Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E04709g3.486ON1661667411e-101
Kwal_55.212153.486ON1421382417e-26
KLTH0F14696g3.486ON2191472432e-25
SAKL0F02904g3.486ON2221552321e-23
KAFR0C019203.486ON2231302208e-22
YGR126W3.486ON2301491981e-18
Skud_7.4373.486ON2301551963e-18
Smik_6.2223.486ON2301491945e-18
CAGL0I10604g3.486ON2111361919e-18
Suva_7.4143.486ON2301461921e-17
TDEL0D055403.486ON2161491859e-17
NDAI0G009803.486ON2341451744e-15
NCAS0E008503.486ON2301391683e-14
KNAG0B008503.486ON2251411674e-14
KLLA0E03829g3.503ON609691301e-08
KNAG0B007303.503ON6221201255e-08
AFR322C3.503ON592841231e-07
Skud_16.4503.503ON622971194e-07
Suva_16.4843.503ON622981185e-07
Kpol_1017.103.486ON234761165e-07
CAGL0I10384g3.503ON630911186e-07
YPR156C (TPO3)3.503ON622981177e-07
KAFR0C020303.503ON624951177e-07
Smik_16.4083.503ON622971169e-07
TPHA0D033103.503ON613611151e-06
Kpol_1017.33.503ON621961123e-06
TBLA0D029003.503ON691421098e-06
TDEL0D057103.503ON616951062e-05
TPHA0D032503.486ON2191461043e-05
Skud_7.4483.503ON6111091053e-05
SAKL0F02442g3.503ON610611043e-05
NDAI0I027703.503ON626981001e-04
Kwal_47.189193.503ON640701001e-04
Smik_6.2333.503ON61460991e-04
KLTH0G02266g3.503ON64471992e-04
Suva_7.4253.503ON61357973e-04
YGR138C (TPO2)3.503ON61457973e-04
NCAS0E007503.503ON62057964e-04
NCAS0F036203.503ON63443880.005
ZYRO0G19646g3.503ON59429740.26
TBLA0A08515singletonON63277628.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E04709g
         (166 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...   290   e-101
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...    97   7e-26
KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...    98   2e-25
SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...    94   1e-23
KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...    89   8e-22
YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...    81   1e-18
Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...    80   3e-18
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...    79   5e-18
CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...    78   9e-18
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...    79   1e-17
TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....    76   9e-17
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...    72   4e-15
NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...    69   3e-14
KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...    69   4e-14
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    55   1e-08
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    53   5e-08
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    52   1e-07
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    50   4e-07
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    50   5e-07
Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...    49   5e-07
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    50   6e-07
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    50   7e-07
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    50   7e-07
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    49   9e-07
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    49   1e-06
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    48   3e-06
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    47   8e-06
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    45   2e-05
TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...    45   3e-05
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    45   3e-05
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    45   3e-05
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     43   1e-04
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    43   1e-04
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    43   1e-04
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    43   2e-04
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    42   3e-04
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    42   3e-04
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               42   4e-04
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    39   0.005
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    33   0.26 
TBLA0A08515 Chr1 (2098421..2100319) [1899 bp, 632 aa] {ON} possi...    28   8.8  

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score =  290 bits (741), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 143/166 (86%)

Query: 1   MVISKERSIPTITKTKXXXXXXXXLVQKQSSPLSKISTTQEVEDYVKDNVQKGETDSIDS 60
           MVISKERSIPTITKTK        LVQKQSSPLSKISTTQEVEDYVKDNVQKGETDSIDS
Sbjct: 1   MVISKERSIPTITKTKHSHHSMSSLVQKQSSPLSKISTTQEVEDYVKDNVQKGETDSIDS 60

Query: 61  LKATNLDLSKKAIPGFNQPIAEGAEFPEEYEIETRTGLVKVATLHQLNRLDTRVXXXXXX 120
           LKATNLDLSKKAIPGFNQPIAEGAEFPEEYEIETRTGLVKVATLHQLNRLDTRV      
Sbjct: 61  LKATNLDLSKKAIPGFNQPIAEGAEFPEEYEIETRTGLVKVATLHQLNRLDTRVTTHSSK 120

