Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E04665g3.489ON64764731160.0
SAKL0F02838g3.489ON65465716320.0
KLTH0F14762g3.489ON65062015550.0
AFR307C3.489ON65065215470.0
NCAS0E008303.489ON67163814750.0
Kpol_480.163.489ON65566013990.0
TDEL0D055703.489ON64966013720.0
ZYRO0D10054g3.489ON66466913311e-176
Suva_7.4163.489ON71371713191e-173
Smik_6.2243.489ON70570812941e-169
NDAI0G009603.489ON70065512871e-169
YGR128C (UTP8)3.489ON71371812791e-167
TBLA0C044603.489ON69870412731e-166
Skud_7.4393.489ON71371612701e-166
TPHA0D042303.489ON65266512541e-164
CAGL0I10560g3.489ON67865412491e-163
Kwal_55.212223.489ON3733769061e-116
KNAG0B008303.489ON6076457402e-88
KAFR0C019403.489ON6096447103e-84
Kwal_55.21225singletonOFF2152134961e-57
Smik_16.4487.541ON153655790.78
TDEL0F044008.313ON168896761.6
YLR060W (FRS1)8.33ON595119733.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E04665g
         (647 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...  1204   0.0  
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   633   0.0  
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   603   0.0  
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   600   0.0  
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   572   0.0  
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   543   0.0  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   533   0.0  
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   517   e-176
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...   512   e-173
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...   503   e-169
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   500   e-169
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...   497   e-167
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   494   e-166
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...   493   e-166
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   487   e-164
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   485   e-163
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   353   e-116
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   289   2e-88
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   278   3e-84
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   195   1e-57
Smik_16.448 Chr16 (764670..769280) [4611 bp, 1536 aa] {ON} YPR18...    35   0.78 
TDEL0F04400 Chr6 complement(825031..830097) [5067 bp, 1688 aa] {...    34   1.6  
YLR060W Chr12 (260979..262766) [1788 bp, 595 aa] {ON}  FRS1Beta ...    33   3.5  

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score = 1204 bits (3116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/647 (93%), Positives = 605/647 (93%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60
           MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60

Query: 61  KLVFNLPIPSTNIVTACDVVEDAANTEVWCYGLEARKVSHLHLATKPMIQDAVSSSNAEI 120
           KLVFNLPIPSTNIVTACDVVEDAANTEVWCYGLEARKVSHLHLATKPMIQDAVSSSNAEI
Sbjct: 61  KLVFNLPIPSTNIVTACDVVEDAANTEVWCYGLEARKVSHLHLATKPMIQDAVSSSNAEI 120

Query: 121 TSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRXXXXXX 180
           TSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIR      
Sbjct: 121 TSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRFVQFFQ 180

Query: 181 XXXXXXXXXXLCQLSDEKICYKLFQVRSESVSCIELNSIILENYTLENAKLCFEFGKLYV 240
                     LCQLSDEKICYKLFQVRSESVSCIELNSIILENYTLENAKLCFEFGKLYV
Sbjct: 181 DGQGNDFFFVLCQLSDEKICYKLFQVRSESVSCIELNSIILENYTLENAKLCFEFGKLYV 240

Query: 241 LKNSNELSIYQLPHLQLQTSIQLPFISKDAVVSIKPVSSNRVLLTADNTIYLVDLLYNAI 300
           LKNSNELSIYQLPHLQLQTSIQLPFISKDAVVSIKPVSSNRVLLTADNTIYLVDLLYNAI
Sbjct: 241 LKNSNELSIYQLPHLQLQTSIQLPFISKDAVVSIKPVSSNRVLLTADNTIYLVDLLYNAI 300

Query: 301 LFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLK 360
           LFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLK
Sbjct: 301 LFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLK 360

Query: 361 DAMGKGFMVXXXXXXXXXFEESNEDDDVELPSPDYERIIKQLHICKKIENFDSIFFKMLS 420
           DAMGKGFMV         FEESNEDDDVELPSPDYERIIKQLHICKKIENFDSIFFKMLS
Sbjct: 361 DAMGKGFMVKQKQKLQKLFEESNEDDDVELPSPDYERIIKQLHICKKIENFDSIFFKMLS 420

Query: 421 LDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPLFPPVHAKGLLTKLK 480
           LDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPLFPPVHAKGLLTKLK
Sbjct: 421 LDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPLFPPVHAKGLLTKLK 480

Query: 481 NNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKAGIRKIEKM 540
           NNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKAGIRKIEKM
Sbjct: 481 NNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKAGIRKIEKM 540

Query: 541 DITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEYLEKLSSFVDAQVSV 600
           DITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEYLEKLSSFVDAQVSV
Sbjct: 541 DITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEYLEKLSSFVDAQVSV 600

Query: 601 VSQNIELLHLAEHYTKHXXXXXXXXXXXXXXXXXQPISAYTVDYLEC 647
           VSQNIELLHLAEHYTKH                 QPISAYTVDYLEC
Sbjct: 601 VSQNIELLHLAEHYTKHSSVVNNKSNSSTNSSSTQPISAYTVDYLEC 647

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/657 (50%), Positives = 452/657 (68%), Gaps = 15/657 (2%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60
           MASISQPFRL+ALPKI SLNN++ QTDYLQV + L+PSANK+NIG+SGSSISQY+INPTP
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60

Query: 61  KLVFNLPIPSTNIVTACDVVE------DAANTEVWCYGLEARKVSHLHLATKPMIQDAVS 114
           KLV NL IPST+IVTACDV E      D    EVWCY L A K   L+   KP+  DA S
Sbjct: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAPS 120

Query: 115 SSNAEITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIR 174
            ++ +    +K  +K +V S+KI+   + ++ +L+NGL+QTFD++LKL ++ DISY +I 
Sbjct: 121 VNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNIS 180

Query: 175 XXXXXXXXXXXXXXXXLCQLSDEKICYKLFQV--RSESVSCIELNSIILENYTLENAKLC 232
                           L  L+D+K+CYKLF++     +V   ELNS+ILE ++L+N+K  
Sbjct: 181 LVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNSKTF 240

Query: 233 FEFGKLYVLKNSNELSIYQLPHLQLQTSIQLPFISKDAVVSIKPVSSNRVLLTADNTIYL 292
           ++FGK+Y L N  ++SIY LPH QL  +I LPF++ + VVS KP+S+NR LLT DN IYL
Sbjct: 241 YQFGKIYTLSNG-KISIYSLPHFQLSNTINLPFVTHENVVSFKPISTNRALLTVDNRIYL 299

Query: 293 VDLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINI 352
           +DLL+NAIL Q++L ++K  QLL+TA++  N+ +N KTIA+ V+TK+  N TS LD++NI
Sbjct: 300 LDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNI 359

Query: 353 DVGTGTLKDAMGKGFMV--XXXXXXXXXFEESNEDDDVELPSP-DYERIIKQLHICK-KI 408
           +VG+GTLKD+M KGF+            F+E +++ D +  S  DY +I+ +L   K K 
Sbjct: 360 NVGSGTLKDSMSKGFLTQDATEEVLNSLFDEQDDELDEDGTSQFDYNQILSELEKAKSKT 419

Query: 409 ENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPLFP 468
           E FD++FFK L++ KEYYT+ DRF N    L +++  +F NF  EYP+ALTYLLTHPLFP
Sbjct: 420 EKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLLTHPLFP 479

Query: 469 PVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKE 528
             HA  LL+K K +PRLF+QAIVTCPN+PLD LL ELF + N ELC D++LR+LQD+ K+
Sbjct: 480 AKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKD 539

Query: 529 SIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEYLE 588
           SIK  I+K+ K+DI NF+  ++N +  D +   +KPQ+FQL++L++DSIGLFALD E LE
Sbjct: 540 SIKQSIKKMSKVDINNFIGFVINEDD-DEERNKSKPQLFQLLNLVLDSIGLFALDGESLE 598

Query: 589 KLSSFVDAQVSVVSQNIELLHLAEHYTKHXXXXXXXXXXXXXXXXXQPISAYTVDYL 645
            L  F++ QV +V QNIELL+L +  T                   Q + +Y+V+YL
Sbjct: 599 NLHQFIENQVDIVEQNIELLNLLDD-TSAKSTSIISSYSASSSTTEQALPSYSVEYL 654

