Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E04687g3.487ON30630616580.0
SAKL0F02882g3.487ON2983086945e-90
NCAS0E008403.487ON3363186942e-89
Ecym_12423.487ON3113176616e-85
Smik_6.2233.487ON3133216549e-84
NDAI0G009703.487ON3323346523e-83
YGR127W3.487ON3123206443e-82
CAGL0I10582g3.487ON3193246435e-82
Suva_7.4153.487ON3133216426e-82
Skud_7.4383.487ON3133216201e-78
KAFR0C019303.487ON3133196122e-77
AFR305W3.487ON3093146079e-77
Kpol_1017.93.487ON3103176042e-76
KLTH0F14718g3.487ON3003105991e-75
Kwal_55.212173.487ON3033115685e-71
KNAG0B008403.487ON3133175504e-68
TPHA0D032603.487ON3143215487e-68
TDEL0D055503.487ON3103175331e-65
TBLA0D029903.487ON3183144522e-53
ZYRO0D10098g3.487ON2762803752e-42
NDAI0A068803.124ON311683731.5
KLTH0A05016g7.271ON61984711.9
ZYRO0A04510gsingletonON42565684.9
ACL031C7.271ON61449676.0
Suva_5.1937.271ON62649667.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E04687g
         (306 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   643   0.0  
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   271   5e-90
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   271   2e-89
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   259   6e-85
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   256   9e-84
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   255   3e-83
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   252   3e-82
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   252   5e-82
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   251   6e-82
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   243   1e-78
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   240   2e-77
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   238   9e-77
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   237   2e-76
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   235   1e-75
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   223   5e-71
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   216   4e-68
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   215   7e-68
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   209   1e-65
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   178   2e-53
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   149   2e-42
NDAI0A06880 Chr1 complement(1565984..1575334) [9351 bp, 3116 aa]...    33   1.5  
KLTH0A05016g Chr1 (417016..418875) [1860 bp, 619 aa] {ON} simila...    32   1.9  
ZYRO0A04510g Chr1 complement(365695..366972) [1278 bp, 425 aa] {...    31   4.9  
ACL031C Chr3 complement(309369..311213) [1845 bp, 614 aa] {ON} S...    30   6.0  
Suva_5.193 Chr5 (294537..296417) [1881 bp, 626 aa] {ON} YER080W ...    30   7.7  

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/306 (100%), Positives = 306/306 (100%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQGYGTWLG 60
           MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQGYGTWLG
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQGYGTWLG 60

Query: 61  INRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFNG 120
           INRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFNG
Sbjct: 61  INRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFNG 120

Query: 121 QHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKMEHMVISNDIFHCAVGEHTSRW 180
           QHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKMEHMVISNDIFHCAVGEHTSRW
Sbjct: 121 QHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKMEHMVISNDIFHCAVGEHTSRW 180

Query: 181 NKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGEDVDSVTTSSIYVPPLRIT 240
           NKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGEDVDSVTTSSIYVPPLRIT
Sbjct: 181 NKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGEDVDSVTTSSIYVPPLRIT 240

Query: 241 KGADAIGTSLPIGDYYGTRSQIVILVDKDNRVTYEEHVIYESDEDCETYSFMDPKEVIQF 300
           KGADAIGTSLPIGDYYGTRSQIVILVDKDNRVTYEEHVIYESDEDCETYSFMDPKEVIQF
Sbjct: 241 KGADAIGTSLPIGDYYGTRSQIVILVDKDNRVTYEEHVIYESDEDCETYSFMDPKEVIQF 300

Query: 301 QFNMES 306
           QFNMES
Sbjct: 301 QFNMES 306

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  271 bits (694), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 144/308 (46%), Positives = 201/308 (65%), Gaps = 14/308 (4%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQGYGTWLG 60
           MCIL  T AHP Y LIL+SNRDEFFER+TH TC + D FI+SP+DM+I  KG+ +GTW G
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRNFGTWCG 60

Query: 61  INRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFNG 120
           +N+ G++AVILNL+I S  + ++V     P+SRGIVP++FL  +D   F+NWDS+EKF+ 
Sbjct: 61  VNKDGKVAVILNLRIASCGNPKNVEC---PQSRGIVPMKFLAGKD-VDFNNWDSYEKFSH 116

Query: 121 QHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKME-HMVISNDIFHCAVGEHTSR 179
            +  + +TG F LFYGD    EY +I  L  +T+ F+  + +MV+SND+          +
Sbjct: 117 HYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLI-----SSKKK 171