Query: 121 XXXXXXXXXCGYDNDKLQKCIERNQKEIDSYHKKSGFKKFIGKLFG 166
                    CGYDNDKLQKCIERNQKEIDSYHKKSGFKKFIGKLFG
Sbjct: 121 KSTKEKNTSCGYDNDKLQKCIERNQKEIDSYHKKSGFKKFIGKLFG 166

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score = 97.4 bits (241), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 79/138 (57%), Gaps = 21/138 (15%)

Query: 49  NVQKGETDSIDSLKATNLDLSKKAIPGFNQPIAE--GAEFPEEYEIETRTGLVKVATLHQ 106
           N  +G ++++DSL+   L++++KA+P +N P A     EFPEEY++ET TGLVKV TL +
Sbjct: 4   NATEGRSETVDSLQRNGLNINQKAVPDYNNPAANFTNCEFPEEYQLETDTGLVKVQTLQK 63

Query: 107 LNRLDTRVXXXXXXXXXXX----------------XXXXCGYDNDKLQKCIERNQKEIDS 150
           LNRL++R                                 G D +KL+K +E+N+++ID 
Sbjct: 64  LNRLESRTSIRSGNSQRKSMRSTPSTDHSISPSAGRSSNSGLDAEKLRKAVEKNKRQIDK 123

Query: 151 Y--HKKS-GFKKFIGKLF 165
           Y  HK S G KKF+GK+F
Sbjct: 124 YQKHKASGGLKKFLGKIF 141

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score = 98.2 bits (243), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 80/147 (54%), Gaps = 20/147 (13%)

Query: 39  TQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPIA--EGAEFPEEYEIETRT 96
           +  +E  +  N  +G +++++SLK   L+L KKAIP  N P A  +   FPEEY++ET T
Sbjct: 72  SNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDT 131

Query: 97  GLVKVATLHQLNRLDTRVXXXXXXXX---------------XXXXXXXCGYDNDKLQKCI 141
           GLVK  TLH LNRL++R                                G D +KL++ +
Sbjct: 132 GLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASANNTINGLDGEKLRRAV 191

Query: 142 ERNQKEIDSY--HKKS-GFKKFIGKLF 165
           E+NQK+ID Y  HK S G ++F+GK+F
Sbjct: 192 EKNQKKIDKYQKHKSSGGLRRFLGKIF 218

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score = 94.0 bits (232), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 89/155 (57%), Gaps = 14/155 (9%)

Query: 25  LVQKQSSPLSKISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPI--AE 82
           L  + S+ L K+ +   +E  +  N  +G T++++SLK   LDL KKAIP +N P    +
Sbjct: 69  LSVRSSNTLKKLDSNA-IEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTD 127

Query: 83  GAEFPEEYEIETRTGLVKVATLHQLNRLDTRVX--------XXXXXXXXXXXXXXCGYDN 134
            ++FPEEY+IET TGLVKV TL  LNRLDTRV                        GYD 
Sbjct: 128 RSQFPEEYQIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDEQRPVGYDE 187

Query: 135 DKLQKCIERNQKEIDSYHK---KSGFKKFIGKLFG 166
           +KL+K +++N+K+I+ Y K   + G K F+ +LFG
Sbjct: 188 EKLKKAVDKNKKKIEKYQKHKHEKGIKGFMSRLFG 222

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score = 89.4 bits (220), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 75/130 (57%), Gaps = 3/130 (2%)

Query: 39  TQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPIAEGAEFPEEYEIETRTGL 98
           ++++E  V  N   G+ +++DSL+AT LDL+K+A+P  N PI+  ++  +E + ET TGL
Sbjct: 93  SRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPISHESKLIDESKFETDTGL 152

Query: 99  VKVATLHQLNRLDTRVXXXXXXXXXXXXXXXCGYDNDKLQKCIERNQKEIDSY--HKKS- 155
           +K  TL  LNR +TR                 G D +++   +ERN+K+++ Y  HKK  
Sbjct: 153 IKTKTLETLNRSNTRNSSSKRKILGNDNSNTSGLDPERMNMVVERNRKKLEKYQQHKKEK 212

Query: 156 GFKKFIGKLF 165
           G K F  K+F
Sbjct: 213 GLKGFFYKIF 222

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score = 80.9 bits (198), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 73/149 (48%), Gaps = 18/149 (12%)

