Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E08207g2.293ON48648624340.0
SAKL0E07524g2.293ON47947912981e-176
KLTH0G10516g2.293ON47447612191e-164
Kwal_27.115002.293ON47547911981e-161
Ecym_33322.293ON51351511851e-158
Smik_9.892.293ON49149011761e-157
Suva_9.1092.293ON49149411741e-157
Skud_9.832.293ON49149411721e-157
ADL208W2.293ON50250211681e-156
YIL090W (ICE2)2.293ON49149411591e-155
CAGL0D04202g2.293ON49949611521e-153
TDEL0G022302.293ON48848811491e-153
NDAI0B035202.293ON50149411311e-150
KNAG0A053902.293ON49748111271e-150
KAFR0J013302.293ON49148711231e-149
NCAS0B062202.293ON48648411191e-149
ZYRO0A02024g2.293ON48648710881e-144
Kpol_1003.422.293ON49049210421e-137
TPHA0C034402.293ON5795519091e-116
TBLA0B059802.293ON4934969011e-116
TBLA0B069902.293ON5365358701e-111
Kpol_526.194.161ON23861731.4
KNAG0G028008.718ON82943751.6
SAKL0A07194g6.112ON71688705.9
Suva_12.555.179ON399118696.4
SAKL0H05544g8.718ON82143698.0
KLLA0C07491g8.718ON82943689.1
KAFR0A040908.718ON85043689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E08207g
         (486 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   942   0.0  
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   504   e-176
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   474   e-164
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   466   e-161
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   461   e-158
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   457   e-157
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   456   e-157
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   456   e-157
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   454   e-156
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   451   e-155
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   448   e-153
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   447   e-153
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   440   e-150
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   438   e-150
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   437   e-149
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   435   e-149
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   423   e-144
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   405   e-137
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   354   e-116
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   351   e-116
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            339   e-111
Kpol_526.19 s526 complement(52696..53412) [717 bp, 238 aa] {ON} ...    33   1.4  
KNAG0G02800 Chr7 complement(619337..621826) [2490 bp, 829 aa] {O...    33   1.6  
SAKL0A07194g Chr1 (638606..640756) [2151 bp, 716 aa] {ON} simila...    32   5.9  
Suva_12.55 Chr12 (74974..76173) [1200 bp, 399 aa] {ON} YJL026W (...    31   6.4  
SAKL0H05544g Chr8 (497300..499765) [2466 bp, 821 aa] {ON} simila...    31   8.0  
KLLA0C07491g Chr3 (653352..655841) [2490 bp, 829 aa] {ON} simila...    31   9.1  
KAFR0A04090 Chr1 complement(821972..824524) [2553 bp, 850 aa] {O...    31   9.6  

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  942 bits (2434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/486 (95%), Positives = 462/486 (95%)

Query: 1   MLHRITMEIFKQTXXXXXXXXXLEPSTIARHCAKFNVSKMPLIKKSVLQTLRIFLTTMYL 60
           MLHRITMEIFKQT         LEPSTIARHCAKFNVSKMPLIKKSVLQTLRIFLTTMYL
Sbjct: 1   MLHRITMEIFKQTRRRRSQERRLEPSTIARHCAKFNVSKMPLIKKSVLQTLRIFLTTMYL 60

Query: 61  FLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSALSTLIYYLQHLLIP 120
           FLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSALSTLIYYLQHLLIP
Sbjct: 61  FLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSALSTLIYYLQHLLIP 120

Query: 121 SILFMFLSYFENIDSDTVDSEYFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAI 180
           SILFMFLSYFENIDSDTVDSEYFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAI
Sbjct: 121 SILFMFLSYFENIDSDTVDSEYFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAI 180

Query: 181 GETERWLKMSRRSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSI 240
           GETERWLKMSRRSNQWV               FYFYRIYVTPMWELSTPSASLLGFTFSI
Sbjct: 181 GETERWLKMSRRSNQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSI 240

Query: 241 VCGIGLYGINGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLP 300
           VCGIGLYGINGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLP
Sbjct: 241 VCGIGLYGINGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLP 300

Query: 301 KKDNLLELMTKNYRAIWSQIVEHTPRNHKYIKMMDQCKWILNPLWNSVKNFTKSVPISIQ 360
           KKDNLLELMTKNYRAIWSQIVEHTPRNHKYIKMMDQCKWILNPLWNSVKNFTKSVPISIQ
Sbjct: 301 KKDNLLELMTKNYRAIWSQIVEHTPRNHKYIKMMDQCKWILNPLWNSVKNFTKSVPISIQ 360

Query: 361 EIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTKERRSFRRIMNFVYWYS 420
           EIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTKERRSFRRIMNFVYWYS
Sbjct: 361 EIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTKERRSFRRIMNFVYWYS 420

Query: 421 PCIIIAMYTHLILRYSGQLKNDLCIWGCFPYETEPKIVVDSWSFWNWCNIYSTMLIYALE 480
           PCIIIAMYTHLILRYSGQLKNDLCIWGCFPYETEPKIVVDSWSFWNWCNIYSTMLIYALE
Sbjct: 421 PCIIIAMYTHLILRYSGQLKNDLCIWGCFPYETEPKIVVDSWSFWNWCNIYSTMLIYALE 480

Query: 481 LMGSNK 486
           LMGSNK
Sbjct: 481 LMGSNK 486

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  504 bits (1298), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 263/479 (54%), Positives = 331/479 (69%), Gaps = 39/479 (8%)

Query: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101
           ++ +S++Q++R  LTT YL LVLITIPISFQVGGL CGLSFTVTLF LYF++TT K+V  
Sbjct: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSK 60

Query: 102 DRGS---ALSTLIYYLQHLLIPSILFMFLSYFEN------IDSD-TVDSE---------- 141
                  ++++ +YYLQH +IPS+LF+FLS F N      ID D  +  E          
Sbjct: 61  KYNRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRNKS 120

Query: 142 ------YFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRSNQ 195
                 ++  ++   VKPWQ  L+HSTP FTLLEG FT+L IQAIGET +WL+  + SN 
Sbjct: 121 GKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNT 180

Query: 196 WVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGSGS 254
           W+               +Y YRIYVTP+WELS  +ASLLGFT SIVCG+GLYGI +G GS
Sbjct: 181 WIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGS 240

Query: 255 VMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLLE----LMT 310
           V+ESSLFFAY+VR +YEISP++A +AMDEIF IVK+TW+ HQ NLP  DNLL     ++ 
Sbjct: 241 VIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPT-DNLLSYYRNVVL 299

Query: 311 KNYRAIWSQIVEHTPRNHKYIKMMDQCKWILNPLWNSVKNFTKSVPISIQEIFVVTFKMA 370
           KN   IW  IV+ T         M   +  L PLW   KNFT SVP SI+EIF VT KMA
Sbjct: 300 KNGEMIWDAIVQKTGTTSPSTTQMVWLR--LQPLWKFTKNFTISVPSSIREIFRVTLKMA 357