Query: 180 WNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGEDV--DSVTTSSIYVPPL 237
           W K      LL  L +++    K+ +L KCF+L S+ T +E   V  +SVT  +IYVPPL
Sbjct: 172 WGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVKHESVTNETIYVPPL 231

Query: 238 RITKGADAIGTSLPIGDYYGTRSQIVILVDKDN-RVTYEEHVIYESDEDCETYSFMDPKE 296
            +  G D +  S+P G YYGTRSQIVILV KD  ++T+ E V+Y  DED   Y   +PKE
Sbjct: 232 LVENGQD-LDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPKNPKE 290

Query: 297 VIQFQFNM 304
            I+F+F++
Sbjct: 291 QIEFEFDI 298

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  271 bits (694), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 205/318 (64%), Gaps = 21/318 (6%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIE---KKGQGYGT 57
           MCIL AT AHP Y+LIL+SNRDEFFERKTH +CW++D FILSP+DMA      + + +GT
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76

Query: 58  WLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEK 117
           W+GINR  +IA ILNLK++S LD + ++   +P+SRG++P  FL + D + F+ WD++EK
Sbjct: 77  WIGINRDAKIATILNLKLESQLDLKQLV---KPQSRGMIPFVFLSEHD-SDFNKWDTYEK 132

Query: 118 FNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKMEHMVISNDIFHC------ 171
           F+G++  LR+TG F  FYGD  +DEY +ID   ++        ++ +SND+F        
Sbjct: 133 FDGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGDPYLTVSNDMFATGGITVE 192

Query: 172 -AVGEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGEDV-----D 225
            A     + W K ++G +LL  L + +  + ++ L++KCF+L S  +    E+       
Sbjct: 193 RASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNS 252

Query: 226 SVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDN-RVTYEEHVIYESDE 284
           ++   +I+VPPL   +  D IGTSL +G YYGTRSQIVIL+ K++ RV   EH++Y SD 
Sbjct: 253 TLPMETIFVPPLE-CEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDN 311

Query: 285 DCETYSFMDPKEVIQFQF 302
           D + YS  +PKEV  F+F
Sbjct: 312 DIQHYSSTNPKEVKSFEF 329

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  259 bits (661), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 142/317 (44%), Positives = 191/317 (60%), Gaps = 18/317 (5%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMA-------IEKKGQ 53
           MCIL AT  HPDYKLIL+SNRDEF+ER+TH TCW+ DG IL+PYD++         K   
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 54  GYGTWLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWD 113
            YGTWLGINR G ++V+LNLK  S   +      G  +SRG V + FL+   N  +D W+
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGA---GNRKSRGNVTVAFLRDLSNGNWDKWN 117

Query: 114 SWEKFNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPF-EKMEHMVISNDIFHCA 172
           ++EKF+     L  T  FTLFYGD K+ ++ +ID  K S NPF  K  ++VISN   +C 
Sbjct: 118 NYEKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCE 177

Query: 173 VGEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGEDVDSVTTS-- 230
             +   RW K   G  LL  L K    ++KE LLQKCFEL     F+    +    TS  
Sbjct: 178 --DEGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTDTSLP 235

Query: 231 --SIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDNRVTYEEHVIYESDEDCET 288
             +I+VP L+   G  ++G S  +G+YYGTR+ IVILVD  N VT  EHVI++SD+D   
Sbjct: 236 EKTIFVPTLK-AAGNSSMGVSKIVGEYYGTRTTIVILVDNFNHVTMHEHVIHDSDKDIGL 294

Query: 289 YSFMDPKEVIQFQFNME 305
            S M+PK  + ++F+++
Sbjct: 295 SSAMNPKTKVAYEFDIQ 311

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  256 bits (654), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 144/321 (44%), Positives = 191/321 (59%), Gaps = 25/321 (7%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMA-IEKKGQGYGTWL 59
           MCIL ATRAHPDY+LIL+SNRDEF  RKTHATCW++D FILSPYD+A   K+GQ +GTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60

Query: 60  GINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFN 119
           GIN+ G++A ILNLK    L SE   +    +SRG++P  FL   + A F +WDS+ KF 
Sbjct: 61  GINKEGKLATILNLK----LGSERSTIKS--KSRGLLPYIFLSNHE-ANFKDWDSYSKFG 113

Query: 120 GQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKM------EHMVISNDIFHCAV 173
             +  L+ TG F  FYGD    +Y VID L  + +            +MVISN  F+   
Sbjct: 114 NHYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTS 173

Query: 174 GEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFN---EGEDV------ 224
                 W K +     L+ L  +  G+ +E ++  CF+L S  +        DV      
Sbjct: 174 SIPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVD 233