Query: 35  KISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPI---AEGAEFPEEYE 91
           K  T+  +E  V  N  +G ++++DSLK   L+L+KKA+P    P+   A  A FPEEY 
Sbjct: 81  KRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYR 140

Query: 92  IETRTGLVKVATLHQLNRLDTRVXXX------------XXXXXXXXXXXXCGYDNDKLQK 139
           +ET TGLVK+ TL  L R D+RV                              + +KL  
Sbjct: 141 LETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHSTRSKVTTNSQGSSLEPNKLNM 200

Query: 140 CIERNQKEIDSYHK---KSGFKKFIGKLF 165
            +E+N+K I+ Y K   + G K F  ++F
Sbjct: 201 AVEKNKKRIEKYQKHKSEKGIKGFFHRIF 229

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score = 80.1 bits (196), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 75/155 (48%), Gaps = 18/155 (11%)

Query: 29  QSSPLSKISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPI---AEGAE 85
            SS   K  ++  +E  +  N  +G +++ DSLK   L+L+KKA+P    P+   A    
Sbjct: 75  HSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGA 134

Query: 86  FPEEYEIETRTGLVKVATLHQLNRLDTRVXXXXXXXXXXXXXXX------------CGYD 133
           FPEEY +ET TGLVK+ TL  L R D+RV                              +
Sbjct: 135 FPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLE 194

Query: 134 NDKLQKCIERNQKEIDSYHK---KSGFKKFIGKLF 165
           +DKL   +E+N+K+I+ Y K   + G K F  ++F
Sbjct: 195 SDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIF 229

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score = 79.3 bits (194), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 73/149 (48%), Gaps = 18/149 (12%)

Query: 35  KISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPI---AEGAEFPEEYE 91
           K  T+  +E  V  N  +G ++++DSLK   L+L KKA+P    P+   A  A FPEEY 
Sbjct: 81  KRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEEYR 140

Query: 92  IETRTGLVKVATLHQLNRLDTRVXXX------------XXXXXXXXXXXXCGYDNDKLQK 139
           +ET TGLVK+ TL  L R D+RV                              + +KL  
Sbjct: 141 LETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHSTRSKVTTNSQGSSLEPNKLNM 200

Query: 140 CIERNQKEIDSYHK---KSGFKKFIGKLF 165
            +E+N+K+I+ Y K   + G K F  ++F
Sbjct: 201 AVEKNKKKIEQYQKHKSEKGIKGFFHRIF 229

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score = 78.2 bits (191), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 68/136 (50%), Gaps = 12/136 (8%)

Query: 42  VEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPIAEGA--EFPEEYEIETRTGLV 99
           +E  V  N   G +++I+SLKA  LD+ +KAIP +N P+      +FPEEY +ET TGLV
Sbjct: 75  IEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLV 134

Query: 100 KVATLHQLNRLDTRVXXXXXXXXXXXXXXXCGYDND-------KLQKCIERNQKEIDSYH 152
           K+ TL  L R  T+V                  +         K+   +ERN+KEI  Y 
Sbjct: 135 KMKTLETLKRKSTQVSRNSDLSSKDKSISKSQSNKSEVSDIAQKINMAVERNKKEIAKYQ 194

Query: 153 K---KSGFKKFIGKLF 165
           K   + G K F  ++F
Sbjct: 195 KHKSEKGIKGFFHRMF 210

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score = 78.6 bits (192), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 70/146 (47%), Gaps = 16/146 (10%)

Query: 35  KISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPI---AEGAEFPEEYE 91
           K  T+  +E  V  N  +G ++++DSLK   L+L+KK  P    P+   A  A FPEEY 
Sbjct: 81  KRPTSNSIEKMVTHNALEGNSETVDSLKKEGLNLNKKGTPDITAPVTNSAHDAAFPEEYR 140

Query: 92  IETRTGLVKVATLHQLNRLDTRVX------------XXXXXXXXXXXXXXCGYDNDKLQK 139
           +ET TGLVK+ TL  L R D+RV                              ++DKL  
Sbjct: 141 LETETGLVKLKTLETLKREDSRVSGAKKDHGHDHTDAHSTRSKATAYSQGSSLESDKLNI 200

Query: 140 CIERNQKEIDSYHKKSGFKKFIGKLF 165
            +E+N+K I+ Y K  G K   G LF
Sbjct: 201 AVEKNKKRIEKYQKHKGEKGIKG-LF 225