Query: 371 KESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNFVYWYSPCIIIAMYT 429
            ES+ P VVINLVFR+L+FYSATRIIP LQ+ ++  R+S RR+M  +YWYSPCI+IAMYT
Sbjct: 358 TESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMYT 417

Query: 430 HLILRYSGQLKNDLCIWGCFPY----ETEPKIVVDSWSFWNWCNIYSTMLIYALELMGS 484
           HLIL+YSG+L NDLC+WGCFP+    +   K+VVD+W FWNWCN++ T+ IY LEL+G 
Sbjct: 418 HLILQYSGELNNDLCLWGCFPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIYGLELIGG 476

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  474 bits (1219), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 257/476 (53%), Positives = 320/476 (67%), Gaps = 33/476 (6%)

Query: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101
           +  +SV+Q+ R+ LT+ YL L+LITIPISFQVGGL CGLSFTVTLF LY ++TT K+   
Sbjct: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 102 DRGSA-LSTLIYYLQHLLIPSILFMFLSYFEN------IDSDTVDSE------------- 141
            RG A L++  YY QH  IPS+LF+FLS F N      ID++T   E             
Sbjct: 61  ARGLAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTNTRPDESLIDLLRSTTQSQ 120

Query: 142 ---YFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRSNQWVX 198
              ++  ++  +V+PWQ  L+ STP FTLLEG FT+L IQA+GET RWL     SN WV 
Sbjct: 121 TWVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMWVI 180

Query: 199 XXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGSGSVME 257
                         +Y YRIYVTP+WELS  +ASLLGFTFSIV G+G+YGI +G GS +E
Sbjct: 181 SGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGSTIE 240

Query: 258 SSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----ELMTKNY 313
           SSLFFAY+VR +YEISP++A +AMDEIF +VKETW     +L   D LL    +++ KN 
Sbjct: 241 SSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILKNG 300

Query: 314 RAIWSQIVEHTPRNHKYIKMMDQCKW-ILNPLWNSVKNFTKSVPISIQEIFVVTFKMAKE 372
             +W  I+  T  N           W  + PLW  VK+FT SVP SIQEIF +T +MA+E
Sbjct: 301 EMVWDAILARTNVNVGASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTLEMARE 360

Query: 373 SLIPAVVINLVFRLLIFYSATRIIPTLQRNTKERRSFRRIMNFVYWYSPCIIIAMYTHLI 432
           ++ PAVVINL FR+LIFYSATRIIP LQ+  K +R  RR M  +YWYSPCI+IAMYTHLI
Sbjct: 361 AIAPAVVINLCFRILIFYSATRIIPALQK--KHKRRSRRFMRMLYWYSPCIVIAMYTHLI 418

Query: 433 LRYSGQLKNDLCIWGCFPYET--EPKIVVDSWSFWNWCNIYSTMLIYALELMGSNK 486
           L+YSGQ+ NDLC+WGCFP+     PK+VVDSW FWNWCNI+ TM IYA EL+GS  
Sbjct: 419 LQYSGQISNDLCLWGCFPWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASELLGSKS 474

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  466 bits (1198), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 253/479 (52%), Positives = 322/479 (67%), Gaps = 39/479 (8%)

Query: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101
           +I +S+LQ++R+ LT+ YL L+LITIPI+FQVGGL CGLSFTVTLF LY ++TT K+   
Sbjct: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 102 DRGSA-LSTLIYYLQHLLIPSILFMFLSYFEN------IDSDTVDSE------------- 141
            RG A L++  YY QH  IPS+LF+FLS F N      ID++T   E             
Sbjct: 61  ARGFAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLIDLLRSSTHSQ 120

Query: 142 ---YFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRSNQWVX 198
              ++  +++ +V+PWQ  L+ STP FTLLEG FT+L IQA+GET RWL     SN WV 
Sbjct: 121 PWIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVWVI 180

Query: 199 XXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGSGSVME 257
                         +Y YRIYVTP+WELS  +ASLLGFTFSIV G+G++GI +G GS +E
Sbjct: 181 SGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGSTIE 240

Query: 258 SSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----ELMTKNY 313
           SSLFFAY+VR +YEISP++A +AMDEI ++VK+TW     +L   D  L    +++ KN 
Sbjct: 241 SSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILKNG 300

Query: 314 RAIWSQIVEHTPRNHKYIKMMDQCKWI----LNPLWNSVKNFTKSVPISIQEIFVVTFKM 369
             IW  ++  T  N   +       WI    + PLW  VK+FT SVP SIQEIF++T  M
Sbjct: 301 EMIWDAVLARTNVN---VSGAGPVAWISWHRVQPLWKFVKHFTSSVPSSIQEIFLLTLSM 357

Query: 370 AKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTKERRSFRRIMNFVYWYSPCIIIAMYT 429
           A+E++ PAVVINL FR+LIFYSATRIIP LQR  K +R  RR M  +YWYSPCI+IAMYT
Sbjct: 358 AREAIAPAVVINLCFRILIFYSATRIIPALQR--KHKRRSRRFMRMLYWYSPCIVIAMYT 415

Query: 430 HLILRYSGQLKNDLCIWGCFPYE--TEPKIVVDSWSFWNWCNIYSTMLIYALELMGSNK 486
           HLI++YSGQ+ NDLC+WGCFP+      K+VVDSW FWNWCNI+ TM IYA EL GS  
Sbjct: 416 HLIMQYSGQISNDLCLWGCFPWSPPEGSKVVVDSWGFWNWCNIFCTMAIYASELFGSKS 474

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  461 bits (1185), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 259/515 (50%), Positives = 328/515 (63%), Gaps = 75/515 (14%)

Query: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101
           ++ + +L+++R  L   YLFLVLITIPISFQVGGL CGLSFTVTLF LYF +TT K+   
Sbjct: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTT 60

Query: 102 DRGSA----LSTLIYYLQHLLIPSILFMFLSYFEN------IDSDTV--DSEYFKVFWNV 149
           + GS     L++LIYYLQH LIPSILF+FLS F +      +DSD V   S+ F    NV
Sbjct: 61  N-GSGKFKLLASLIYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNV 119

Query: 150 ---------------------------MVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGE 182
                                      +VKPWQ  L+H+TP FTL EG FT+LAIQAIGE
Sbjct: 120 NESLLQLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179

Query: 183 TERWLKMSRRSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVC 242
           T RWL+  + SN WV               FY YRIYVTP+W LS  +A+LLGFT S+V 
Sbjct: 180 TGRWLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239

Query: 243 GIGLYGI-NGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPK 301
           G+GLYGI +G GS +ESSLFFAYMVR +YEISP++A+ AM EIF +V +TW++ Q  L  
Sbjct: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-S 298

Query: 302 KDNLL---ELMTKNYRAIWSQIVEHTPRN----------------------HKYIKMMDQ 336
           K+NLL        N  + W  +++ T                          K   ++ Q
Sbjct: 299 KNNLLTYYNTFVSNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLIILQ 358