Query: 225 DSVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDN-RVTYEEHVIYESD 283
            +VT S+IYVPPLR   G D +G S+P GD+YGTRSQIV+L+ KD+ + T+ E +IY SD
Sbjct: 234 PNVTMSTIYVPPLRRPPG-DDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSD 292

Query: 284 EDCETYSFMDPKEVIQFQFNM 304
           ED   YS   PKE  +F+F +
Sbjct: 293 EDVRQYSVSAPKEEKRFEFEL 313

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  255 bits (652), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 137/334 (41%), Positives = 200/334 (59%), Gaps = 34/334 (10%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKK---GQGYGT 57
           MCIL AT AHPDY+LIL+SNRDEF +RKTH +CW++D FILSPYDMA E K    + +GT
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60

Query: 58  WLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEK 117
           WLGIN+ G+IA +LNLK++  L  + ++    P+SRG++P  +L       F  WD ++ 
Sbjct: 61  WLGINKDGKIATVLNLKLNKSLSLKQLVA---PKSRGMLPFVYLSDMTEDSFAEWDGYDN 117

Query: 118 FNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPF-EKMEHMVISNDIFHC--AVG 174
           F  ++  L+ TG F LFYGD K  +Y ++D + ++ +      +++V+SND+F C   +G
Sbjct: 118 FTKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLG 177

Query: 175 EHTSR----------------WNKTEYGYVLLDALAKNTTGIAKEE--LLQKCFELLSNH 216
           E  S                 W K + G  LL +L   +    ++E  ++ +CF+L S  
Sbjct: 178 ELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTC 237

Query: 217 TFNEGEDV-----DSVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDN- 270
           +    +        ++   +I VPPLR  K  D +GTSLPIG+YYGTRSQIVIL+ +   
Sbjct: 238 SVTVEDHCKFHQNSTLPNETILVPPLRC-KITDDVGTSLPIGEYYGTRSQIVILIKRGTY 296

Query: 271 RVTYEEHVIYESDEDCETYSFMDPKEVIQFQFNM 304
            V + EHVIY SD D +T+S  +PKE ++F F +
Sbjct: 297 EVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  252 bits (644), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 193/320 (60%), Gaps = 24/320 (7%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMA-IEKKGQGYGTWL 59
           MCIL ATRAHPDY+LIL+SNRDEF  RKTHATCW+++ FILSPYD+A    + Q +GTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60

Query: 60  GINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFN 119
           GIN+ G++A ILNLK+D+  +      N + RSRG++P  FL     A F++WD+++KF 
Sbjct: 61  GINKEGKLATILNLKLDNEQN------NTKSRSRGLLPFIFLSIH-KADFEDWDNYKKFE 113

Query: 120 GQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKM------EHMVISNDIFHCAV 173
           G +  L+ TG F  FYGD    +Y VID L  + +            +MV+SN  F+ + 
Sbjct: 114 GHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSS 173

Query: 174 GEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEG-------EDVD- 225
                 W K +     L+ L        +E+++  CF+L S  +           + VD 
Sbjct: 174 SIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVDP 233

Query: 226 SVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDN-RVTYEEHVIYESDE 284
           +VT ++IYVPPLR     D +G S+P GDYYGTRSQIV+LV KD+ RVT+ E V+Y SDE
Sbjct: 234 NVTMNTIYVPPLR-RPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDE 292

Query: 285 DCETYSFMDPKEVIQFQFNM 304
           D   YS   PKE  +F+F +
Sbjct: 293 DVRKYSVTSPKEEKRFKFKL 312

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  252 bits (643), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 141/324 (43%), Positives = 204/324 (62%), Gaps = 24/324 (7%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQG---YGT 57
           MCILFATR HPDY+LI++SNRDEF ERKTH+TCW++D FILSPYD+A    GQ    +GT
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60

Query: 58  WLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEK 117
           W G+NR+GR+A +LNL+I   LD + ++  GE RSRG +P  FL  +    F++WD++ K
Sbjct: 61  WTGVNRKGRVATVLNLRICDELDMKRMI--GE-RSRGALPFVFL-NDRQGNFEDWDTYAK 116

Query: 118 FNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEK--MEHMVISNDI---FHCA 172
           F   + +++RTG F LFYGD K   Y +ID L ++   F K    ++VISN+I    H  
Sbjct: 117 FCKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQ 176

Query: 173 ---VGEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEG--EDVD-- 225
              +      W K + G  +++   K  T + KE++++ CF+L S +   +   E+ D  
Sbjct: 177 SQDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLV 236