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score = 75.9 bits (185), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 72/149 (48%), Gaps = 25/149 (16%)

Query: 42  VEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPI---AEGAEFPEEYEIETRTGL 98
           +E  V  N   G +++  SL+   LD  KKAIP  N PI   A+ ++FPEEY IET+TGL
Sbjct: 67  IEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGL 126

Query: 99  VKVATLHQLNRLDTRVXXXXXXXXXXXXXXXCGYDN-------------------DKLQK 139
           VK+ TL+ L+R DTRV                  D+                   + L+ 
Sbjct: 127 VKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDTAKAEQEAAQNAENLEH 186

Query: 140 CIERNQKEIDSYHK---KSGFKKFIGKLF 165
            IE+N+  I+ + K   + G K F+ +LF
Sbjct: 187 AIEKNKHRIEKFEKHRHEKGLKGFVHRLF 215

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score = 71.6 bits (174), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 68/145 (46%), Gaps = 16/145 (11%)

Query: 37  STTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPIAEG-AEFPEEYEIETR 95
           S   ++E  +  N+   +T+++DSL    L+  KK++   N P+  G AEFPEEY IET 
Sbjct: 89  SNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPLNAGTAEFPEEYRIETE 148

Query: 96  TGLVKVATLHQLNRLDTRVXX------------XXXXXXXXXXXXXCGYDNDKLQKCIER 143
           TGLVK  T+  L R ++                                D +KL   +E+
Sbjct: 149 TGLVKAKTIESLRRQESIASANSRRSQDQGSFKSARTNNTRKSRASSSLDPNKLNMAVEK 208

Query: 144 NQKEIDSYHK---KSGFKKFIGKLF 165
           N+KE++ Y K   + G K F  +LF
Sbjct: 209 NKKELEKYSKHKQQKGIKGFFNRLF 233

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score = 69.3 bits (168), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 65/139 (46%), Gaps = 15/139 (10%)

Query: 42  VEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPIAEG---AEFPEEYEIETRTGL 98
           +E  +  N ++G T+++ SL A  LDL+KKA    N P+        FPEEY +ET TGL
Sbjct: 91  IERVITSNAKEGNTETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGL 150

Query: 99  VKVATLHQLNRLDTRVXXXX---------XXXXXXXXXXXCGYDNDKLQKCIERNQKE-- 147
           VK  T+  L R  +RV                             +KL   +E+N+KE  
Sbjct: 151 VKAKTIETLRRETSRVSSTRRGDDVVSHKSQATGKSQRSAQSLQAEKLNLAVEKNKKELE 210

Query: 148 -IDSYHKKSGFKKFIGKLF 165
            I+ +  + G K F+ +LF
Sbjct: 211 KIEKHKHQKGLKGFMNRLF 229

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score = 68.9 bits (167), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 67/141 (47%), Gaps = 17/141 (12%)

Query: 42  VEDYVKDNVQKGETDSIDSLKATNLDLSKK-AIPGFNQPIA-EGAEFPEEYEIETRTGLV 99
           +E  V  N    +++S D+L++  LD +K+  IP  N P+    + FPEEY++ET TGLV
Sbjct: 84  IERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLV 143

Query: 100 KVATLHQLNRLDT------------RVXXXXXXXXXXXXXXXCGYDNDKLQKCIERNQKE 147
           K+ T+  L    +                              G + +KL   +ERN+KE
Sbjct: 144 KMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSSMEEHGEAGLNAEKLNSAVERNRKE 203

Query: 148 IDSYHK---KSGFKKFIGKLF 165
           ++ Y K   K G K F+ K+F
Sbjct: 204 LERYEKNRGKKGIKGFLSKMF 224

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 42/69 (60%), Gaps = 4/69 (5%)

Query: 49  NVQKGETDSIDSLKATNLDLSKKAIPGFNQP---IAEGAEFPEEYEIETRTGLVKVATLH 105
           N++   T++  SL+   L  S+  IP FN P   +A+ A FPEEY +ET TGLV VATLH
Sbjct: 42  NLKLVPTETAKSLQDMGLT-SEVPIPDFNAPTTSVAKNAIFPEEYTLETATGLVPVATLH 100