Query: 337 CKWIL--NPLWNSVKNFTKSVPISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATR 394
            +W L    +W+  KNF+  +P SI EI +VT KMAKES+ PAV+ NLVFR+L+FYSATR
Sbjct: 359 TQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATR 418

Query: 395 IIPTLQRNTKERRSFRRIMNFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGCFPY--- 451
           IIP LQ+ T   +S R++M  +YWYSPCI+IAMYTHLILRYSG+L NDLCIWGCFP+   
Sbjct: 419 IIPALQKATGATQS-RKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNF 477

Query: 452 --ETEPKIVVDSWSFWNWCNIYSTMLIYALELMGS 484
             +T  K VVD+WSFWNWCN++ T+LIYA+EL+GS
Sbjct: 478 SAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  457 bits (1176), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 241/490 (49%), Positives = 311/490 (63%), Gaps = 44/490 (8%)

Query: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99
           M  + KS +Q+ RI     YL   L++IPISF+VGGL CGLSFTVTLF LYF++TT  ++
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 100 LLDRGSAL----STLIYYLQHLLIPSILFMFLSYFEN----------------------- 132
               G  L    ++ +YY QH +I S+L++FLS F N                       
Sbjct: 61  ARRYGGKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKKRPNESESFLEALKN 120

Query: 133 -IDSDTVDSEYFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSR 191
            ++S+ ++   +  ++  +V+PWQ  L  STP FTL EG FTILAIQA+GET RWL    
Sbjct: 121 SLNSNQINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 192 RSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-N 250
            SN W+               +Y YRIYVTP+W LS  +ASLLGF  S+VCG+GLYGI +
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 251 GSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL---- 306
             GSV+ESSLFFAY+VR +YEISPK+A  A DEI D+ K+ W+ HQ NLP  DNLL    
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 307 ELMTKNYRAIWSQIVEHTPR-----NHKYIKMM--DQCKWILNPLWNSVKNFTKSVPISI 359
            ++ KN   +W   +    +     + K I ++  ++   I  P W   KNFT SVP+SI
Sbjct: 301 NVILKNAEMLWGSFIPRGRKKTGDFHDKLISVLSFEKVSLISKPFWKFFKNFTFSVPLSI 360

Query: 360 QEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNFVYW 418
            E   VT KMA ES+ PA+V+NL FR+L+FYSATRIIP LQR N K+ R  RRIM  +YW
Sbjct: 361 NEFCQVTIKMASESVSPAIVVNLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 419 YSPCIIIAMYTHLILRYSGQLKNDLCIWGCFPY---ETEPKIVVDSWSFWNWCNIYSTML 475
           YSPCI+IAMYTHLIL+YSG+LK DLCIWGC        +P+I+VDSW FWNWCNI+ T+L
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGSDQPEIIVDSWGFWNWCNIFCTIL 480

Query: 476 IYALELMGSN 485
           +YA EL+GS 
Sbjct: 481 VYATELIGSG 490

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  456 bits (1174), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 248/494 (50%), Positives = 308/494 (62%), Gaps = 50/494 (10%)

Query: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99
           M  + KS +Q+ RI     YL   L++IPISF+VGGL CGLSFTVTLF LYF++TT  ++
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 100 LLDRGSAL----STLIYYLQHLLIPSILFMFLSYFENIDSDTV------DSEYF------ 143
               G  L    ++ +YY QH +I S+LF+FLS F N +   V      +SE F      
Sbjct: 61  ARRNGGRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKNRSNESESFLEALKN 120

Query: 144 ------------KVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSR 191
                         ++  +V+PWQ  L  STP FTL EG FTILAIQA+GET RWL    
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 192 RSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-N 250
            SN W+               +Y YRIYVTP+W LS  +ASLLGF  S+VCG+GLYGI +
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 251 GSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL---- 306
             GSV+ESSLFFAY+VR +YEISPK+A  A DEI D+ K+ W+ HQ NLP  DNLL    
Sbjct: 241 QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 307 ELMTKNYRAIWSQIVEHTPRNHK----------YIKMMDQCKWILNPLWNSVKNFTKSVP 356
            ++ KN   +W   +   PR  K           I   ++   I  P W   KNFT SVP
Sbjct: 301 NVILKNAEVLWGSFI---PRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVP 357

Query: 357 ISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNF 415
           +SI E   VT KMA ES+ PA+VINL FR+L+FYSATRIIP LQR N K+ R  RRIM  
Sbjct: 358 LSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKG 417

Query: 416 VYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGCFPY---ETEPKIVVDSWSFWNWCNIYS 472
           +YWYSPCI+IAMYTHLIL+YSG+LK DLCIWGC        +P+I+VDSW FWNWCNI+ 
Sbjct: 418 LYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFC 477

Query: 473 TMLIYALELMGSNK 486
           T+L+YA EL+GS  
Sbjct: 478 TILVYATELVGSGS 491

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  456 bits (1172), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 248/494 (50%), Positives = 309/494 (62%), Gaps = 52/494 (10%)

Query: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99
           M  + KS +Q+ R+     YL   L++IPISF+VGGL CGLSFTVTLF LYF++TT  ++
Sbjct: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 100 LLDRGSAL----STLIYYLQHLLIPSILFMFLSYFENIDSDTV------DSEYF------ 143
               G  L    +  +YY QH +I S+L++FLS F N +   V      +SE F      
Sbjct: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD 120

Query: 144 ------------KVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSR 191
                         ++  +V+PWQ  L  STP FTL EG FTILAIQA+GET RWL    
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 192 RSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-N 250
            SN W+               +Y YRIYVTP+W LS  +ASLLGF  S+VCG+GLYGI +
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 251 GSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL---- 306
             GSV+ESSLFFAY+VR +YEISPK+A  A DEI D+ K+ W+ HQ NLP  DNLL    
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 307 ELMTKNYRAIWSQIVEHTPRNHK----------YIKMMDQCKWILNPLWNSVKNFTKSVP 356
            ++ KN   +W   +   PR  K           I   ++   I  P W   KNFT SVP
Sbjct: 301 NVVLKNAEMLWGSFI---PRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVP 357

Query: 357 ISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNF 415
           +SI E   VT KMA ES+ PA+VINL FR+L+FYSATRIIP LQR N K+ R  RRIM  
Sbjct: 358 LSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRG 417

Query: 416 VYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGC----FPYETEPKIVVDSWSFWNWCNIY 471
           +YWYSPCI+IAMYTHLIL+YSG+LK DLCIWGC    F  E +P+I+VDSW FWNWCNI+
Sbjct: 418 LYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAE-QPEIIVDSWGFWNWCNIF 476

Query: 472 STMLIYALELMGSN 485
            T+L+YA EL+GS 
Sbjct: 477 CTILVYATELIGSG 490

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  454 bits (1168), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 241/502 (48%), Positives = 319/502 (63%), Gaps = 60/502 (11%)