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/620 (48%), Positives = 439/620 (70%), Gaps = 11/620 (1%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60
           M SISQPFRL+ALPKI SLNNYA Q +YLQV D L+P+ N +N+G+SGS++SQY+INPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60

Query: 61  KLVFNLPIPSTNIVTACDVVE-----DAANTEVWCYGLEARKVSHLHLATKPMIQDAVSS 115
           KLV+N PI STN+V+AC V E     +  + EV CYG+++ +V  L    KP+   A  S
Sbjct: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASDS 120

Query: 116 SNAEITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRX 175
           S  E  +  K  +  ++V++K++   + ++ +LR+GLIQ FD+ELKL +++D SY ++  
Sbjct: 121 SFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSY 180

Query: 176 XXXXXXXXXXXXXXXLCQLSDEKICYKLFQV-RSESVS-CIELNSIILENYTLENAKLCF 233
                          L  +   K+ +KLF++ +S+S +   EL+S+ILEN  L+++++ +
Sbjct: 181 VQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKDSQIFY 240

Query: 234 EFGKLYVLKNSNELSIYQLPHLQLQTSIQLPFISKDAVVSIKPVSSNRVLLTADNTIYLV 293
           +FG++Y L + N +SIY LPH Q   +I+LPF++ ++++S KP+S+NR LLT+DN I+L+
Sbjct: 241 QFGQVYRL-HGNAVSIYNLPHFQHSRTIELPFLAPESIISFKPISTNRALLTSDNKIFLL 299

Query: 294 DLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINID 353
           DLL+NAIL Q+++ ++K  QLL TAV+  NS  N KTIAL V+ K+G+NP+S LD+INID
Sbjct: 300 DLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINID 359

Query: 354 VGTGTLKDAMGKGFMVXXXXXXXXXFEESNEDDDVELPSPDYERIIKQL-HICKKIENFD 412
           VGTGTL+D+MGKGFM             S  +D  E    +Y+RI+K+L      IENFD
Sbjct: 360 VGTGTLRDSMGKGFMSRENKSQHLQPLISTLND-TEAAEFNYDRILKELSKAADNIENFD 418

Query: 413 SIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPLFPPVHA 472
           S+FFK L +   YYTD+DRF+ND + L  +   +F +FK EYPKALTYLLT+PLFP  H 
Sbjct: 419 SVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTNPLFPVSHT 478

Query: 473 KGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKA 532
             LL KLK++PRLFKQAIVTCPN+ LD+L+ ELF + N ELC D++LR+LQD+ K+SIK 
Sbjct: 479 HNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKE 538

Query: 533 GIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEYLEKLSS 592
            I++  K+D+ NF++ +++ N  +  +K NKP++FQL+SL++DS+GLFAL++E LEKL+ 
Sbjct: 539 AIKQKSKIDVNNFINFVISENFEEDRIK-NKPRLFQLLSLVLDSVGLFALENEMLEKLTK 597

Query: 593 FVDAQVSVVSQNIELLHLAE 612
           ++D Q+SVV +N+EL +L E
Sbjct: 598 YIDQQLSVVKENVELYNLVE 617

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/652 (47%), Positives = 436/652 (66%), Gaps = 9/652 (1%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60
           MA I+QPFRL+ LPKI SLNNYA QT YLQV D L P++N V +G+SGSSISQY+INPTP
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPTSNTVTVGVSGSSISQYVINPTP 60

Query: 61  KLVFNLPIPSTNIVTACDVVEDAANTEVWCYGLEAR-KVSHLH-LATKPMIQDAVSSSNA 118
           KLV+N+PIPSTN+VT CDV+  +   E+W Y L A  KV  LH +  K       +  +A
Sbjct: 61  KLVYNIPIPSTNVVTGCDVLAMSDGAELWSYALTANGKVHTLHAVLRKAGAAPQETGLDA 120

Query: 119 EITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRXXXX 178
                FK  LK  VV ++I S  ++++V+L  GLIQT+DY+L+L +++DISY ++     
Sbjct: 121 SEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEY 180

Query: 179 XXXXXXXXXXXXLCQLSDEKICYKLFQVR--SESVSCIELNSIILENYTLENAKLCFEFG 236
                       LC + ++K CYKLFQ+   +E++   ELNS+ILE++ L  +K+ ++FG
Sbjct: 181 FTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAESKMVYQFG 240

Query: 237 KLYVLKNSNELSIYQLPHLQLQTSIQLPFISKDAVVSIKPVSSNRVLLTADNTIYLVDLL 296
           KLY L +S ++ +Y LPH QL   + LPF+ KD  VS++ +S+NR+LLT  N I+L+DLL
Sbjct: 241 KLYRLVDS-KMYVYSLPHFQLSHCVPLPFVRKDDQVSLQAISTNRLLLTCCNKIFLLDLL 299

Query: 297 YNAILFQKDLQNIKAIQLLSTAVVQENS--EDNRKTIALDVTTKNGANPTSYLDVINIDV 354
           +NAIL++++L NIK  QLL  AV+   +  E NR T A+ V+TK G+NP+S LDV+ I V
Sbjct: 300 HNAILYERELSNIKFFQLLRAAVIPGTTPGESNR-TFAIGVSTKQGSNPSSALDVVTIAV 358

Query: 355 GTGTLKDAMGKGFMVXXXXXXXXXFEESNEDDDVELPSPDYERIIKQLHICKKIENFDSI 414
           GTGTLKD++GKGF+                DDD E P+ D+  I+ +L      + FDSI
Sbjct: 359 GTGTLKDSLGKGFLSGEHRRTEALKPLFGTDDD-ESPNIDFAAILAELTSRTTPKAFDSI 417

Query: 415 FFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPLFPPVHAKG 474
           F+K L   KEYYT++DRF+N+S+ L  I+D +F  F DE+PKAL YLLTHPLFP  H KG
Sbjct: 418 FYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTHPLFPSSHTKG 477

Query: 475 LLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKAGI 534
           LL KLK +PRLFKQA+VTCPN+PLD+LL ELF + N EL  D++LRVLQ++ KE IK GI
Sbjct: 478 LLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQGI 537

Query: 535 RKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEYLEKLSSFV 594
           R++ ++D+ NFL+ ++  +    + +  KPQ+FQL+SL+ID++GL AL+ + L +LS+F+
Sbjct: 538 RELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDILHRLSAFI 597

Query: 595 DAQVSVVSQNIELLHLAEHYTKHXXXXXXXXXXXXXXXXXQPISAYTVDYLE 646
           D+QV+V  Q +ELL+L E+ +                     I  Y+V+YL+
Sbjct: 598 DSQVAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEYLD 649

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/638 (48%), Positives = 437/638 (68%), Gaps = 32/638 (5%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDN-LSPSANKVNIGISGSSISQYLINPT 59
           M S+SQPFRL+ LPKI SL+N+A Q+DY+QV D+  SP+ NK+ IGISGSS+SQY++NPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 60  PKLVFNLPIPSTNIVTACDVVEDAANTE-VWCYGLEARKVSHLHLATKPMIQ------DA 112
           PKL+FN PIPSTNIVTAC+V E   ++E  WC+   A K S L+L  K   Q        
Sbjct: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEETWCFATMANKTSTLNLINKNQYQTNEEESGD 120

Query: 113 VSSSNAEITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDD 172
            + S++ +TS+FK K    VV IKI    +K++V+L+NG IQT+D+ELKL N+I+++Y++
Sbjct: 121 SAPSDSSVTSEFKIKADDHVVDIKI-LNKKKIIVVLKNGKIQTYDFELKLLNSINMAYNN 179

Query: 173 IRXXXXXXXXXXXXXXXXLCQLSDEKICYKLFQVRS--ESV--SCIELNSIILENYTLEN 228
           +R                LC L ++K+C KLFQ+    E++  S IEL S ILEN+ LEN
Sbjct: 180 VRFVEHFHEDGKDFMFV-LCDLENDKVCLKLFQINENIETINDSAIELTSTILENFPLEN 238