Query: 106 QLNRLDTRV 114
            L R  T +
Sbjct: 101 SLGRTPTAI 109

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 52.8 bits (125), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 37/120 (30%), Positives = 55/120 (45%), Gaps = 12/120 (10%)

Query: 27  QKQSSPLSKISTTQEVEDYVKDNVQKG-------ETDSIDSLKATNLDLSKKA-IPGFNQ 78
           Q+ SS    +   Q+ + YV +    G        T+++ SL+  ++ ++K A IP  N 
Sbjct: 16  QETSSSAGSLRDAQQPQQYVPETKGDGTNKLKLVRTETVKSLQ--DMGMTKNAPIPDVNA 73

Query: 79  P--IAEGAEFPEEYEIETRTGLVKVATLHQLNRLDTRVXXXXXXXXXXXXXXXCGYDNDK 136
           P    + A FPEEY +ET TGLV VATL  + R  T +                 + NDK
Sbjct: 74  PQTAKKTAIFPEEYTMETPTGLVPVATLQSIGRTATSISRTRTRQMDRSISMRSSHSNDK 133

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 47/84 (55%), Gaps = 2/84 (2%)

Query: 32  PLSKISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQP-IAEGAEFPEEY 90
           P S +   Q+ +     +++   T+++ SL+   L  S+K IP  N P  + G  FPEEY
Sbjct: 22  PQSYVPQAQQQDGRGGGSLRLVPTETVKSLQEMGLS-SEKPIPDVNAPSTSAGVIFPEEY 80

Query: 91  EIETRTGLVKVATLHQLNRLDTRV 114
            +ET TGLVK+ATL  L R  + V
Sbjct: 81  TLETPTGLVKIATLVSLGRTGSAV 104

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 50.4 bits (119), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 12/97 (12%)

Query: 29  QSSPLSKISTTQEVEDYVKDNVQKG----------ETDSIDSLKATNLDLSKKAIPGFNQ 78
           ++S LS + + Q  +    +N  K            T+++ SL+   +  SK  IP  N 
Sbjct: 14  ETSSLSDVESQQPQQYIPSENGSKSNMAPNQLKLTRTETVKSLQDMGVS-SKAPIPDVNA 72

Query: 79  PIAEGAE-FPEEYEIETRTGLVKVATLHQLNRLDTRV 114
           P +   + FPEEY +ET TGLV VATLH + R  T +
Sbjct: 73  PQSSKNKIFPEEYTLETPTGLVPVATLHSIGRTSTAI 109

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 50.1 bits (118), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 33/98 (33%), Positives = 53/98 (54%), Gaps = 14/98 (14%)

Query: 29  QSSPLSKISTTQEVEDYV------KDNVQKGE-----TDSIDSLKATNLDLSKKAIPGFN 77
           ++S LS + + Q+ + Y+      K N+   +     T+++ SL+   +  S+  +P  N
Sbjct: 14  ETSSLSNVES-QQPQQYIPSERGSKSNMSPNQLKLTRTETVKSLQDMGVS-SRAPVPDVN 71

Query: 78  QPIAEGAE-FPEEYEIETRTGLVKVATLHQLNRLDTRV 114
            P +   + FPEEY IET TGLV VATLH + R  T +
Sbjct: 72  APQSSKNKIFPEEYTIETPTGLVPVATLHSIGRTSTAI 109

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score = 49.3 bits (116), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 45/76 (59%), Gaps = 5/76 (6%)

Query: 35  KISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFN---QPIAEGAEFPEEYE 91
           K++++ E+E  V  N  +  T+++ +L+ T   LSK  +P  N     +   A FPEEY 
Sbjct: 64  KVNSSNEIEKIVTRNALENNTETVATLRETESKLSK--VPTENVLPATMENNAAFPEEYR 121

Query: 92  IETRTGLVKVATLHQL 107
           IET+TGLV + TL ++
Sbjct: 122 IETKTGLVPIKTLEEM 137

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 31/91 (34%), Positives = 46/91 (50%), Gaps = 5/91 (5%)

Query: 26  VQKQSSPLSKISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQP--IAEG 83
           ++ Q  P   I + ++  D  K+ +    T+++ SL+   +      IP  N P    + 
Sbjct: 24  IESQQQPRQYIPSNEK--DGNKERLHLTRTETVKSLQEMGMT-QDAPIPDVNAPQTTTKN 80