Query: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101
           ++ K +L++LR  L + YLFLVLIT+PISFQ+GGL CGLSFTVTLF LYFV+TT K+   
Sbjct: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60

Query: 102 DRGSA---LSTLIYYLQHLLIPSILFMFLSYFEN-------IDSDTVDSEYFKVF----- 146
            RG     +++ +YYLQH L+PSILF+FLS F N       + SD   +    +F     
Sbjct: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120

Query: 147 ----------------------WNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETE 184
                                 +  +V+PWQ  L+H+TP FTL EG FT+LAIQ IGET 
Sbjct: 121 ESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180

Query: 185 RWLKMSRRSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGI 244
           RWL+  R S  WV               +Y YRIYVTP+W LS  +A+LLGFT S+V G+
Sbjct: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240

Query: 245 GLYGI-NGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKK- 302
           GLYGI +G GS +ESSLFFAYMV  +YEISP++A+ AM EIF +V  TW++ Q  LPK  
Sbjct: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPKNS 300

Query: 303 ------------DNLLELMTKNYRAIWSQIVEHTPRNH--KYIKMMDQCKW--ILNPLWN 346
                       +NL +++ K    + S  ++  P +   K   ++ Q +W      LW+
Sbjct: 301 LLAYYKNFILNAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQLWS 360

Query: 347 SVKNFTKSVPISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTKER 406
             KNF+  +P SI EIF+VT  +A+ES+  AVV NLVFR+++FYSATRIIP LQR T   
Sbjct: 361 FTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATGGT 420

Query: 407 RSFRRIMNFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGCFPY----ETEPKIVVDSW 462
           +S R++M  +YWYSPCI+IAMYTH+ILRYSG+L N+LCIWGCFP+        + VVD+W
Sbjct: 421 QS-RKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVVDAW 479

Query: 463 SFWNWCNIYSTMLIYALELMGS 484
            FWNWCN++ T+LIYA+EL+GS
Sbjct: 480 GFWNWCNLFFTLLIYAVELIGS 501

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  451 bits (1159), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 246/494 (49%), Positives = 308/494 (62%), Gaps = 52/494 (10%)

Query: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99
           M  + KS +Q+ RI     YL   L++IPISF+VGGL CGLSFTVTLF LYF++TT  ++
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 100 LLDRGSAL----STLIYYLQHLLIPSILFMFLSYFENIDSDTV------DSEYF------ 143
               G  L    +  +YY QH +I S+L++FLS F N +   V      +SE F      
Sbjct: 61  ARRHGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKN 120

Query: 144 ------------KVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSR 191
                         ++  +V+PWQ  L  STP FTL EG FTILAIQA+GET RWL    
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 192 RSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-N 250
            SN W+               +Y YRIYVTP+W LS  +ASLLG   S+VCG+GLYGI +
Sbjct: 181 NSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVS 240

Query: 251 GSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL---- 306
             GSV+ESSLFFAY+VR +YEISPK+A  A DEI ++ K+ W+ HQ NLP  DNLL    
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 307 ELMTKNYRAIWSQIVEHTPRNHK----------YIKMMDQCKWILNPLWNSVKNFTKSVP 356
            ++ KN   +W   +   PR  K           I   ++   I  P W   KNFT SVP
Sbjct: 301 NVILKNAEVLWGSFI---PRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVP 357

Query: 357 ISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNF 415
           +SI E   VT KMA ES+ PA+VINL FR+L+FYSATRIIP LQR N K+ R  RRIM  
Sbjct: 358 LSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKG 417

Query: 416 VYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGC----FPYETEPKIVVDSWSFWNWCNIY 471
           +YWYSPCI+IAMYTHLIL+YSG+LK DLCIWGC    F  + +P+I+VDSW FWNWCNI+
Sbjct: 418 LYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVD-QPEIIVDSWGFWNWCNIF 476

Query: 472 STMLIYALELMGSN 485
            T+L+YA EL+GS 
Sbjct: 477 CTILVYATELIGSG 490

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  448 bits (1152), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 244/496 (49%), Positives = 323/496 (65%), Gaps = 53/496 (10%)

Query: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99
           M LI + V +++RI    +YL L L++IPISF++GGL CGLSFTVTLF LY +STT  ++
Sbjct: 1   MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVL 60

Query: 100 L---LDRGSALST-LIYYLQHLLIPSILFMFLSYFEN---------------IDSDTVDS 140
                +RG   +T ++YY QHL+I  +LF+FLS F N               +D D    
Sbjct: 61  ARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFL 120

Query: 141 EYFK-------------------VFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIG 181
           +  K                    ++  +V+PWQ  L +STP FTLLEG FTILAIQAIG
Sbjct: 121 DLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIG 180

Query: 182 ETERWLKMSRRSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIV 241
           ET +WL     SN W+               +Y YRIYVTP+W+L+  SASLLGF  SIV
Sbjct: 181 ETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIV 240

Query: 242 CGIGLYGI-NGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLP 300
             +GLYGI +  GSV+ESSLFFAY+VR +YEISPK+A  A +EI D+VK+ W+ HQ NL 
Sbjct: 241 FCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLL 300

Query: 301 KKDNLL----ELMTKNYRAIWSQIVEHTPRNHKYIKMMDQCKWILN--PLWNSVKNFTKS 354
            +DNLL     ++ KN   +W   +   PR+   +  M++ ++ L+  P+W   KNFT S
Sbjct: 301 NRDNLLAYYHNVVLKNAEMVWESFI--LPRSRS-LNAMEKIRFWLDVTPVWKFFKNFTVS 357

Query: 355 VPISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNT-KERRSFRRIM 413
           VP SI E+  VT+KMA ESL PAV++NL FR+LIFYSATRIIP LQR++ KE+R  RRI+
Sbjct: 358 VPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRIL 417

Query: 414 NFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGC----FPYETEPKIVVDSWSFWNWCN 469
             +YWYSPC++IAMYTHLIL+YSG+LK +LC+WGC    F  + +P+IV DSWSFWNWCN
Sbjct: 418 KLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDSWSFWNWCN 477

Query: 470 IYSTMLIYALELMGSN 485
           I+ T+L+YA EL+G+ 
Sbjct: 478 IFWTVLVYANELIGTQ 493

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  447 bits (1149), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 240/488 (49%), Positives = 304/488 (62%), Gaps = 41/488 (8%)

Query: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99
           M  I KS LQ  R+ L   YL   L+TIPISF+VGGL CGLSFTVTLF LY ++TT  +V
Sbjct: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60

Query: 100 LLDRGSAL----STLIYYLQHLLIPSILFMFLSYFENI-------DSDTVDSEYFKVFWN 148
               G+      +T IYYLQH +I S+L++FLS F N        D    +     V  N
Sbjct: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120