Query: 226 ---SVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDN-RVTYEEHVIYE 281
               VT  +IYV PL +T   + IG+ L  G YYGTRSQIV+LVDK   + T+ E +IY 
Sbjct: 237 KSLGVTKETIYVQPL-LTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYS 295

Query: 282 SDEDCETYSFMDPKEVIQFQFNME 305
           SD+D   YS  +PKE +++++++E
Sbjct: 296 SDQDISLYSTSNPKEELRYEYDIE 319

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  251 bits (642), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 147/321 (45%), Positives = 190/321 (59%), Gaps = 25/321 (7%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMA-IEKKGQGYGTWL 59
           MCIL ATRAHP Y+LIL+SNRDEF ERKTHATCW++D FILSPYD+A    + Q +GTW 
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60

Query: 60  GINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFN 119
           GIN+ G++A ILNLK+D   D  S     + +SRG++P  FL     A F +WD + KF 
Sbjct: 61  GINKEGKLATILNLKMD---DQRSC---TKSKSRGMLPFTFLTSH-KARFQDWDDYNKFE 113

Query: 120 GQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKH------STNPFEKMEHMVISNDIFHCAV 173
             +  LR TG F  FYGD     Y VID L H      ST   +   +MVISN  +H + 
Sbjct: 114 KHYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSS 173

Query: 174 GEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTF-NEGEDVD------- 225
                 W K +     L+ L  +     +E L+  CF+L S  +  + G   D       
Sbjct: 174 SISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVD 233

Query: 226 -SVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKD-NRVTYEEHVIYESD 283
            +VT ++IYVPPLR   G D +G S+P GDYYGTRSQIV+LV KD ++VT+ E V+Y SD
Sbjct: 234 PNVTMNTIYVPPLRRPPG-DDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSD 292

Query: 284 EDCETYSFMDPKEVIQFQFNM 304
           ED   YS   PKE  +F+F +
Sbjct: 293 EDVSHYSASAPKEEKRFEFEL 313

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  243 bits (620), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 136/321 (42%), Positives = 185/321 (57%), Gaps = 25/321 (7%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMA-IEKKGQGYGTWL 59
           MCIL ATRAHPDY+LIL+SNRDEF  RKTHATCW++D FILSPYD+A   K+ Q +GTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60

Query: 60  GINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFN 119
           GINR G++A ILNLK+D   D+       + +SRG++P  FL     A F NWD+++KF 
Sbjct: 61  GINREGKLATILNLKLDGQRDTI------KSKSRGLLPFTFLSTH-KADFQNWDNYDKFE 113

Query: 120 GQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKM------EHMVISNDIFHCAV 173
             +  L  TG F  FYGD    +Y +ID L  + N  +         +M +SN  F+ + 
Sbjct: 114 MNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSP 173

Query: 174 GEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGEDV--------- 224
                 W K +     L+ L        +E ++  CF+L S  +                
Sbjct: 174 SISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLAD 233

Query: 225 DSVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKD-NRVTYEEHVIYESD 283
            +V  ++IYVPPLR     D +G S+P GDYYGTRSQIV+LV K+ ++VT+ E ++Y SD
Sbjct: 234 PNVIMNTIYVPPLR-RPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSD 292

Query: 284 EDCETYSFMDPKEVIQFQFNM 304
           ED   YS   PKE  +F+F +
Sbjct: 293 EDVNHYSVATPKEEKRFEFKL 313

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  240 bits (612), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 136/319 (42%), Positives = 198/319 (62%), Gaps = 22/319 (6%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKK--GQGYGTW 58
           MCILFATR+H +Y+LIL+SNRDE+  RKTH TCW++D FILSPYDM+ E+    + +GTW
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60

Query: 59  LGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQE--DNAPFDNWDSWE 116
           LG+N++G+IA ILNL+  S +D + ++   +PRSRG++P  FL  +  +   F+ W+++E
Sbjct: 61  LGMNKKGKIATILNLRRFSSIDLKELV---KPRSRGLIPFTFLYSDWTNEDSFEEWETFE 117

Query: 117 KFNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKME----HMVISNDIF-HC 171
           KF  ++  L+ +G F  FYGD K   Y +ID L    N F+ ++    +M+ISND++ H 
Sbjct: 118 KFKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSL---GNTFKVLDNNNRNMIISNDLYQHK 174

Query: 172 AVGEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFN-----EGEDVDS 226
              E    W K + G   L+   K T    ++E+L KCFEL S  + +     E      
Sbjct: 175 DEYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKE 234

Query: 227 VTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDNR-VTYEEHVIYESDED 285
           +   +IYVPPL++    D IG +   G YYGTR+QIV+LV KD + VT  EH I+ SDE+
Sbjct: 235 LAAETIYVPPLKVCPDED-IGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEE 293