Query: 229 AKLCFEFGKLYVLKNSNELSIYQLPHLQLQTSIQLPFIS----KDAVVSIKPVSSNRVLL 284
           AK C++FGK Y L + +++ +Y LP  Q Q SI LP I+     + VVS KP+S NR+LL
Sbjct: 239 AKFCYQFGKFYKLTD-DKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILL 297

Query: 285 TADNTIYLVDLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPT 344
           T +N IYL+DL++N+IL +++L ++K  QLL TAVV  N   NR T+A+ V+TK G+NPT
Sbjct: 298 TVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQNR-TLAIGVSTKFGSNPT 356

Query: 345 SYLDVINIDVGTGTLKDAMGKGFMVXXX----XXXXXXFEESNE--DDDVELPSPDYERI 398
           S L+++N+DVGT T+KD++GK F               F++ N+  D   ++ + +YE+I
Sbjct: 357 SSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKKQVKNFNYEKI 416

Query: 399 IKQLHICKK-IENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKA 457
            K+L   K  +  FD IFFK   + KEYYT+ DRF+ + + L QIID +F  FK+EYPK 
Sbjct: 417 YKELVDSKNDVTKFDDIFFKSFDIKKEYYTEKDRFIYNHEFLVQIIDLIFETFKEEYPKT 476

Query: 458 LTYLLTHPLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDI 517
            TYLLT PLFP    KGLL +L N+PRLFKQAIVTCPN+PL++LL ELF I+N EL  DI
Sbjct: 477 FTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCPNLPLNELLAELFTISNGELSLDI 536

Query: 518 TLRVLQDYKKESIKAGIRKIEKMDITNFLDMILNSNKADSDLK--LNKPQIFQLMSLIID 575
           +LR+LQDY ++SIK  ++K+ K+++ NF++ I++    +SD+K   N P +FQL+SL++D
Sbjct: 537 SLRILQDYTRDSIKKELKKLPKIEVENFIEFIIDE---ESDIKDTTNAPHLFQLLSLVVD 593

Query: 576 SIGLFALDDEYLEKLSSFVDAQVSVVSQNIELLHLAEH 613
           SIGLFALD+  LE+LS ++D QV++   N EL HL ++
Sbjct: 594 SIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDY 631

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/660 (44%), Positives = 426/660 (64%), Gaps = 20/660 (3%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60
           M S SQPFRL+ LPKI SL+N   Q   LQ+ D+ S  +NK+ IGISGS+ISQY+INPTP
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADDFSLESNKITIGISGSTISQYIINPTP 60

Query: 61  KLVFNLPIPSTNIVTACDVVE-----DAANTEVWCYGLEARKVSHLHLATKPMIQDAVSS 115
            LVFN+PIPSTN VTAC++       D +  E W YGL   K   L+++ K    D  ++
Sbjct: 61  SLVFNVPIPSTNNVTACNIGHFVSDTDGSKLECWAYGLSYNKNHTLNISIKTSDDDKYAT 120

Query: 116 SNAEITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRX 175
           S  E+   +  K   ++  IKI  K + ++V+L+NGLIQ +D+ LKL  ++++ Y DI  
Sbjct: 121 SGGEVVETYSQKCDDKIEHIKINEKEKVIVVVLKNGLIQFYDFTLKLLKSVNVMYSDI-S 179

Query: 176 XXXXXXXXXXXXXXXLCQLSDEKICYKLFQVRSESVSCI-ELNSIILENYTLENAKLCFE 234
                          L  +  +KI +KL+++ +   + I EL+S ILE+  L  +++C++
Sbjct: 180 FVEHFEEDGKQFAIILSNIEGKKISFKLYELFTNDKTSINELSSTILEDADLGESQICYQ 239

Query: 235 FGKLYVLKNSNELSIYQLPHLQLQTSIQLPFISK--DAVVSIKPVSSNRVLLTADNTIYL 292
           FGK+Y L   + L IY LP  QLQ +I+LPFI K    V+S  P+++NR+LLT +N IYL
Sbjct: 240 FGKIYRLF-EDRLYIYNLPQCQLQQTIELPFIQKKDSDVLSFSPIANNRILLTVNNKIYL 298

Query: 293 VDLLYNAILFQKDLQNIKAIQLLSTAVVQENSED-NRKTIALDVTTKNGANPTSYLDVIN 351
           +DL++N+IL ++DL ++K  QLL + VV    E+ N KTIA+ V+ KNG +P S L+VIN
Sbjct: 299 LDLVHNSILAERDLSHVKVYQLLKSIVVPSKGENKNSKTIAIGVSIKNGPSPISSLEVIN 358

Query: 352 IDVGTGTLKDAMGKGFMVXXXXXXXXXFEESNEDDDV----ELPSPDYERIIKQLHICKK 407
           +DVG+GTLKD++GK F V              ED+ +    E  S DY+ I+++L   K 
Sbjct: 359 VDVGSGTLKDSLGKSFQVANVKKNIPLQSLFPEDETIYAKGEQKSFDYKNILQELQNNKN 418

Query: 408 -IENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPL 466
            I  FD IFFK L++ KEYYT+ DRF+ D   L+ ++D +F  FK +YP+ALT+LLTHPL
Sbjct: 419 DINKFDDIFFKKLNIMKEYYTEQDRFIYDQKFLSDVLDLIFSAFKKDYPRALTFLLTHPL 478

Query: 467 FPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYK 526
           FP  H + LLTK +N PRLFKQA+VTCPN+PL +LL ELF ITN ELC DI+LR+LQDY 
Sbjct: 479 FPISHTRNLLTKFRNQPRLFKQAVVTCPNLPLKELLAELFTITNGELCLDISLRILQDYT 538

Query: 527 KESIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEY 586
           ++SIK  ++ + K+DI NF++ +++++  D   + N PQ+FQL+SL++D+ GLFAL++E 
Sbjct: 539 RDSIKQELKTLSKVDIQNFIEFVIDTDSEDKS-QFN-PQLFQLLSLVLDASGLFALEEET 596

Query: 587 LEKLSSFVDAQVSVVSQNIELLHLAEHYTKHXXXXXXXXXXXXXXXXXQPISAYTVDYLE 646
           LEKLS+++D QV+V  +N  L HL +  +                   + +SAY+V+YLE
Sbjct: 597 LEKLSAYIDNQVNVAERNNRLWHLLDENSDK--RSTLNQANDQNVLQTKSLSAYSVEYLE 654

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/660 (42%), Positives = 438/660 (66%), Gaps = 26/660 (3%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60
           M S+SQ F+L+ LP++ SL+N+A QT++LQV D++ P++N++ IGIS S+ISQY++NPTP
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60

Query: 61  KLVFNLPIPSTNIVTACDVVEDAANTEVWCYGLEARKVSHLHLATK-PMIQDAVSSSNAE 119
           KLV ++PIPSTNIVTACDV   +   E+WCY L+A KV  L++A+K    ++ V+S +  
Sbjct: 61  KLVLSIPIPSTNIVTACDVAR-SDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDV- 118

Query: 120 ITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRXXXXX 179
                K K+  + V + +  K + ++V+L+NGLIQ +D++LKL +++D+SY D+      
Sbjct: 119 ----LKVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDV-SVTKF 173

Query: 180 XXXXXXXXXXXLCQLSDEKICYKLFQV---RSESVSCIELNSIILENYTLENAKLCFEFG 236
                      LC L ++K+C+KLF++       V   EL+SIILE+++L  +K+C++ G
Sbjct: 174 FTEGANDFLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKICYQSG 233

Query: 237 KLYVLKNSNELSIYQLPHLQLQTSIQLPFISKDAVVSIKPVSSNRVLLTADNTIYLVDLL 296
           +LY L   +E+ +Y LP  QL  ++ LP +    V+S+KP+SSNR+L+TADN IYL++L 
Sbjct: 234 RLYRLIG-HEVLVYALPQCQLVQAVTLPMVQGADVISMKPISSNRILVTADNKIYLLNLT 292