Query: 149 -----------------VMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSR 191
                             +V+PWQ  L HST  F L EG FT+L IQAIGET RWL    
Sbjct: 121 NVFSNHSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM 180

Query: 192 RSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-N 250
            SN W+               +Y YRIYVTP+W LS  +ASLLGFT SIVCGIGL+GI +
Sbjct: 181 NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS 240

Query: 251 GSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL---- 306
            +GSV+ESSLFFAY+VR +YEISPK+A  A DEI +++K  W+ HQ NL   +NLL    
Sbjct: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300

Query: 307 ELMTKNYRAIWSQIVEHTPRNHK----YIKMMDQCKWILNPLWNSVKNFTKSVPISIQEI 362
           +++ KN   +W  IV  T  +       I+ +++      P+W   K F  SVP SI  +
Sbjct: 301 DVVLKNAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGV 360

Query: 363 FVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNFVYWYSP 421
           F VT K+A ES+ PA+V+NL FR+L+FYSATRIIP LQR NT+E R  RRIMN +YWYSP
Sbjct: 361 FQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSP 420

Query: 422 CIIIAMYTHLILRYSGQLKNDLCIWGCFPY---ETEPKIVVDSWSFWNWCNIYSTMLIYA 478
           CI+IAMYTHLIL+YSG+L +DLC+WGC        +PKI +++W FWNWCNI+ T+LIY 
Sbjct: 421 CILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVLIYG 480

Query: 479 LELMGSNK 486
            EL+G  +
Sbjct: 481 SELIGGKR 488

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  440 bits (1131), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 237/494 (47%), Positives = 310/494 (62%), Gaps = 51/494 (10%)

Query: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101
           +I  S ++ +R F    YL   LI+IPISF++GGL CGL+FT TLF +YF+STT  L+  
Sbjct: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60

Query: 102 DRGSA----LSTLIYYLQHLLIPSILFMFLSYF------------------------ENI 133
             GS     L+  +YY QHL+I S+L++FLS F                         N+
Sbjct: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120

Query: 134 DSDTVDSEYFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRS 193
            S   +   +  ++   V+PW+  L +STP FTL EG FTILAIQA+GET +WL     S
Sbjct: 121 SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINS 180

Query: 194 NQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGS 252
           N W+               +Y YRIYVTP+W+LS  +ASLLGFT S+V G+GLYGI    
Sbjct: 181 NTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEK 240

Query: 253 GSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----EL 308
           GSV+ESSLFFAY+VR +YEISPK+A  A DEI +I KE W+ HQ NLP  DNLL      
Sbjct: 241 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNF 300

Query: 309 MTKNYRAIW----SQIVEHTPRNH-------KYIKMM---DQCKWILNPLWNSVKNFTKS 354
           + ++   +W    S+I ++ P N         ++      D    I  P+W   KNFT S
Sbjct: 301 VLRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVS 360

Query: 355 VPISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQ-RNTKERRSFRRIM 413
           VP SI E+ +VT++MA+ES+ PAVVINL FR+LIFYSATRIIP LQ RN  E +  RRIM
Sbjct: 361 VPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIM 420

Query: 414 NFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGC---FPYETEPKIVVDSWSFWNWCNI 470
             +YWYSPC++IAMYTHLIL+YSG+LK DLC+WGC   +    +P+++VDSW FWNWCNI
Sbjct: 421 KILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNI 480

Query: 471 YSTMLIYALELMGS 484
           + T++IYA EL G+
Sbjct: 481 FFTIIIYASELFGT 494

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  438 bits (1127), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 231/481 (48%), Positives = 309/481 (64%), Gaps = 44/481 (9%)

Query: 48  LQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGS-- 105
           ++  RI    +YL L LI+IPISF+VGGL CGL+FT TLF LYFVSTT  ++    G+  
Sbjct: 10  IRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNGNRI 69

Query: 106 --ALSTLIYYLQHLLIPSILFMFLSYFEN------IDSDTVDSEYFKVFWNV-------- 149
              LS+++YY QH +I S+L +FLS F N      I++D +  E      NV        
Sbjct: 70  YIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMSSSEAN 129

Query: 150 ----------MVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRSNQWVXX 199
                     +V PW+  L HSTP FTL EG FTILAIQAIGET +WL   + SN W+  
Sbjct: 130 WIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNAWIIS 189

Query: 200 XXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGSGSVMES 258
                        +Y YRIYVTP+WEL+  +ASLLGF  S+V G+G+YGI + SGSV+ES
Sbjct: 190 SLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIVSDSGSVIES 249

Query: 259 SLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----ELMTKNYR 314
           SLFFAY+VR +YEISPK+A  A DE+ ++ K+ W+  Q NLP ++NL+     ++ KN  
Sbjct: 250 SLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYYNNVILKNIE 309

Query: 315 AIWSQIVEHTPR----NHKYIKMMDQCKWILNPLWNSVKNFTKSVPISIQEIFVVTFKMA 370
             W   +  T      N+    +++       P+W   KNFT SVP SI+EI ++T+KM+
Sbjct: 310 MAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILLMTWKMS 369

Query: 371 KESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNFVYWYSPCIIIAMYT 429
            ES+ PAVVINL FR+LIFYSATRI+P+LQR + +E+R  R++M  VYWYSPCI+IAMY 
Sbjct: 370 LESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCILIAMYA 429

Query: 430 HLILRYSGQLKNDLCIWGC----FPYETEPK--IVVDSWSFWNWCNIYSTMLIYALELMG 483
           HLIL+YS +LKN+LC+WGC      Y T+    +VVD+W FWNWCN++ T+L+YA EL+G
Sbjct: 430 HLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVYANELIG 489

Query: 484 S 484
            
Sbjct: 490 D 490

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  437 bits (1123), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 240/487 (49%), Positives = 310/487 (63%), Gaps = 42/487 (8%)

Query: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99
           M L+ KS+++ LRIF  T YL   LI+IP+SF++GG++CGLSFTVTLF  YF+STT  ++
Sbjct: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60

Query: 100 LLDRGS----ALSTLIYYLQHLLIPSILFMFLSYFEN------------------IDSDT 137
               GS     L++LIYY QHL+I S+L+ FLS F N                   + D 
Sbjct: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVANQDL 120

Query: 138 VDSE----YFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRS 193
           + SE     +  +++ +VKPW+  L +STP F L EG FTILAIQAIGET RWL   + S
Sbjct: 121 MVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNS 180

Query: 194 NQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGS 252
           N W+               +Y YRIYVTP+WELS  +A+LLG   S+  G+G++GI +  
Sbjct: 181 NSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISER 240

Query: 253 GSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----EL 308
           GSV+ESSLFFAY+VR +YEISPK+A  A DEI ++ KE W+ HQ  LP  DN+L     +
Sbjct: 241 GSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSV 300