Query: 286 CETYSFMDPKEVIQFQFNM 304
              YS ++PKEV +  F +
Sbjct: 294 IYKYSGLNPKEVQRLDFTI 312

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  238 bits (607), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 125/314 (39%), Positives = 191/314 (60%), Gaps = 16/314 (5%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKK-----GQGY 55
           MCILFAT AHP YKL+L+SNRDE+F RKTH TCW+H+  IL+PYDMA++       G   
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 56  GTWLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSW 115
           GTW+GINR G ++V+LNL   +P D++         SRG V +++L+  D+  +D+W+++
Sbjct: 61  GTWIGINRAGHVSVLLNL---APKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTY 117

Query: 116 EKFNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKMEHMVISNDIFHCAVGE 175
           EKF      L +T  FT FYGD  + +++VI+ L  + +PF +  + V+SN     A  +
Sbjct: 118 EKFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQSPYYVVSNGPSDGA--K 175

Query: 176 HTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGEDV----DSVTTSS 231
              +W K   G  L   + + +  +++EELLQ+CF L S   +   + +    DS+   +
Sbjct: 176 ALGQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDSIPKRT 235

Query: 232 IYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDNRVTYEEHVIYESDEDCETYSF 291
           I+VP L    G   +  S   G YYGTRS IV+LV +D  V   EHVI++SD+D ++YS 
Sbjct: 236 IFVPALYNLSGQANL--SFAAGMYYGTRSTIVMLVSEDGNVVTREHVIHDSDQDLDSYSI 293

Query: 292 MDPKEVIQFQFNME 305
           ++PKE +  +F+++
Sbjct: 294 LNPKEQVTHRFSLQ 307

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  237 bits (604), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 136/317 (42%), Positives = 188/317 (59%), Gaps = 20/317 (6%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGF--ILSPYDMAI--EKKGQGYG 56
           MCIL A+R HP+Y LIL+SNRDEF +R+TH TCWN   +  IL PYDM+   EK     G
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKIG 60

Query: 57  TWLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWE 116
           TW GIN  GR++ ILNLK D    S    V    +SRG +P++FL  ++     NWDS+E
Sbjct: 61  TWCGINEFGRVSTILNLKNDDSFQSS---VPSTKKSRGALPIKFLDNKETDSLLNWDSYE 117

Query: 117 KFNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKME--HMVISNDIFHCAVG 174
           KF  ++  ++ TG F  FYGD +  +YNVID +  STN    ++  ++VISND F  + G
Sbjct: 118 KFVKEYPFVKETGDFNFFYGDVRIGKYNVIDSI-GSTNEVLTVDNPYLVISNDKFGKSNG 176

Query: 175 EHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNE----GEDVDSVTTS 230
           + T  W K      LL  L    T   +++L+ KCF++ S +T NE      DV  + T 
Sbjct: 177 KSTKEWEKITLAKNLLKHLPLCET---EDDLIHKCFDIASTNTLNEDLIKDVDVRELMTE 233

Query: 231 SIYVPPLRIT--KGADAIGTSLPIGDYYGTRSQIVILVDKD-NRVTYEEHVIYESDEDCE 287
           +I VPPL +   +  + IG SLPIG YYGTRSQIVILV+K+  +V + E ++Y SD+D  
Sbjct: 234 TILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDVT 293

Query: 288 TYSFMDPKEVIQFQFNM 304
           T     P + + + F +
Sbjct: 294 TQKLSSPIQDLTYNFTI 310

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  235 bits (599), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 188/310 (60%), Gaps = 17/310 (5%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQ-GYGTWL 59
           MCIL A+ AHP Y LI +SNRDEFFERKT  TC NHD +ILSP D A+    +   GTW 
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60

Query: 60  GINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFN 119
           G+NR+GR+AVILNL+   P     V     P SRG VP+++L   D  P  +W+S+EKF 
Sbjct: 61  GVNRKGRVAVILNLRNKEPAKRIPV---KSPISRGSVPMKYLM--DRGPSTDWNSFEKFV 115

Query: 120 GQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKME-HMVISNDIFHCAVGEHTS 178
            ++  +     F +FYGD  + EY  ID L +S+      + ++V+SND       + +S
Sbjct: 116 SKYPQITECE-FNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHI-----DSSS 169

Query: 179 RWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNE--GEDVDSVTTSSIYVPP 236
           RW K +   +LL  L +++   ++EEL++KCF L SN    E    D +  T SSI++PP
Sbjct: 170 RWPKVQKADILLQELVQSSQHDSEEELIEKCFALASNTEPAEIDNSDKEEFTCSSIFIPP 229