Query: 84  AEFPEEYEIETRTGLVKVATLHQLNRLDTRV 114
           A FPEEY +ET TGLV VATL  L R  T +
Sbjct: 81  AIFPEEYTMETPTGLVPVATLQSLGRTSTAI 111

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 49.7 bits (117), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 33/98 (33%), Positives = 53/98 (54%), Gaps = 14/98 (14%)

Query: 29  QSSPLSKISTTQEVEDYV------KDNVQKGE-----TDSIDSLKATNLDLSKKAIPGFN 77
           ++S LS + + Q+ + Y+      K N+   +     T+++ SL+   +  SK  +P  N
Sbjct: 14  ETSSLSDVES-QQPQQYIPSESGSKSNMAPNQLKLTRTETVKSLQDMGVS-SKAPVPDVN 71

Query: 78  QPIAEGAE-FPEEYEIETRTGLVKVATLHQLNRLDTRV 114
            P +   + FPEEY +ET TGLV VATLH + R  T +
Sbjct: 72  APQSSKNKIFPEEYTLETPTGLVPVATLHSIGRTSTAI 109

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 49.7 bits (117), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 6/95 (6%)

Query: 25  LVQKQSSPLSKISTTQEVEDYVKDN----VQKGETDSIDSLKATNLDLSKKAIPGFNQPI 80
           +V+ Q  P   + +     + + ++    ++   T+++ SL+   ++ +  A+P  N P 
Sbjct: 18  VVEDQQQPQQYVPSISNSHNSINNDERTRLKLIRTETVKSLQDMGMN-ATPAVPDVNAPQ 76

Query: 81  A-EGAEFPEEYEIETRTGLVKVATLHQLNRLDTRV 114
           +   A FPEEY IET TGLV VATL  L R  T +
Sbjct: 77  SNRNAIFPEEYTIETTTGLVPVATLQSLGRTSTAI 111

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 49/97 (50%), Gaps = 12/97 (12%)

Query: 29  QSSPLSKISTTQEVEDYVKDNVQKG----------ETDSIDSLKATNLDLSKKAIPGFNQ 78
           ++S LS + + Q  +    +N  K            T+++ SL+   +  SK  +P  N 
Sbjct: 14  ETSSLSDVESQQPQQYIPSENGSKSNMAPNQLKLTRTETVKSLQDMGVS-SKAPVPDVNA 72

Query: 79  PIA-EGAEFPEEYEIETRTGLVKVATLHQLNRLDTRV 114
           P + +   FPEEY +ET TGLV VATLH + R  T +
Sbjct: 73  PQSGKNKIFPEEYTLETPTGLVPVATLHSIGRTSTAI 109

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/61 (45%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 55  TDSIDSLKATNLDLSKKAIPGFNQPIA-EGAEFPEEYEIETRTGLVKVATLHQLNRLDTR 113
           T+++ SL+   L  S   IP  N P + + + FPEEY +ET TGLV VATLH L R  T 
Sbjct: 45  TETVKSLQDMGLT-SDAPIPDVNAPTSNKHSIFPEEYTMETPTGLVPVATLHSLGRNSTT 103

Query: 114 V 114
           +
Sbjct: 104 I 104

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 45/96 (46%), Gaps = 7/96 (7%)

Query: 55  TDSIDSLKATNLDLSKKAIPGFNQPIAEGAE-FPEEYEIETRTGLVKVATLHQLNRLD-- 111
           T+++ SL+   +  S+  IPG N P     + FPEEY +ET TGLV VATL  L R    
Sbjct: 48  TETVKSLQDMGMT-SEAPIPGVNAPQTSRVQIFPEEYTMETPTGLVPVATLQSLGRSSLA 106

Query: 112 ---TRVXXXXXXXXXXXXXXXCGYDNDKLQKCIERN 144
              TR                   ++D+ QK  E++
Sbjct: 107 VTRTRTRQMDRQSQTNASISGSNSESDEYQKETEKS 142

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 74  PGFNQP-IAEGAEFPEEYEIETRTGLVKVATLHQLNRLDTRV 114
           P  N P  ++ A FPEEY +ET TGLV V+TLH L R +T +
Sbjct: 89  PAINAPKTSKKAIFPEEYTLETETGLVPVSTLHSLGRTNTNL 130