Query: 297 YNAILFQKDLQNIKAIQLLSTAVVQE---NSEDNRKTIALDVTTKNGANPTSYLDVINID 353
           +N+ILFQ++L ++K+ QLL +AV+     +S  N+KT  + V TK+G NPTS L+++N+D
Sbjct: 293 HNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVD 352

Query: 354 VGTGTLKDAMGKGFMVXXXXXXX------XXFEESNEDDDVELPSPDYERIIKQLHICKK 407
           VGTGTLKD++GKGF V                +   ED+D +    D+ +I + L   K+
Sbjct: 353 VGTGTLKDSLGKGFTVSNEPISQVLKPLFSDEDNEAEDEDNKFEHFDFNQIYQHLEKNKQ 412

Query: 408 -IENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPL 466
            I +FD IF + L++ +E+YT+ DRF+ D   L+ ++  +  NF++EYPKALT+LLTHPL
Sbjct: 413 SISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLLTHPL 472

Query: 467 FPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYK 526
           FP      LL++L+ +PRLFKQAIVTCPN+PL +LL+ELF+I N EL  DI+LR+LQDY 
Sbjct: 473 FPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYT 532

Query: 527 KESIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEY 586
            + IK  +RK+ K+D+ NF++ +++SN  D +   +  Q+FQL+SL++DSIGLFALD   
Sbjct: 533 TDMIKQEVRKLNKIDVQNFIEFVISSN--DENAIRSSHQLFQLLSLVLDSIGLFALDGVL 590

Query: 587 LEKLSSFVDAQVSVVSQNIELLHLAEHYTKHXXXXXXXXXXXXXXXXXQPISAYTVDYLE 646
           L++L+ ++  +V++  +N +L HL +   K                  + +  YTV+YL+
Sbjct: 591 LDRLADYIQERVAIAERNSKLCHLLD--DKQNSRGFAKSGAGSVGSTREAVPKYTVEYLD 648

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  517 bits (1331), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 284/669 (42%), Positives = 427/669 (63%), Gaps = 29/669 (4%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60
           M SI QPFRLS LP+I +L+NY  Q+DYL+V  ++SP++NK+ IGIS S+ISQY++NPTP
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60

Query: 61  KLVFNLPIPSTNIVTACDVVEDAANTEVWCYGLEARKVSHLHLATKPMIQDAV-SSSNAE 119
           KL+ N+ IPSTN+V+ACDV   A + E+WCY +++ K   L+ + KP+  D V  +   +
Sbjct: 61  KLLSNISIPSTNVVSACDVATLADDKEIWCYCVKSGKSHFLNASVKPVDADTVLDTDGGD 120

Query: 120 ITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRXXXXX 179
            T  FK K+ S+VV IKI    + ++V+L +GLIQ +D++L+  +++DISY +++     
Sbjct: 121 KTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYF 180

Query: 180 XXXXXXXXXXXLCQLSDEKICYKLFQV----RSESVSCIELNSIILENYTLENAKLCFEF 235
                      L    + K+C+KLF++            EL++ ILEN+ L+ +KLC++ 
Sbjct: 181 SENGQNFMFV-LSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQS 239

Query: 236 GKLYVLKNSNELSIYQLPHLQLQTSIQLPFI--SKDAVVSIKPVSSNRVLLTADNTIYLV 293
           GKLY L+ S  +  Y LP   L  +  LP I       VS+ PVS+NR+LLT +N +YL+
Sbjct: 240 GKLYQLEGST-IKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQVYLL 298

Query: 294 DLLYNAILFQKDLQNIKAIQLLSTAVVQ-----ENSEDNRKTIALDVTTKNGANPTSYLD 348
           DL+++++L ++ L + K  QLL +A +      + SE   +T+A+ VTTKNG NPTS L+
Sbjct: 299 DLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALE 358

Query: 349 VINIDVGTGTLKDAMGKGFMVXXXXXXXX-----XFEESNEDDDV---ELPSPDYERIIK 400
           VIN+DVGTGTLKD++GK F                 +ES+  D+    E+ +  YE I K
Sbjct: 359 VINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAFAYEDIFK 418

Query: 401 QLHIC-KKIENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALT 459
           +L    K I  FDS F K L++ +E+YTD +RF+ D + L++++  +  +F  EYP+ALT
Sbjct: 419 ELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYPRALT 478

Query: 460 YLLTHPLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITL 519
           +LLTHPLFP    +GLL + +N+PRLFKQAIVTCPN+PLDDLL+ELF+I N ELC DI+L
Sbjct: 479 FLLTHPLFPTDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISL 538

Query: 520 RVLQDYKKESIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKP--QIFQLMSLIIDSI 577
           R+LQD+  + IK  ++K+ K+D+ NF++ +++    D +L  NK   ++FQL+SL+ID+I
Sbjct: 539 RILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPK--DEELIQNKSTYELFQLLSLVIDAI 596

Query: 578 GLFALDDEYLEKLSSFVDAQVSVVSQNIELLHLAEHYTKHXXXXXXXXXXXXXXXXXQPI 637
           GLFALD   L++LS ++D QV +  +N  L +L +  T++                 Q +
Sbjct: 597 GLFALDGALLQRLSDYIDEQVYLAERNARLWNLLD--TRNKNRGATGSLAGSSRAKEQTL 654

Query: 638 SAYTVDYLE 646
             YTV+YLE
Sbjct: 655 PKYTVEYLE 663

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  512 bits (1319), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 300/717 (41%), Positives = 447/717 (62%), Gaps = 76/717 (10%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDN-LSPSANKVNIGISGSSISQYLINPT 59
           M S+SQPFRL+ LPKI SL+N++ Q DY+QV D   +   N + +GISGSSISQY+INPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVFNLPIPSTNIVTACDVVE-------DAANT------------------EVWCYGLE 94
           PKL F+ PIPSTNI+TAC+ V+       D  N+                  E+W +GL 
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHEVTNFQSKRDVEIWSFGLM 120

Query: 95  ARKVSH-LHLATKPMIQDAVSSSNAEIT----------------SQFKYKLKSEVVSIKI 137
             K ++ L++ TK  ++D   +SN  +T                SQ+K K K +V++IKI
Sbjct: 121 VNKGNYTLNVITKA-VEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKI 179

Query: 138 YSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRXXXXXXXXXXXXXXXXLCQLSDE 197
            +K   V+ +L+NGL++ +D++LKL ++ DISY +++                LC L D+
Sbjct: 180 DAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFV-LCPLEDD 238

Query: 198 KICYKLFQVR----SESVSCIELNSIILENYTLENAKLCFEFGKLYVLKNSNELSIYQLP 253
           K+CYKLF++      ES    EL+S I+E ++ E++K C++FGKLY L N  ++ +Y LP
Sbjct: 239 KVCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKL-NQGKIHVYSLP 297

Query: 254 HLQLQTSIQLPFISK----DAVVSIKPVSSNRVLLTADNTIYLVDLLYNAILFQKDLQNI 309
           H QLQ  I +P I+K    + ++S +PVS NR+LLT +NTIYL+DLL+ +IL Q++L ++
Sbjct: 298 HCQLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHV 357

Query: 310 KAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLKDAMGKGFMV 369
           +  QLL +AV+      N KTIA+ ++TKNG NPTS L++INIDVGT TLKD++GK F +
Sbjct: 358 RTFQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQI 417

Query: 370 XXXXXXXXX----FEESNE----------DDDVELPSPDYERIIKQLHICKK--IENFDS 413
                        F++ N           D ++ +P+  Y+ IIK++   K   + +FD 
Sbjct: 418 GKNDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDD 477

Query: 414 IFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFK-DEYPKALTYLLTHPLFPPVHA 472
           IFFK L + +E+YT+ DRF++DS+ L +++D +F  F  ++YPKALT+LLTHPLFP    
Sbjct: 478 IFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKALTFLLTHPLFPLNRT 537

Query: 473 KGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKA 532
             LL++L++ PRLFKQAIVTCPN+PL++LL ELF+I N EL  DI+ R+LQD+ ++SIK 
Sbjct: 538 HNLLSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQ 597

Query: 533 GIRKIEKMDITNFLDMILNSNKADSDLKLN---KPQIFQLMSLIIDSIGLFALDDEYLEK 589
            ++ + K+DI NF+D I N+++  +   LN     Q+FQL+SL++DSIGLF+L+   L+ 
Sbjct: 598 EMKNLSKLDIQNFIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDN 657