Query: 237 LRITKGADAIGTSLPIGDYYGTRSQIVILVDKDNR-VTYEEHVIYESDEDCETYSFMDPK 295
           + I +  D +G SLP G +YGTRSQIVILV +  R +++ E V+++SD +   +S   PK
Sbjct: 230 VEIPEKVD-VGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSEKHPK 288

Query: 296 EVIQFQFNME 305
           E +QF  +++
Sbjct: 289 EKLQFNLHVD 298

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  223 bits (568), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 124/311 (39%), Positives = 189/311 (60%), Gaps = 24/311 (7%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQ-GYGTWL 59
           MCIL A+ AHP Y LIL+SNRDEF ER+T  TC NHD +++SP DM ++   +   GTW 
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60

Query: 60  GINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFN 119
           G NR GRIAVILNL+  +   +++  +     SRG V +++L   D  P  +W+S+ KF 
Sbjct: 61  GANRNGRIAVILNLRTGNTNQTKTKRI----VSRGNVTMRYLT--DKQPASDWNSYAKFA 114

Query: 120 GQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKME----HMVISNDIFHCAVGE 175
            +  ++ ++  F +FYGD KS +Y  ID   HS   FE +     ++VISND       E
Sbjct: 115 SKCPDI-KSCEFNMFYGDCKSGDYTAIDSSGHS---FEVLRSQNPYLVISNDSI-----E 165

Query: 176 HTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSN-HTFN-EGEDVDSVTTSSIY 233
             ++W K E    L+  L +++   ++++LL +CF L S+   +N +  D + VT+S+I+
Sbjct: 166 SATKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASHKQDYNVDHMDKEKVTSSNIF 225

Query: 234 VPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDK-DNRVTYEEHVIYESDEDCETYSFM 292
           VPPL + K  D +G S+P G +YGTRSQIV+LV K D  + + EHV+Y+SD +   +   
Sbjct: 226 VPPLEVPKSED-LGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAA 284

Query: 293 DPKEVIQFQFN 303
           +PK+ + ++ N
Sbjct: 285 NPKKCVSYKIN 295

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  216 bits (550), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 127/317 (40%), Positives = 178/317 (56%), Gaps = 19/317 (5%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQG---YGT 57
           MCIL  TR HPDY L+L+SNRDEFFER TH T W+   +ILSPYDM       G    GT
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60

Query: 58  WLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEK 117
           W+G+NR GR++ +LNLK++     +      + RSRG++P  FL   D    D WDS+EK
Sbjct: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLS--DRGFIDQWDSFEK 118

Query: 118 FNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKME-----HMVISNDIFHCA 172
           F  ++ +L ++G F LF GD +  +Y V+D    S N F  +      +MV+SND +   
Sbjct: 119 FRDRYPDLEKSGDFNLFIGDIRQQDYKVLD---SSGNTFSVLNETTGMNMVVSNDTYKEF 175

Query: 173 VGEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEG-EDVDS---VT 228
                S WNK + G + L  L      + K   + KCF   S  +  +  ED+     V 
Sbjct: 176 NENDISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKTPEVI 235

Query: 229 TSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDNR-VTYEEHVIYESDEDCE 287
           +++I+VPPL+     D +G +   G Y+GTRSQ+V LV KD R VT  E +++ SD D +
Sbjct: 236 SNTIFVPPLKCQPQQD-VGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLDRD 294

Query: 288 TYSFMDPKEVIQFQFNM 304
             S  +PKEV QF F++
Sbjct: 295 FNSPHNPKEVKQFTFDL 311

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  215 bits (548), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 122/321 (38%), Positives = 185/321 (57%), Gaps = 25/321 (7%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNH--DGFILSPYDMAI-EKKGQGYGT 57
           MCILF TR+HPDY+LIL+SNRDEF +RKT  +CWN   +  +L PYD++  E     +GT
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60

Query: 58  WLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEK 117
           W GIN  GR++ +LNLK+D     +    N   +SRG +P++FL       F++W+S+ K
Sbjct: 61  WCGINEFGRVSSVLNLKMDENKVEDK---NVRKKSRGYLPVKFLDNRKENSFNDWNSYSK 117

Query: 118 FNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKMEH-----MVISNDIFHCA 172
           F  Q+ +L +TG F LF GD K  EY +ID    +    +  +      +VISN  F   
Sbjct: 118 FLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEF--- 174