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 44/95 (46%), Gaps = 11/95 (11%)

Query: 30  SSPLSKISTTQEVEDYVKDNVQKG--------ETDSIDSLKATNLDLSKKAIPGFNQP-- 79
           S   S     Q+ ++Y+  N  K          T+++ SL+   +  +   +P  N P  
Sbjct: 12  SDSSSAFRDDQQPQEYIPSNNNKNNGLPLNLTRTETVKSLQEMGMT-ATAPVPDVNAPQT 70

Query: 80  IAEGAEFPEEYEIETRTGLVKVATLHQLNRLDTRV 114
            A    FPEEY +ET TGLV VATL  + R  T +
Sbjct: 71  TARPQIFPEEYTMETPTGLVPVATLQSIGRTSTAI 105

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 66/146 (45%), Gaps = 19/146 (13%)

Query: 38  TTQEVEDYVKDNVQKGETDSIDSLKA--TNLDLSKKAIPGFNQPIAEGAEFPEEYEIETR 95
           T+ +V   V  N+     +S ++LK   TN++ S++A       +   + FPEEY +ET 
Sbjct: 74  TSNDVHRIVSRNIMDNNVESEEALKTQLTNME-SRRADIILPASMEGNSNFPEEYTMETT 132

Query: 96  TGLVKVATLHQLNR------------LDTRVXXXXXXXXXXXXXXXCGYDNDKLQKCIER 143
           TGLV V TL  + +            L +                  G +  KL   +E+
Sbjct: 133 TGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNTVKSRNEGGLNPAKLNAAVEK 192

Query: 144 NQKEIDSY--HK--KSGFKKFIGKLF 165
           N++E++ Y  HK  K+  KK + KLF
Sbjct: 193 NKEELEKYQHHKTEKNPIKKMLFKLF 218

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 48/109 (44%), Gaps = 12/109 (11%)

Query: 3   ISKERSIPTITKTKXXXXXXXXLVQKQSSPLSKISTTQEVEDYVKDNVQKGET-DSIDSL 61
           +S + S+ +                +Q  P   IS T ++      N+ K ET  S+  L
Sbjct: 1   MSDQESVASFNSQNTSMVDAEGQQPQQYVPTKSISRTNQL------NLTKTETVKSLQDL 54

Query: 62  KATNLDLSKKAIPGFNQP-IAEGAEFPEEYEIETRTGLVKVATLHQLNR 109
             T    S   +P  N P  A+   FPEEY +ET +GLV VATL  + R
Sbjct: 55  GVT----SAAPVPDINAPKTAKNNIFPEEYTMETPSGLVPVATLQSMGR 99

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 55  TDSIDSLKATNLDLSKKAIPGFNQPI-AEGAEFPEEYEIETRTGLVKVATLHQLNRLDTR 113
           T++  SL+   +  S+  IP  N P   +   FPEEY +ET TGLV VATLH + R  + 
Sbjct: 44  TETAKSLQEMGVS-SEAPIPDINAPQNVKSPIFPEEYTMETPTGLVPVATLHSIGRTTSA 102

Query: 114 V 114
           V
Sbjct: 103 V 103

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 15/98 (15%)

Query: 30  SSPLSKISTTQEVEDYVKD----------NVQKGETDSIDSLKATNLDLSKKA-IPGFNQ 78
           S+  S I   Q+ + Y+ +           ++   T+++ +L+  +L +++ A +P  N 
Sbjct: 17  STNSSSIDEQQQPQQYIPNTTTTTTTNGAQLKLTRTETVKTLQ--DLGVTRDAPVPDVNA 74

Query: 79  P--IAEGAEFPEEYEIETRTGLVKVATLHQLNRLDTRV 114
           P   A    FPEEY +ET TGLV V+TL  L R  T +
Sbjct: 75  PQTSARNTIFPEEYTMETTTGLVPVSTLQSLGRTATSI 112

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 48  DNVQKGETDSIDSLKATNLDLSKKAIPGFNQPIAE---GAEFPEEYEIETRTGLVKVATL 104
           D ++   T+++ SL+   +   +  +P  N P A     A FPEEY +ET TGLV VATL
Sbjct: 44  DRLRLVPTETVKSLQEMGVT-PEAPLPDVNAPAAATSGKAIFPEEYTLETATGLVPVATL 102