Query: 590 LSSFVDAQVSVVSQNIELLHLAEHYTKHXXXXXXXXXXXXXXXXXQPISAYTVDYLE 646
           L+S++D QV +  +N EL +L E  TK                  Q +  YT++YLE
Sbjct: 658 LASYIDKQVEIAERNTELWNLVE--TKGSQHGFTNMNSDSRTSQKQALPTYTMEYLE 712

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score =  503 bits (1294), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 293/708 (41%), Positives = 444/708 (62%), Gaps = 66/708 (9%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDN-LSPSANKVNIGISGSSISQYLINPT 59
           M S+SQPFRL+ALPKI SL+N++ Q +Y+QV D   + S N + +GISGSS+SQY+INPT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 60  PKLVFNLPIPSTNIVTACDV------VEDA------------ANTEVWCYGLEARKVSH- 100
           PKL+F+ PIPSTNI+TAC+       +ED              N E+W +GL   K ++ 
Sbjct: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120

Query: 101 LHLATKPM---------------IQDAVSSSNAEITSQFKYKLKSEVVSIKIYSKAEKVL 145
           L++ TK +               I++ V + +  + SQ+K K K++V+SIKI +K   ++
Sbjct: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180

Query: 146 VILRNGLIQTFDYELKLSNTIDISYDDIRXXXXXXXXXXXXXXXXLCQLSDEKICYKLFQ 205
            IL+NGLI+ +D++LKL ++ DISYD+++                LC L D+K+CYKL +
Sbjct: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFV-LCPLQDDKVCYKLLE 239

Query: 206 V----RSESVSCIELNSIILENYTLENAKLCFEFGKLYVLKNSNELSIYQLPHLQLQTSI 261
           +      E+    EL+S I+E ++ +++KLC++FGKLY L N  ++ +Y LPH QLQ  I
Sbjct: 240 LTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKL-NKGKIYVYSLPHCQLQQVI 298

Query: 262 QLPFIS----KDAVVSIKPVSSNRVLLTADNTIYLVDLLYNAILFQKDLQNIKAIQLLST 317
           +LP I+    +  ++S +PVS NRVLLT +N +YL+DLL+ + L Q++L ++K  QLL+T
Sbjct: 299 ELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNT 358

Query: 318 AVVQENSEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLKDAMGKGF---------- 367
           AV+      + KTIA+ ++TKNGANPTS L++INIDVGT TLKD++GK F          
Sbjct: 359 AVINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSVI 418

Query: 368 ---MVXXXXXXXXXFEESNEDDDVELPSPDYERIIKQLHICKK--IENFDSIFFKMLSLD 422
              +           + +N D D+ +P+  Y+ II +L   K   I +FD IFFK L + 
Sbjct: 419 LKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIK 478

Query: 423 KEYYTDNDRFLNDSDLLTQIIDCLFLNFK-DEYPKALTYLLTHPLFPPVHAKGLLTKLKN 481
           +E+YT+ DRF++D   L +++D +F  F  ++YPK LT+LLTHPLFP    + LL+ L++
Sbjct: 479 EEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKTLTFLLTHPLFPLDRTRNLLSLLRD 538

Query: 482 NPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKAGIRKIEKMD 541
            PRLFKQAIVTCPN+PL++LL ELF+I N EL  DI+ R+LQD+ ++SIK  ++++ K+D
Sbjct: 539 QPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLD 598

Query: 542 ITNFLDMILNSNKADSDLKLNKP---QIFQLMSLIIDSIGLFALDDEYLEKLSSFVDAQV 598
           I NF++ + ++   +S    N     Q+FQL+SL++DSIGLF+L+   LE L+S++D QV
Sbjct: 599 IQNFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTSYIDKQV 658

Query: 599 SVVSQNIELLHLAEHYTKHXXXXXXXXXXXXXXXXXQPISAYTVDYLE 646
            +  +N EL +L +   K                  Q +  YT++YL+
Sbjct: 659 KIAERNTELWNLID--IKSSQHGFTNLAFESASSQKQALPTYTMEYLD 704

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  500 bits (1287), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 299/655 (45%), Positives = 426/655 (65%), Gaps = 51/655 (7%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDN-LSPSANKVNIGISGSSISQYLINPT 59
           M S+SQPFRL+ LPKI SL+NY+ Q DY+QV  +  +P+ NKV IG+SGS+ISQY+INPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 60  PKLVFNLPIPSTNIVTACDVVEDAANTE---VWCYGLEARKVSHLHLATKPMIQDAVS-- 114
           PKL+FN PIPSTNIVTACDV+E+  +     VWC+GL A K   L L TK   + + +  
Sbjct: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSATME 120

Query: 115 -------SSNAEITSQFKYKLKSEVVSIKIYSKAE---KVLVILRNGLIQTFDYELKLSN 164
                    +  I  +F  KL S++V IKI  K      ++++L NGLIQ F+  LKL N
Sbjct: 121 DDEDVVDVIDTTIKDEFNVKLDSKIVDIKIIKKKADDISIMIVLENGLIQFFNSSLKLLN 180

Query: 165 TIDISYDDIRXXXXXXXXXXXXXXXXLCQLSDE-KICYKLFQVRSESVSCIELNSIILEN 223
           T+ I+Y +++                +C L D  K+C KLFQ+ ++S   IELNSII+EN
Sbjct: 181 TVKINYKNVKFVEHFKEDNKDFMFT-ICDLGDNNKVCIKLFQINNDS--AIELNSIIMEN 237

Query: 224 YTLENAKLCFEFGKLYVLKNSNELSIYQLPHLQLQTSIQLPFI-SKDAVVSIKPVSSNRV 282
           +  +NAK C++FGK Y L N+N L +Y LP  QL+ +  +P I + D +VS+KP+S+NR+
Sbjct: 238 FNGQNAKFCYQFGKFYKLTNNN-LMVYSLPQFQLEHTTTIPMIKTDDQIVSMKPISTNRI 296

Query: 283 LLTADNTIYLVDLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGAN 342
           LLT +N IYL+DL++N+IL +++L ++K++QLL +AV+ +  E+N KTI + V+TK G N
Sbjct: 297 LLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIGK-GENNNKTITIGVSTKFGVN 355

Query: 343 PTSYLDVINIDVGTGTLKDAMGKGF--------MVXXXXXXXXXFE---ESNEDDD---- 387
           PTS L++IN+DVG+ TLKD++GK F        +          F+   + ++DDD    
Sbjct: 356 PTSSLEIINVDVGSNTLKDSLGKCFQNLNLQNQIQISTQALKPLFDPNTDGDKDDDLFKK 415

Query: 388 -VELPSPDYERIIKQL-HICKKIENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDC 445
            V     +Y+ I+ +L      I  FD IFF+  ++ KE+YT+NDRF+ + +   ++ID 
Sbjct: 416 LVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDL 475

Query: 446 LFLNFK--------DEYPKALTYLLTHPLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVP 497
           +F  F         +EYPK LT+LLTHPLFP    + LL++  N+PRLFKQAIVTCPN+P
Sbjct: 476 IFEKFGSTATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPRLFKQAIVTCPNLP 535

Query: 498 LDDLLTELFNITNAELCFDITLRVLQDYKKESIKAGIRKIEKMDITNFLDMILNSNKADS 557
           L +LL EL  I N EL  DI+LR+LQDY K+SIK  +R + +++I NF+D ILN    D 
Sbjct: 536 LPELLNELLTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILNDEIKDD 595

Query: 558 DLKLNKPQIFQLMSLIIDSIGLFALDDEYLEKLSSFVDAQVSVVSQNIELLHLAE 612
               N PQ+FQL++L++DSIGLFAL D  LE LS+++D QVS+V +N EL +L +
Sbjct: 596 Q---NSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLID 647