Query: 173 VGEHTSRWNKTEYGYVLLDA-LAKNTTGIAKEELLQKCFEL-----LSNHTFNEGEDVDS 226
           +     RW+K   G  L+D  L+K+     +  +++ CF++     L+N   +  +D+  
Sbjct: 175 ISNDKERWHKISNGEKLMDEFLSKDIRD--ENSVIESCFKIASTSELTNEYLHSHDDILD 232

Query: 227 VTTSSIYVPPLRITKGA--DAIGTSLPIGDYYGTRSQIVILVDKD-NRVTYEEHVIYESD 283
           + T +++VPP+++      D IG SLP+G +YGTRSQIVILV+K+   V Y E V+YE D
Sbjct: 233 LMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECD 292

Query: 284 EDCETYSFMDPKEVIQFQFNM 304
           +D        P   + F++N+
Sbjct: 293 DDVSKAGIEKPINELNFEYNI 313

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  209 bits (533), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 123/317 (38%), Positives = 176/317 (55%), Gaps = 22/317 (6%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQGYGTWLG 60
           MCIL AT  HP Y L+L+SNRDE+F RK     W  D F+L P D  ++  G+  GTW+G
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGEDLGTWIG 60

Query: 61  INRRGRIAVILNLKIDS-PLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFN 119
            NR G+I  +LNLK+ S P    +V     P SRG +P+ FL     A F +WD+++KF 
Sbjct: 61  ANRDGKIGTVLNLKLFSDPRGRPAVC----PESRGKIPVSFLSSR-GANFKDWDTYDKFC 115

Query: 120 GQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKM--EHMVISNDIFHCAVGEHT 177
            Q   L  T  F  FYGD    +Y VID L ++T    K   +++V+SNDIF    GE  
Sbjct: 116 HQFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQ---GESN 172

Query: 178 SR--WNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGED-------VDSVT 228
               W+K       L  L +      +++ +Q+CF + S + F+   D          ++
Sbjct: 173 KNRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELS 232

Query: 229 TSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKD-NRVTYEEHVIYESDEDCE 287
             +++VPPL+ T   D +G S+PIG+YYGTRSQ VILV KD + +TY E +I++SD D  
Sbjct: 233 MQTVFVPPLK-TSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDAL 291

Query: 288 TYSFMDPKEVIQFQFNM 304
            YS    KE  ++ F++
Sbjct: 292 QYSRDHYKEQKRYDFDL 308

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  178 bits (452), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 114/314 (36%), Positives = 177/314 (56%), Gaps = 34/314 (10%)

Query: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMA--IEKKGQG---- 54
           MCIL  T AHP YKLIL+SNRDE FER+TH+TCWNH+  IL PYDM+  I   G G    
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 55  ---YGTWLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDN 111
              +GTW G+N+ G+I  +LNL  +     +    N   +SRG++P+++L   D+  F +
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGD-CNNSLQSRGLIPIKYLCDFDHG-FQD 118

Query: 112 WDSWEKFNGQHGNLR-RTGPFTLFYGDAKSDEYNVIDYLKHSTNPF-EKMEHMVISNDIF 169
           W++++KF  Q+G++  + G F LF GD KS+EY++I+ +  S     E+  +MV+SN   
Sbjct: 119 WNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSN--I 176

Query: 170 HCAVGEHTSRWNKTEYGYVLLDALAKNTTGIAKE---ELLQKCFELLSNHTFNEGEDVDS 226
           +    +    W+K + G  LL+ L  +    + +   E+L+ CF++ S    + G+ +D 
Sbjct: 177 NWGDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLS-GKKIDG 235

Query: 227 ------VTTSSIYVPPLRITKG--------ADAIGTSLPIGDYYGTRSQIVILVD-KDNR 271
                  T   I+VPPL+ ++G                    YYGTRSQIV+L + K N+
Sbjct: 236 NIERLEQTKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCERKSNK 295

Query: 272 VTYEEHVIYESDED 285
           VT+ E +++  +ED
Sbjct: 296 VTFVERILHCKNED 309

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  149 bits (375), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/280 (35%), Positives = 144/280 (51%), Gaps = 33/280 (11%)

Query: 43  PYDMAIEKKGQGYGTWLGINRRGRIAVILNLKIDSPLDSESVLVNGEP---RSRGIVPLQ 99
           P     E +   +GTW GIN+ GR+  +LNLK+D           G P    SRG VP  
Sbjct: 11  PLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLDQGAQ------RGHPLHLSSRGKVPTA 64

Query: 100 FLQQEDNAPFDNWDSWEKFNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKM 159
           FL Q D   ++ W+S+ KF  Q   L  TG F  FYGD K+ +Y +ID L+ + +     
Sbjct: 65  FLSQHD-LDWEQWNSYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNN 123