Query: 105 HQLNRLDTRV 114
             L R  + V
Sbjct: 103 QSLGRTTSGV 112

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 54  ETDSIDSLKATNLDLSKKAIPGFNQP-IAEGAEFPEEYEIETRTGLVKVATLHQLNRLDT 112
           +T+++ SL+   +  S   +P  N P  A+   FPEEY +ET +GLV VATL  + R  T
Sbjct: 44  KTETVKSLQDLGVT-SNAPVPDINAPQTAKNNIFPEEYTMETPSGLVPVATLQSMGRTAT 102

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 6/71 (8%)

Query: 48  DNVQKGETDSIDSLKATNLDLSKKA-IPGFNQPI---AEGAEFPEEYEIETRTGLVKVAT 103
           D ++   T+++ SL+  ++ ++ +A +P  N P       A FPEEY +ET TGLV VAT
Sbjct: 50  DRLRLVPTETVKSLQ--DMGVTPEAPLPDVNAPTTGKGGAAIFPEEYTLETATGLVPVAT 107

Query: 104 LHQLNRLDTRV 114
           L  L R  + V
Sbjct: 108 LQSLGRTQSAV 118

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 54  ETDSIDSLKATNLDLSKKAIPGFNQP-IAEGAEFPEEYEIETRTGLVKVATLHQLNR 109
           +T+++ SL+   +  S   +P  N P  A+   FPEEY +ET +GLV VATL  + R
Sbjct: 44  KTETVKSLQDLGVT-SAAPVPDINAPQTAKNNIFPEEYTMETPSGLVPVATLQSMGR 99

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 54  ETDSIDSLKATNLDLSKKAIPGFNQP-IAEGAEFPEEYEIETRTGLVKVATLHQLNR 109
           +T+++ SL+   +  S   +P  N P  A+   FPEEY +ET +GLV VATL  + R
Sbjct: 44  KTETVKSLQDLGVT-SAAPVPDINAPQTAKNNIFPEEYTMETPSGLVPVATLQSMGR 99

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 55  TDSIDSLKATNLDLSKKAIPGFNQPIA--EGAEFPEEYEIETRTGLVKVATLHQLNR 109
           T+++ +L+   +  S   +P  N P +  + A FPEEY +ET TGLV VATL  + R
Sbjct: 46  TETVKTLQDLGVT-SHVPVPDINAPQSSKKNAIFPEEYTMETTTGLVPVATLQSMGR 101

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 38.5 bits (88), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 69  SKKAIPGFNQPIA--EGAEFPEEYEIETRTGLVKVATLHQLNR 109
           S+  +P  N P    + A FPEEY +ET TGLV V TL  + R
Sbjct: 63  SEAPLPDINAPQGSKKPAIFPEEYTMETPTGLVPVVTLQSIGR 105

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 33.1 bits (74), Expect = 0.26,   Method: Composition-based stats.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 86  FPEEYEIETRTGLVKVATLHQLNRLDTRV 114
           FPEEY +ET +G+V +A L  L R  T V
Sbjct: 71  FPEEYTMETPSGIVPLAQLESLGRTVTTV 99

>TBLA0A08515 Chr1 (2098421..2100319) [1899 bp, 632 aa] {ON} possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 632

 Score = 28.5 bits (62), Expect = 8.8,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 32/77 (41%), Gaps = 3/77 (3%)

Query: 28  KQSSPLSKISTTQEVEDYVKDNVQKGETD---SIDSLKATNLDLSKKAIPGFNQPIAEGA 84
           +  SP  KIS    +  YV     + ETD   SID L  +   L  K+I       +   
Sbjct: 70  QTGSPNCKISADIPISQYVLGTQSQAETDSQESIDILPPSQYRLQNKSIKSSRLEPSSSN 129

Query: 85  EFPEEYEIETRTGLVKV 101
                  I+ +TGL+KV
Sbjct: 130 SNTSVSLIDEKTGLIKV 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.130    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,738,278
Number of extensions: 510827
Number of successful extensions: 1754
Number of sequences better than 10.0: 52
Number of HSP's gapped: 1736
Number of HSP's successfully gapped: 56
Length of query: 166
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 65
Effective length of database: 41,900,133
Effective search space: 2723508645
Effective search space used: 2723508645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 61 (28.1 bits)