Query: 309 MTKNYRAIWSQIVEHTPR--NHKYIKMMD-QCKWI-LNPLWNSVKNFTKSVPISIQEIFV 364
           + KN   IW   +  T +  NH        +  WI  NPLW   KNFT SVP SI E+  
Sbjct: 301 ILKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSG 360

Query: 365 VTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNFVYWYSPCI 423
           +  +MA ES+ PAVV+NL FR+LIFYSATRIIP+LQR   ++ R  RRIM  +YWYSPCI
Sbjct: 361 MMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCI 420

Query: 424 IIAMYTHLILRYSGQLKNDLCIWG------CFPYETEPKIVVDSWSFWNWCNIYSTMLIY 477
           +IAMYTHLIL+YSG+LK +L +WG          + E  IVVDSWSFWNWCNI+ T+LIY
Sbjct: 421 LIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTILIY 480

Query: 478 ALELMGS 484
             EL G+
Sbjct: 481 GGELFGT 487

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  435 bits (1119), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 237/484 (48%), Positives = 313/484 (64%), Gaps = 45/484 (9%)

Query: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101
           +I  S ++ +RI   T YL   LI+IPISF++GGL+CGL+FTV+LF LYF+STT  +   
Sbjct: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60

Query: 102 DRGSA----LSTLIYYLQHLLIPSILFMFLSYFEN--------IDSDTVDS--EYFK--- 144
             GS     L+ ++YY QH +I S+L++FLS F N          +  +DS  + FK   
Sbjct: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120

Query: 145 ------------VFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRR 192
                        ++   V+PWQ  L +STP FTL EG FTILAIQAIGET +WL     
Sbjct: 121 ASSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEIN 180

Query: 193 SNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NG 251
           SN WV               +Y YRIYVTP+W+LS  +ASLLGFT S+V G+G+YGI   
Sbjct: 181 SNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTD 240

Query: 252 SGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLLE---- 307
            GSV+ESS+FFAY+VR +YEISPK+A  A +EI ++ KE W+ HQANL   +NLL     
Sbjct: 241 KGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHN 300

Query: 308 LMTKNYRAIWSQIVEHTPRNHKYIKMM--DQCKWILNPLWNSVKNFTKSVPISIQEIFVV 365
           ++ KN   IW         ++ +I     ++   I  P+W  +K FT +VP SI E+  V
Sbjct: 301 VVLKNIETIWESF---KINDNSFITSFSTERVITIFMPIWKLLKTFTITVPSSINELCFV 357

Query: 366 TFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQ-RNTKERRSFRRIMNFVYWYSPCII 424
           T+KMA ES+ PAV++NL FR+LIFYSATRIIP LQ R+  E R  RRIM  +YWYSPCI+
Sbjct: 358 TYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCIL 417

Query: 425 IAMYTHLILRYSGQLKNDLCIWGC----FPYETEPKIVVDSWSFWNWCNIYSTMLIYALE 480
           IAMY HLIL+YSG+LK++LC+WGC    FP + +PKI+VDSW FWNWCNI+ T+L+YA E
Sbjct: 418 IAMYAHLILQYSGELKDELCLWGCNSKIFPSD-QPKIIVDSWGFWNWCNIFFTILVYASE 476

Query: 481 LMGS 484
           L+G+
Sbjct: 477 LIGT 480

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  423 bits (1088), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 240/487 (49%), Positives = 304/487 (62%), Gaps = 51/487 (10%)

Query: 47  VLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSA 106
           V+Q++R+ L   YL  +LITIPISF+VGGL CGLSFTVTLF LYF+STT  L +    S 
Sbjct: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63

Query: 107 L----STLIYYLQHLLIPSILFMFLSYFEN------IDS---------DTVDSEYFKVFW 147
                +  IYY QH +I S+L++FLS F N      ++S         + + S  F    
Sbjct: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHS 123

Query: 148 N---------VMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRSNQWVX 198
           N          +V+PWQ  L HST  F+L EG FTILAIQA+GE+ RWL     SN W  
Sbjct: 124 NWILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNI 183

Query: 199 XXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGSGSVME 257
                         +Y YRIYVTP+WELS  +ASLLGFT S+VCG+GLYGI + +GSV+E
Sbjct: 184 TSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIE 243

Query: 258 SSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----ELMTKNY 313
           SSLFFAY+VR +YEISPK+A  A DEI +I KE W+ HQ N    +NLL    +++  + 
Sbjct: 244 SSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSA 303

Query: 314 RAIWSQIVEHT-----PRNHKYI-----KMMDQCKWILNPLWNSVKNFTKSVPISIQEIF 363
             +W  IV  T     P  H  +     K  D    I  P+    KNFT SVP SI+ +F
Sbjct: 304 EMMWESIVSKTVTTSDPFYHTSMFPPLRKFTD----IFKPVGIFFKNFTISVPSSIEGLF 359

Query: 364 VVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQ-RNTKERRSFRRIMNFVYWYSPC 422
            VT KMA +S+ PA+V+NL FR+LIFYSAT+IIP LQ +  ++    RRIMN +YWYSPC
Sbjct: 360 QVTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPC 419

Query: 423 IIIAMYTHLILRYSGQLKNDLCIWGCFPY---ETEPKIVVDSWSFWNWCNIYSTMLIYAL 479
           I+IAMYTHLIL+YSG+L  DLC+WGC        + KIVVDSW FWNWCNI+ T+L+Y  
Sbjct: 420 ILIAMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGS 479

Query: 480 ELMGSNK 486
           EL+G  K
Sbjct: 480 ELIGGKK 486

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  405 bits (1042), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 221/492 (44%), Positives = 304/492 (61%), Gaps = 47/492 (9%)

Query: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99
           M  + K++++++++ L   YL  ++ TIPISF++GGL CGL+FTVTLF LYF STT  ++
Sbjct: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNII 60

Query: 100 LLDRGSALSTLI----YYLQHLLIPSILFMFLSYFENID---------------SDTVDS 140
               GS  + +I    +Y Q+ +IPS+L +FL+ F N D                D +  
Sbjct: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120

Query: 141 E---------YFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSR 191
           +          F  +++  VKPWQ+ L +STPVFTLLEG FTIL IQ IGE   WLK  R
Sbjct: 121 DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER 180

Query: 192 RSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-N 250
            SN W+               +Y YRIY TP+W LS  +A+LLGFT S+V  +G+YGI +
Sbjct: 181 NSNIWIISSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS 240

Query: 251 GSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLLELMT 310
            +GSV+ESSLFFAY+VR +YEI+P++A  A +E  + +KE W+ H ANL   D  +    
Sbjct: 241 HNGSVIESSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADGFISYFY 300

Query: 311 KNY----RAIWSQIVEHTPRN---HKYIKMMDQCKWIL-----NPLWNSVKNFTKSVPIS 358
            ++       W+     TP     H Y   MD    ++      P+W ++K  T SVP S
Sbjct: 301 DSFHMQAHKFWTLFTSRTPYYGYLHNY--CMDYPSLVMIRSNFYPIWETLKTLTFSVPTS 358

