3216 bp, 1071 aa]
           {ON} YGL251C (HFM1) - C4 zinc finger DNA-binding protein
           of low sequence specificity in vitro; Probable 119 kD
           DNA/RNA helicase family member [contig 344] FULL
          Length = 1071

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 387 SDIIICSPLGIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKI 446
           ++++I +P    L+  N D    Q+ FL ++ +M++D++HSI+ +    +  I   +N +
Sbjct: 180 TNLVIMTPEKCDLLSRNRDI---QNIFLHTLSLMLVDEVHSIKEERGAILEVIIMRLNLL 236

Query: 447 PEQQR 451
               R
Sbjct: 237 SNTLR 241

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,419,114
Number of extensions: 3367410
Number of successful extensions: 11962
Number of sequences better than 10.0: 45
Number of HSP's gapped: 12271
Number of HSP's successfully gapped: 58
Length of query: 704
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 587
Effective length of database: 40,065,477
Effective search space: 23518434999
Effective search space used: 23518434999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)