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score =  497 bits (1279), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 299/718 (41%), Positives = 435/718 (60%), Gaps = 78/718 (10%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDN-LSPSANKVNIGISGSSISQYLINPT 59
           M S+SQPFRL+ LPKI SL+N++ Q DY+QV D   + S N + +GISGSSISQY+INPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVFNLPIPSTNIVTACDVVEDAAN--------------------------TEVWCYGL 93
           PKL F+ PIPSTNI+TAC+  +  AN                           E+W +GL
Sbjct: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120

Query: 94  EARKVSH-LHLATKPMIQDAVSSSNA----------------EITSQFKYKLKSEVVSIK 136
              K ++ L++ TK + +D   +SN                 E  SQ+K K K++V+SIK
Sbjct: 121 MVNKGNYTLNVITKAL-EDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIK 179

Query: 137 IYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRXXXXXXXXXXXXXXXXLCQLSD 196
           I +K   V+ IL+NGLI+ FD++L L ++ DISYD+++                LC L D
Sbjct: 180 IDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFV-LCPLQD 238

Query: 197 EKICYKLFQV----RSESVSCIELNSIILENYTLENAKLCFEFGKLYVLKNSNELSIYQL 252
           +K+CYKL ++      ES    EL+S I+E ++ EN+KLC++FGKLY L N  ++ IY L
Sbjct: 239 DKVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKL-NQGKIYIYSL 297

Query: 253 PHLQLQTSIQLPFISK----DAVVSIKPVSSNRVLLTADNTIYLVDLLYNAILFQKDLQN 308
           PH QLQ  I+ P + K    D ++S +PVS NRVLLT +N IYL+DLL+ + L Q++L +
Sbjct: 298 PHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTH 357

Query: 309 IKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLKDAMGKGFM 368
           +K  QLL +AV+      N KTIA+ ++TKNG NPTS L++INIDVGT TLKD++GK F 
Sbjct: 358 VKTFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQ 417

Query: 369 VXXXXXXXXX---FEESNEDD----------DVELPSPDYERIIKQLHICKK--IENFDS 413
           V            F++ + +D          D  +P      +I++L   +   I +FD 
Sbjct: 418 VGNNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDD 477

Query: 414 IFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFK-DEYPKALTYLLTHPLFPPVHA 472
           IFFK L + +E+YT+ DR+++D   L +++D +F  F  ++YPK LT+LLTHPLFP    
Sbjct: 478 IFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRT 537

Query: 473 KGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKA 532
           + LL+ L++ PRLFKQAIVTCPN+PL++LL ELF+I N EL  DI+ R+LQD+ ++SIK 
Sbjct: 538 RNLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQ 597

Query: 533 GIRKIEKMDITNFLDMILNSNKADSDLKLNKP----QIFQLMSLIIDSIGLFALDDEYLE 588
            ++K+ K+D+ NF++ I  S   DS  +   P    Q+FQL+SL++DSIGLF+L+   LE
Sbjct: 598 EMKKLSKLDVQNFIEFI-TSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLE 656

Query: 589 KLSSFVDAQVSVVSQNIELLHLAEHYTKHXXXXXXXXXXXXXXXXXQPISAYTVDYLE 646
            L+ ++D QV +  +N EL +L +  TK                  + +  YT++YL+
Sbjct: 657 NLTLYIDKQVEIAERNTELWNLID--TKGFQHGFASSTFDNGTSQKRALPTYTMEYLD 712

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  494 bits (1273), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 284/704 (40%), Positives = 427/704 (60%), Gaps = 65/704 (9%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVV-DNLSPSANKVNIGISGSSISQYLINPT 59
           M S+SQPFRL+ LPKI SL+NY+ QTDYLQV  D  +   NKV +GISGS ISQY+INPT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 60  PKLVFNLPIPSTNIVTACDV------VEDAANT--------------------------- 86
           PKL+FN+ IPSTN VTA ++      VE+A +T                           
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 87  ------EVWCYGLEARKVSHLHLATKPMIQDAVSSSNAEITSQFKYKLKSEVVSIKIYSK 140
                 E+W YGL A K + L+++ K    D  S++  EI  +   K+ S+VV+IKI+ +
Sbjct: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180

Query: 141 AEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRXXXXXXXXXXXXXXXXLCQLSDEK-- 198
            + ++V+L+NGL++ FD++L L +++DI+Y+D++                L  + +EK  
Sbjct: 181 FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLI-LSNIDEEKSS 239

Query: 199 ICYKLFQVR--SESVSCIELNSIILENYTLENAKLCFEFGKLYVLKNSNELSIYQLPHLQ 256
           +C+KL+Q+R  S+S    EL+  IL+++ L  +KL ++FGKLY L  S EL +Y LP  Q
Sbjct: 240 VCFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGS-ELFVYSLPQCQ 298

Query: 257 LQTSIQLPFISKDA--VVSIKPVSSNRVLLTADNTIYLVDLLYNAILFQKDLQNIKAIQL 314
           L  +I L  I  +   V SIKPV++NR++L  +N +YL+D L+ +IL +++  ++K  QL
Sbjct: 299 LLQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQL 358

Query: 315 LSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLKDAMGKGFMVXXXXX 374
           L +A + + S   ++TIA+ V+TK+G    S L++INI+VG+GTLKD++GKG        
Sbjct: 359 LQSATIGD-SNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKKLSEG 417

Query: 375 XXX----XFEESNEDDDVELPSPD--------YERIIKQLHICKKIENFDSIFFKMLSLD 422
                   F+E++E   +  P  D        + +I+  L     I +FD  FF+ L + 
Sbjct: 418 SHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADLKSSDTISDFDKTFFESLEIK 477

Query: 423 KEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPLFPPVHAKGLLTKLKNN 482
           + +YT+NDRF++D D +   ID +F  F  E+PKA T+LLTHPLFP     GLL KLK++
Sbjct: 478 ENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLDKLKDH 537

Query: 483 PRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKAGIRKIEKMDI 542
           PRLFKQAIVTCPN+PL +LL +LF + N EL  DI+LRVLQDY +  +K  I+K++ +DI
Sbjct: 538 PRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNVDI 597

Query: 543 TNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEYLEKLSSFVDAQVSVVS 602
            NF++ I+       +++ N PQ+FQL+SL++DSIGLFAL    LE+LS++++ QV++  
Sbjct: 598 ENFIEFII--TPTTEEIQTNTPQLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIAE 655

Query: 603 QNIELLHLAEHYTKHXXXXXXXXXXXXXXXXXQPISAYTVDYLE 646
           ++ EL HL +  T                   + +S Y+VDYL+
Sbjct: 656 RSSELWHLLD--TSTTPRPFKNAYLKSVIGNKETLSVYSVDYLD 697

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  493 bits (1270), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 294/716 (41%), Positives = 435/716 (60%), Gaps = 74/716 (10%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDN-LSPSANKVNIGISGSSISQYLINPT 59
           M S+SQPFRL+ LPKI SL+N++ Q DY+QV D   + S N + +GISGSSISQY+INPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVFNLPIPSTNIVTACDVVE--------------------DAANT------EVWCYGL 93
           PKL F+ PIPSTN++TAC   E                     AAN+      E+W +G 
Sbjct: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120

Query: 94  EARKVSHLHLATKPMIQDAVSSSNAEIT----------------SQFKYKLKSEVVSIKI 137
              K ++    T  M++   ++SN  +                 SQ K K K++V++IKI
Sbjct: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180

Query: 138 YSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRXXXXXXXXXXXXXXXXLCQLSDE 197
            +K   ++ +L+NGLI+ +D +LKL  + DISYD+++                LC L D+
Sbjct: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFV-LCPLEDD 239

Query: 198 KICYKLFQV---RSESVSCI-ELNSIILENYTLENAKLCFEFGKLYVLKNSNELSIYQLP 253
           K+CYK+ ++    S+  S I EL+S I+E ++ E++KLC++FGKLY L N  ++ +Y LP
Sbjct: 240 KVCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKL-NQGKIYVYSLP 298

Query: 254 HLQLQTSIQLPFISK----DAVVSIKPVSSNRVLLTADNTIYLVDLLYNAILFQKDLQNI 309
           H QLQ  I+LP I+K    D ++S +PVS NR+LLT +N IYL+DLL+ +IL  ++L ++
Sbjct: 299 HCQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHV 358