Query: 359 IQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTK-ERRSFRRIMNFVY 417
           I E+F +T +MA +S+ PA++INL FRL+IFYSATRIIP +Q+ T+ E R  R IM  +Y
Sbjct: 359 ISELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALY 418

Query: 418 WYSPCIIIAMYTHLILRYSGQLKNDLCIWGCFPY---ETEPKIVVDSWSFWNWCNIYSTM 474
           WYSPCI+IAMYTHLIL+YSG+LK DLC+WGC      E + +I VD+WSFWNWCNI+ T+
Sbjct: 419 WYSPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTI 478

Query: 475 LIYALELMGSNK 486
           +IY  EL+G  K
Sbjct: 479 IIYGSELIGGKK 490

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  354 bits (909), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/551 (38%), Positives = 306/551 (55%), Gaps = 93/551 (16%)

Query: 23  LEPSTIARHCAKFNVSKMPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSF 82
           ++ + + R  ++       LI + V+ +    L   YL  +++TIPISF++GG+ CGLSF
Sbjct: 31  MQETVVVRQPSRRKYILQNLIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSF 90

Query: 83  TVTLFALYFVSTTFKLVL--LDRGSALSTL---IYYLQHLLIPS---------------- 121
           T TLF LYF+ST+  ++   L   + L  L   ++Y+Q+ +I S                
Sbjct: 91  TGTLFGLYFISTSVTIITKRLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLIT 150

Query: 122 ---------------------ILFMFLSYFENI--------------------------- 133
                                ILF+   YF NI                           
Sbjct: 151 ALTFLDDYYYNEKNGTNTKYQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSV 210

Query: 134 -DSDTVDS-EYFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSR 191
            D   ++S   F  ++ + +KPW+  LI+STP FTLLEG FTIL IQ IGET  WLK  +
Sbjct: 211 PDPQKLNSWILFFYYYYIFIKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQK 270

Query: 192 RSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-N 250
            S+ WV               +Y  RIYVTP W+L+  +AS+LGFT SIV G+G++GI +
Sbjct: 271 HSSFWVILSLLSSGGVITATLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVS 330

Query: 251 GSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLLELMT 310
            +GS +ESSLFFAY+VR +YE+SP++A++A DE  +   E W+++Q  +   DN+L    
Sbjct: 331 KNGSAIESSLFFAYIVRCIYEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCK 390

Query: 311 KNYRAIWSQI--VEHTPRNH---KYIKMMDQCKWILNPLWNSVKNFTKSVPISIQEIFVV 365
           K     +S    +EH    H   K I++      I+   W  +KNFT +VP SI ++  +
Sbjct: 391 KYIMDAFSSFSSIEH----HLFPKTIELGISKNLIVKQFWVFLKNFTINVPSSINDLIQI 446

Query: 366 TFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTK-ERRSFRRIMNFVYWYSPCII 424
           T +MA +S+ PA++INL FRL+IFYSATRIIP +QR TK +       M+ VYW+SPC++
Sbjct: 447 TAQMAVDSISPAIIINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCML 506

Query: 425 IAMYTHLILRYSGQLKNDLCIWGCFPYET-----------EPKIVVDSWSFWNWCNIYST 473
           IAMYTHLIL++SG+LK ++C+W C  + +           +  I+VDSWSFWNWCNI+ T
Sbjct: 507 IAMYTHLILQFSGELKKNICLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWT 566

Query: 474 MLIYALELMGS 484
           ++IYA EL+G 
Sbjct: 567 IIIYASELIGG 577

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  351 bits (901), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 206/496 (41%), Positives = 295/496 (59%), Gaps = 52/496 (10%)

Query: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99
           M  + K++ ++ R F   +YL  VL+T+PI+FQ+GGL CGL+FT+TLF+ YF++TT   +
Sbjct: 1   MSQVLKNLGESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAI 60

Query: 100 LL----DRGSALSTLIYYLQHLLIPSILFMFLSYFENID--------------------- 134
                  R  A +  +YY Q+  I  IL +FLS F + +                     
Sbjct: 61  ARKLRWQRFIAWTNFLYYFQNFNIIGILHIFLSLFSHTELSISMSDENPSMETITSILKN 120

Query: 135 SDTVDSE----YFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMS 190
           +DT  S+     +K F+   +  W+  L +STP+F L+EG FTILAIQ IGET  WL   
Sbjct: 121 NDTYPSKTISFIYKYFFYYAMPRWKFCLSYSTPLFALVEGFFTILAIQVIGETNIWLTTV 180

Query: 191 RRSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI- 249
           + S+ W+               +Y Y+IYVTP+W LS   ASLL FTFS+V G+ +YGI 
Sbjct: 181 KNSSIWIILSLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVGGVAIYGIV 240

Query: 250 NGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL--- 306
           +  GSV+ESSLFFAY+V  +YEISP MA  AMD+IFD +KE+W+IHQ N    DNLL   
Sbjct: 241 SHRGSVVESSLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFISDNLLIYY 300

Query: 307 --ELMTKNYRAIWSQIVEHTPRN---HKYIKMMDQCKWILNPLWNSV----KNFTKSVPI 357
              L+      I  +I++ T ++   +K+  ++ QC  I    +  +    K FT  +P 
Sbjct: 301 YNSLIKNVDEFIKLKIIKLTTKDNFSNKFNSLLFQCVKISKKSFKFILKLSKRFTLGIPS 360

Query: 358 SIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQ-------RNTKERRSFR 410
           SI E++ +T KMA ES+ P +++NL +R+LIFY+ATRIIP L+        N  + +S  
Sbjct: 361 SIYELYSITLKMASESISPVILVNLCYRVLIFYAATRIIPALESRSNGFSNNNIKTKSNS 420

Query: 411 RIMNFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGCFPYETEPKIVVDSWSFWNWCNI 470
           + M  +YWYSPCI+IAMYT+LIL+YSG+LK++  +W         ++VVDSW FWNWCNI
Sbjct: 421 KFMKVLYWYSPCILIAMYTNLILQYSGELKSEFKLW---NNSNNNEVVVDSWRFWNWCNI 477

Query: 471 YSTMLIYALELMGSNK 486
           + T+ +Y  EL+G  K
Sbjct: 478 FWTITLYGSELIGGRK 493

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  339 bits (870), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 207/535 (38%), Positives = 302/535 (56%), Gaps = 91/535 (17%)

Query: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99
           MP + KSV Q++R+     YL  VLITIP +F++GGL CGLSFT+TLF LYF+STT  L+
Sbjct: 1   MPWVVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLI 60

Query: 100 ----LLDRGSALSTLIYYLQHLLIPSILFMFLSYFEN---------------------ID 134
               L +    LSTL+YYLQH++I S+L++F++ F +                     I 
Sbjct: 61  AKRTLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIK 120