Query: 160 E------HMVISNDIFHCAVGEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELL 213
           E      +MV+SND++    GE T  W K +     L  L ++     ++  + KCF++ 
Sbjct: 124 ESQDDSSYMVVSNDVYRYQ-GEET--WPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVA 180

Query: 214 SNHTFNEGEDVDS--------VTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVIL 265
           S    + G D  S        VT  SI+VPPL+     + +GT+   G +YGTRSQIV+L
Sbjct: 181 ST---SPGLDWQSEELLKSSDVTKQSIFVPPLKFPPDLN-LGTTTHAG-FYGTRSQIVLL 235

Query: 266 VDKD-NRVTYEEHVIYESDEDCETYSFMDPKEVIQFQFNM 304
           V KD  +VT+ E V++ SDE     S   P E ++FQF++
Sbjct: 236 VSKDRQKVTFVERVLHNSDEQVSQRSPDHPAEQLKFQFDL 275

>NDAI0A06880 Chr1 complement(1565984..1575334) [9351 bp, 3116 aa] {ON}
            Anc_3.124 YBR140C
          Length = 3116

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 169  FHCAVGEHTSR-WNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGEDVDSV 227
            F   +  H S  WNK  Y +VLL  + +  +    +     C ELL  +++ E ++    
Sbjct: 2859 FLSEIESHNSIIWNKDNYPHVLLAFITRGLSIPVVKTAAVNCLELLFRNSYRELKNDSKY 2918

Query: 228  TTSSIYVPPLRITKGADAIGTSL 250
             T   Y+  + I  GAD++G  L
Sbjct: 2919 KTYLCYLFFIYILFGADSLGKLL 2941

>KLTH0A05016g Chr1 (417016..418875) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40053 Saccharomyces cerevisiae YER080W FMP29
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 619

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 6/84 (7%)

Query: 223 DVDSVTTSSIYVP---PLRITKGADAIGTSLP-IGDYYGTRSQIVILVDKDNRVTYEEHV 278
           ++DS+    +Y P   P+ +    D    S P + D+  T  +  IL +    V Y+   
Sbjct: 400 NIDSLLKPRLYHPDLDPMNVL--LDEKDNSAPYLLDFENTSIKPFILQNSPQFVAYDGPK 457

Query: 279 IYESDEDCETYSFMDPKEVIQFQF 302
           IY  +ED E Y  +   E +Q+QF
Sbjct: 458 IYNLEEDVEGYKDLSEAEKVQYQF 481

>ZYRO0A04510g Chr1 complement(365695..366972) [1278 bp, 425 aa] {ON}
           no similarity
          Length = 425

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 6/65 (9%)

Query: 152 STNPFEKMEHMVISNDIFHCAVGEHTSRWN---KTEYGYVL--LDALAKNTTGIA-KEEL 205
           S+  F+ +   V SN IF   +GEHTS  N   +  +G +L  LD + ++   I  K E 
Sbjct: 131 SSVSFKSIVSAVFSNSIFQNPLGEHTSNTNPFIENSFGGILDQLDGVNEDHLLICTKNES 190

Query: 206 LQKCF 210
           L  CF
Sbjct: 191 LNSCF 195

>ACL031C Chr3 complement(309369..311213) [1845 bp, 614 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER080W
          Length = 614

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 254 DYYGTRSQIVILVDKDNRVTYEEHVIYESDEDCETYSFMDPKEVIQFQF 302
           D+ GT  +  IL +    V Y+   IY+ + D E YS ++ +E  Q++F
Sbjct: 428 DFEGTTVKPFILHNNPQFVAYDGPKIYDLERDVENYSKLNAQEKDQYEF 476

>Suva_5.193 Chr5 (294537..296417) [1881 bp, 626 aa] {ON} YER080W
           (REAL)
          Length = 626

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 254 DYYGTRSQIVILVDKDNRVTYEEHVIYESDEDCETYSFMDPKEVIQFQF 302
           D+ G  ++  IL +    V YE   IYE  ED + +  +   E +Q+QF
Sbjct: 435 DFEGACTKPFILQNSPQFVAYEGPKIYELKEDIKDFDKLSEPEKVQYQF 483

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,662,102
Number of extensions: 1702036
Number of successful extensions: 4713
Number of sequences better than 10.0: 31
Number of HSP's gapped: 4705
Number of HSP's successfully gapped: 31
Length of query: 306
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 197
Effective length of database: 40,982,805
Effective search space: 8073612585
Effective search space used: 8073612585
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)