Query: 310 KAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLKDAMGKGFMV 369
           K  QLL +A++      N KTIA+ ++TKNG NPTS L++INIDVGT TLKD++GK F V
Sbjct: 359 KTFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQV 418

Query: 370 XXXXXXX-------------XXFEESNEDDDVELPSPDYERIIKQLHICKK--IENFDSI 414
                                  + ++ D ++ +P   Y+ +I++L + K   I +FD I
Sbjct: 419 GKNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEI 478

Query: 415 FFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFK-DEYPKALTYLLTHPLFPPVHAK 473
           FF  L + +E+YT+ DRF++D   L +++D +FL F  ++YPKALT+LLTHPLFP     
Sbjct: 479 FFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKALTFLLTHPLFPLNRTH 538

Query: 474 GLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKAG 533
           GLL+ L++ PRLFKQAIVTCPN+PL++LL ELF+I N EL  DI+ RVLQD+ ++SIK  
Sbjct: 539 GLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTRDSIKQE 598

Query: 534 IRKIEKMDITNFLDMILNSNKADSDLKLN---KPQIFQLMSLIIDSIGLFALDDEYLEKL 590
           ++K+ K+DI NF++ I N+ +       N     Q+FQL+SL++DSIGLF+L+   LE L
Sbjct: 599 MKKLSKLDIQNFIECITNTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGALLENL 658

Query: 591 SSFVDAQVSVVSQNIELLHLAEHYTKHXXXXXXXXXXXXXXXXXQPISAYTVDYLE 646
           + ++D QV +  +N EL +L +   K                  Q + AY ++YL+
Sbjct: 659 TLYIDKQVKIAERNTELWNLID--IKGSQHGFATLSSGSTTSQKQALPAYAMEYLD 712

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  487 bits (1254), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 275/665 (41%), Positives = 416/665 (62%), Gaps = 33/665 (4%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60
           M S+SQPFRL+ LPKI  L++Y  Q+  LQV D+ +  +NK+ IG+SG ++SQY+INPTP
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60

Query: 61  KLVFNLPIPSTNIVTACDVVE-DAANTE----VWCYGLEARKVSHLHLATKPMIQDAVSS 115
            +   +PIPSTN VTAC+V +   A+TE    +W Y L   K + LH+A K +  D  S+
Sbjct: 61  NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFST 120

Query: 116 SNAEITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRX 175
           + ++    +  K  + VV IKI  + + ++V L NG IQ FD++LKL N+++ SYD+I  
Sbjct: 121 TQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNI-Y 179

Query: 176 XXXXXXXXXXXXXXXLCQLSDEKICYKLFQVRSESVSCI-ELNSIILENYTLENAKLCFE 234
                          L  +   K+ YKL+++  +  + I EL+S ILE+   +++K+ ++
Sbjct: 180 FSEHFVENKKSFAIILSTIEGNKLSYKLYELFGQDKTSIKELSSTILEDIQCKDSKISYQ 239

Query: 235 FGKLYVLKNSNELSIYQLPHLQLQTSIQLPFI--SKDAVVSIKPVSSNRVLLTADNTIYL 292
           FGKLY L   N++ +Y LP  QL  +I LP I   K   +S KPVS+NR+LLT DN I++
Sbjct: 240 FGKLYRLY-KNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFI 298

Query: 293 VDLLYNAILFQKDLQNIKAIQLLSTAVVQEN-SEDNRKTIALDVTTKNGANPTSYLDVIN 351
           +DL++ A L ++ L ++K  QLL + V++ N + +N KTIA+ V+ KNG +P + L++IN
Sbjct: 299 LDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIIN 358

Query: 352 IDVGTGTLKDAMGKGFMVXXXXXXXXXFEESNEDDD-VELPSPDYERIIKQLHICKK-IE 409
            +VGTGTLKD++G  F V              +D + V+     YE I+K+L   +  I+
Sbjct: 359 ANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLVKRHDFKYEAILKKLSSTENDIK 418

Query: 410 NFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPLFPP 469
            FD IFF  L + + YYTDN+RF+ D   L+ +ID +F NF+ EYP ALT+LLTHPLFP 
Sbjct: 419 KFDDIFFGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLLTHPLFPI 478

Query: 470 VHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKES 529
              K LL KL+ +PRLFKQA+VTCPN+P+D+LLTELF+ITN EL  DI+LR+LQDY K+S
Sbjct: 479 HQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDS 538

Query: 530 IKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEYLEK 589
           IK  ++ + K+DI NF+D +++ N  +   K +  Q+F L+SL++D+ GLF+++   L +
Sbjct: 539 IKLELKNLNKIDIQNFIDFVIDPNNEEE--KKHNEQLFVLLSLVLDASGLFSIEGPLLTQ 596

Query: 590 LSSFVDAQVSVVSQNIELLHLAE--------HYTKHXXXXXXXXXXXXXXXXXQPISAYT 641
           LS ++D QV ++ ++ +L HL +        HY                    + ++AY+
Sbjct: 597 LSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHY----------QTSGATVPEIKALTAYS 646

Query: 642 VDYLE 646
           V+YLE
Sbjct: 647 VEYLE 651

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  485 bits (1249), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 261/654 (39%), Positives = 421/654 (64%), Gaps = 50/654 (7%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60
           M S+SQPFRL+ LPKI SL+N++ +  Y++V D+ +P +N V +GISGSSIS+Y+I PTP
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDSNSVLLGISGSSISKYVITPTP 60

Query: 61  KLVFNLPIPSTNIVTACDV------------------------------VEDAANTEVWC 90
           +L+FN+PIPST++V+AC++                              VE+  + E+WC
Sbjct: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIWC 120

Query: 91  YGLEARKVSHLHLATKPMIQDAVSSSNAEITS---QFKYKLKSEVVSIKIYSKAEKVLVI 147
           Y L A   +H    T   +   V ++N  IT    QF  K K ++++I++ +K + ++++
Sbjct: 121 YALSANNKTH----TLNCLIREVDNNNTSITENNPQFNAKFKEQIINIEVDTKHKVIVIL 176

Query: 148 LRNGLIQTFDYELKLSNTIDISYDDIRXXXXXXXXXXXXXXXXLCQLSDEKICYKLFQVR 207
              GL+Q +D +LKL N+I+  Y DI+                +  L D+K+  +L++V 
Sbjct: 177 FETGLVQFYDLQLKLLNSINTPYRDIK-IVKTFEENGLEYMLLISDLKDQKVALQLYEVS 235

Query: 208 SESVSCIELNSIILENYTLENAKLCFEFGKLYVLKNSNELSIYQLPHLQLQTSIQLPFIS 267
           +E     EL S I+EN+ L+++ LC++FG++Y L   +E+ +Y +P LQL + +++PF+S
Sbjct: 236 TEEKKVKELTSSIIENFNLQDSLLCYQFGRIYRLF-KDEIEVYSIPSLQLNSKVKIPFLS 294

Query: 268 ----KDAVVSIKPVSSNRVLLTADNTIYLVDLLYNAILFQKDLQNIKAIQLLSTAVVQEN 323
               K+ ++S+KP+++NRVLLT  N IYL+DLL+ +IL ++++ ++K  Q+L TA+ ++ 
Sbjct: 295 EIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAMNRDG 354

Query: 324 SEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLKDAMGKGFMVXXXXXXXXXFEESN 383
           SE ++ T+AL ++TKNG NPTS L++INIDVG+ +LKD++GK F+           +   
Sbjct: 355 SE-SKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFL-RRNNQIQGQLKNLF 412

Query: 384 EDDDVELPSPDYERIIKQLHICKKIENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQII 443
            +   ELPS ++  I+ +L      E FD  FF +L++ +E +T+N RFLND   L  ++
Sbjct: 413 PEPKYELPSINFPEILGKLKNANSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLASVL 472

Query: 444 DCLF--LNFKDEYPKALTYLLTHPLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDL 501
           D +F  +++    P++L +LLTHPLFP   A GLLTK+K+N RLFKQAIVTCPN+PL +L
Sbjct: 473 DLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCPNLPLQEL 532