Query: 135 SDTVDS-------EYFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWL 187
           +DT  S         F  ++   V+PW   L HSTP FTLLEG FTIL IQAIGET  WL
Sbjct: 121 NDTSKSVSQNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWL 180

Query: 188 KMSRRSNQWVXXXXXXXXXXXXXXXFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLY 247
            + ++   +                 + Y+IY   +WELS  +ASLLG T S+V  +G++
Sbjct: 181 LLKKQKKIFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIF 240

Query: 248 GI-NGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL 306
           GI + +GS++ESSLF  Y++R  YEISP+++ +A  EI D +KE W+ HQ ++   +++L
Sbjct: 241 GIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHIL 300

Query: 307 ----ELMTKN------YRAIWSQIVEHTPRNHKYIKMMDQC------------------- 337
                ++ KN      + + +S+  + + +N    ++                       
Sbjct: 301 FYYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIG 360

Query: 338 ------KWIL--NPLWNSVKNFTKSVPISIQEIFVVTFKMAKESLIPAVVINLVFRLLIF 389
                  W++   P++  +K+F  ++P S+  +  VT+K+A +S+ P++VINL FR+LIF
Sbjct: 361 FKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIF 420

Query: 390 YSATRIIPTLQR-NTKERRSFRRIMNFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGC 448
           YSATRIIP +QR N  E +  R  +   Y +SPCI+IAMYT+LIL+YSG+LKNDLCIWGC
Sbjct: 421 YSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGC 480

Query: 449 ------------------FPYETEP--KIVVDSWSFWNWCNIYSTMLIYALELMG 483
                                +T P  + +V+SW FWNWCNI+ T+ IY  ELMG
Sbjct: 481 DIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535

>Kpol_526.19 s526 complement(52696..53412) [717 bp, 238 aa] {ON}
           complement(52696..53412) [717 nt, 239 aa]
          Length = 238

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 276 MAMNAMDEIFDIVKETWKIHQANLPKKDNL-LELMTKNYRAIWSQIVEHTPRNHKYIKMM 334
           +A    DE   I+K+   +++    K   L + L T NY A+W +    TP NHKY+   
Sbjct: 71  VAFGESDEYSFILKKDTTLYRRRSEKLSTLFVSLFTSNYVALWPKFFPDTPLNHKYLPFF 130

Query: 335 D 335
           D
Sbjct: 131 D 131

>KNAG0G02800 Chr7 complement(619337..621826) [2490 bp, 829 aa] {ON}
           Anc_8.718 YOR270C
          Length = 829

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 65  ITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSAL 107
           +TI ISF V GL  G+  TV LFA++FV T   LV+++  SA+
Sbjct: 749 MTIQISFGVPGL-LGVCMTVGLFAMWFVLTCCILVVMEGTSAM 790

>SAKL0A07194g Chr1 (638606..640756) [2151 bp, 716 aa] {ON} similar
           to uniprot|P38315 Saccharomyces cerevisiae YBR216C YBP1
           and to uniprot|P53169 Saccharomyces cerevisiae YGL060W
           YBP2
          Length = 716

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 47/88 (53%), Gaps = 10/88 (11%)

Query: 258 SSLFFAYMVRNVYEISPKMAMNAMDEIFDI-VKETWKIHQANLPKKDNLLELMTKNYRAI 316
           S + F Y     Y+++    +N  +E   + +KE+ +I+Q+ LP  +   +++    ++ 
Sbjct: 361 SGILFRY-----YQLAISFDINIKEEFIRLCIKESRRIYQS-LPMDE---KIVNDEAKSA 411

Query: 317 WSQIVEHTPRNHKYIKMMDQCKWILNPL 344
            SQ+V H  RN++  KM ++    L+PL
Sbjct: 412 ISQVVYHLSRNYELQKMANEKDLPLDPL 439

>Suva_12.55 Chr12 (74974..76173) [1200 bp, 399 aa] {ON} YJL026W
           (REAL)
          Length = 399

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 53/118 (44%), Gaps = 12/118 (10%)

Query: 271 EISPKMAMNAM------DEIFDIVKETWKIHQANLPKKDNLLELMTKNYRAIWSQIVEHT 324
           E   K A NA+      D   ++ K+   + + N  K D L E  +K+     + +  H 
Sbjct: 4   ETPSKAAANALSDLEIKDSKSNLNKDLETLREENKQKVDVLKEKFSKDAENHKAYLKSHE 63

Query: 325 PRNHKYIKMMDQCKWILNPLWNSVKNFTKSVPISIQEIFVVTFKMAKESLIPAVVINL 382
              HK +K M++ +    PL N  KN T   PI   EI+  ++K A+ S   A  I+L
Sbjct: 64  VHRHK-LKEMEKDE----PLLNEDKNRTVLFPIQYHEIW-QSYKRAEASFWTAEEIDL 115

>SAKL0H05544g Chr8 (497300..499765) [2466 bp, 821 aa] {ON} similar
           to uniprot|P32563 Saccharomyces cerevisiae YOR270C VPH1
           Subunit of vacuolar-ATPase V0 domain one of two isoforms
           (Vph1p and Stv1p) Vph1p is located in V- ATPase
           complexes of the vacuole while Stv1p is located in
           V-ATPase complexes of the Golgi and endosomes
          Length = 821

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 65  ITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSAL 107
           +TI ISF + G+  G+  TV LFA++FV T   LV+++  SA+
Sbjct: 743 MTIEISFGMSGV-VGVIMTVILFAMWFVLTCAVLVVMEGTSAM 784

>KLLA0C07491g Chr3 (653352..655841) [2490 bp, 829 aa] {ON} similar
           to uniprot|P32563 Saccharomyces cerevisiae YOR270C VPH1
           Subunit of vacuolar-ATPase V0 domain one of two isoforms
           (Vph1p and Stv1p) Vph1p is located in V- ATPase
           complexes of the vacuole while Stv1p is located in
           V-ATPase complexes of the Golgi and endosomes
          Length = 829

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 65  ITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSAL 107
           +TI I+F + G   G+  TV LFA++FV T   LV+++  SA+
Sbjct: 749 MTIEIAFGMSGF-VGVVMTVALFAMWFVLTCVILVVMEGTSAM 790

>KAFR0A04090 Chr1 complement(821972..824524) [2553 bp, 850 aa] {ON}
           Anc_8.718 YOR270C
          Length = 850

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 65  ITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGSAL 107
           +TI I+F   G+  G+  TV LFA++FV T   LVL++  SA+
Sbjct: 764 MTIQIAFSFTGVG-GVLITVVLFAMWFVLTCAVLVLMEGTSAM 805

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.139    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,043,343
Number of extensions: 1942337
Number of successful extensions: 7062
Number of sequences better than 10.0: 46
Number of HSP's gapped: 7090
Number of HSP's successfully gapped: 52
Length of query: 486
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 372
Effective length of database: 40,409,475
Effective search space: 15032324700
Effective search space used: 15032324700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)