Query: 502 LTELFNITNAELCFDITLRVLQDYKKESIKAGIRKIEKMDITNFLDMIL---NSNKADSD 558
           L ELF I N+EL  DI++R+LQDY K++IK  I+K++++ + NF++ I+   N   A SD
Sbjct: 533 LQELFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREAAVSD 592

Query: 559 LKLNKPQIFQLMSLIIDSIGLFALDDEYLEKLSSFVDAQVSVVSQNIELLHLAE 612
             +  PQIF+L+SLI+DSIGLF L++  L +LSS ++ +V +  +N+EL ++ +
Sbjct: 593 FTMFTPQIFKLLSLILDSIGLFGLEESILIQLSSIIEKEVKIAERNVELWNIMD 646

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  353 bits (906), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 185/376 (49%), Positives = 253/376 (67%), Gaps = 5/376 (1%)

Query: 272 VSIKPVSSNRVLLTADNTIYLVDLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTI 331
           +S  P+S NR LLT DN +YL+DLL+NAIL Q++  ++K  QLL TAV+  NS  N  TI
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60

Query: 332 ALDVTTKNGANPTSYLDVINIDVGTGTLKDAMGKGFMVXXXXXXXXXFEESNEDDDVELP 391
           A+ V TK G   TS LDV+NIDVGTGTLKD+MGKGF+                 +D E+ 
Sbjct: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQ-SLLGTPNDTEVQ 119

Query: 392 SPDYERIIKQLHICKK-IENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNF 450
             +Y +I+K L   K   + FDS+FFK L++  +YYTD+DRFLND + L   +  +F NF
Sbjct: 120 EHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIFENF 179

Query: 451 KDEYPKALTYLLTHPLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITN 510
           + EYPKALTYLLTHPLFP      LL KLK++PRLFKQAIVTCPN+PL DLL ELF + N
Sbjct: 180 QSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFTVIN 239

Query: 511 AELCFDITLRVLQDYKKESIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLM 570
            ELC D++LR+LQD+ K+SIK  I++  K+D+  F++ ++N N  D D   NKP++FQL+
Sbjct: 240 DELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNEN-VDEDRVKNKPRLFQLL 298

Query: 571 SLIIDSIGLFALDDEYLEKLSSFVDAQVSVVSQNIELLHLAEHYTKHXXXXXXXXXXXXX 630
           +L++DS+GLFAL+DE L+KLS+++D Q+SVV QN++L +L +   ++             
Sbjct: 299 NLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDE--RNFKNILGQHHADSL 356

Query: 631 XXXXQPISAYTVDYLE 646
                 I+AY+V+ LE
Sbjct: 357 SVGEGAITAYSVEQLE 372

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  289 bits (740), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 214/645 (33%), Positives = 328/645 (50%), Gaps = 102/645 (15%)

Query: 2   ASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTPK 61
           ASISQPF ++ +P+       A+QT  L    +L+ +AN +++ +S  SISQY+INPTPK
Sbjct: 3   ASISQPFTIANVPR------QASQTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56

Query: 62  LVFNLPIPSTNIVTACD--VVEDAANTEVWCYGLEARKVSHLHLATKPMIQDAVSSSNAE 119
           LV +  IPS   VTA D  V    +N + +C  L+    SH                   
Sbjct: 57  LVNSKAIPSNLTVTAFDNGVYATQSNNKSFCLYLDE---SH------------------- 94

Query: 120 ITSQFKYKLKSEVV---SIKIYSKAEKVLVILRNGLIQ-------TFDYELKLSNTIDIS 169
                +  LKS VV   S KI+ ++     IL++G +Q        F   L L +   + 
Sbjct: 95  -----QIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQKYKGGEQVFAKHLPLKDIKQVE 149

Query: 170 YDDIRXXXXXXXXXXXXXXXXLCQLSDEKICYKLFQVRSESVSCIELNSIILENYTLENA 229
           + D +                L   +     Y+L  +    VS     ++  E +     
Sbjct: 150 FIDGQYA--------------LIVAAQSTALYELENLTELRVST----TLHFEQF----K 187

Query: 230 KLCFEFGKLYVLK-NSNELSIYQLPHLQLQTSIQLPFIS--KDAVVSIKPVSSNRVLLTA 286
           ++    GK+Y     +N+  I++L  L     + +PF+S  K A ++   V  +RV L  
Sbjct: 188 QIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRVCLAL 247

Query: 287 DNTIYLVDLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSY 346
            N IYL+DL   ++L       +K ++L++ A       D    IAL    ++ A     
Sbjct: 248 ANEIYLLDLHLGSVLSHNKFAQLKQVELIAGA------RDGSFAIALSHGPQDNA---VS 298

Query: 347 LDVINIDVGTGTLKDAMGKGFMVXXXXXXXXXFEESNEDDDVELP-----------SPDY 395
           LD+IN+++G+ ++KD++GKGF            E  + +  V L            S DY
Sbjct: 299 LDIINLELGSRSIKDSLGKGFATFMK-------ERRSAESQVTLRPILDAGDKTKRSFDY 351

Query: 396 ERIIKQLHICKK-IENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDE- 453
             I+K+L    K    FD IFFK L + +E YT+ DRF+ D + L++ +  +  N+  E 
Sbjct: 352 ASILKKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEP 411

Query: 454 ---YPKALTYLLTHPLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITN 510
              YP A TYLLTHPLFP    + LL+K+K  PRL+KQ IVTCPN+PLD+LLTE F I N
Sbjct: 412 SSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIEN 471

Query: 511 AELCFDITLRVLQDYKKESIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLM 570
            EL  D++L++LQDY K+SIK  ++ + ++++TNF+  ++ +     +  +  PQ+FQL+
Sbjct: 472 NELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLL 531

Query: 571 SLIIDSIGLFALDDEYLEKLSSFVDAQVSVVSQNIELLHLAEHYT 615
           SL+IDSIGLFALD E L +L+ ++D  V +   N EL +L E  T
Sbjct: 532 SLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRT 576

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  278 bits (710), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 212/644 (32%), Positives = 344/644 (53%), Gaps = 103/644 (15%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60
           M SISQPF ++ +PK       ++ +  +    +L+ ++N +++ IS  ++S+++INPTP
Sbjct: 1   MPSISQPFAITTVPK------QSSTSPIIVSSHSLTANSNSLDVAISKYAVSKFVINPTP 54

Query: 61  KLVFNLPIPSTNIVTACDVVEDAANTEVWCYGLEARKVSHLHLATKPMIQDAVSSSNAEI 120
           KL+ ++PIPS  +VTA        +  V+      +K + LHL  K              
Sbjct: 55  KLINSIPIPSNEVVTAF-------HDTVFATATVNQKYT-LHLNGK-------------- 92

Query: 121 TSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRXXXXXX 180
               K  ++S++  +K++S   + + IL NG I+ +D     SN I  +Y          
Sbjct: 93  ----KVPIQSKI--MKLFSDESQTITILENGTIEKYD-----SNLIKSTY---------- 131

Query: 181 XXXXXXXXXXLCQLSDEKICYKLFQVRSESVSCIELNSII-LENYTLENAKLCFEF---- 235
                     L  +   +  Y L  +   S+S  ++N++I L N       +  +F    
Sbjct: 132 ----KTPHKDLVNVEFIESKYALL-ISQNSISLYDINTMIELRNVANVQDIVDSDFKSLD 186

Query: 236 GKLYVLKNS-NELSIYQLPHLQLQTSIQLPFIS--KDAVVSIKPVSSNRVLLTADNTIYL 292
           GKLY      ++  I+++  + +   I +PFI+  +  VVS   V  N V++  ++TIY 
Sbjct: 187 GKLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYA 246

Query: 293 VDLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINI 352
           ++L  ++++   +L N+K  +L+           N+  + L    +N        ++IN+
Sbjct: 247 LNLHLSSVISMSELLNLKWFKLIDNL-------SNQFVLGLSFNNENYK-----FELINL 294

Query: 353 DVGTG-TLKDAMGKGF-------------MVXXXXXXXXXFEE---SNEDDDVELPSPDY 395
           D+ +   LKD++GKGF             +V          +E   ++ D DVE  + +Y
Sbjct: 295 DLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVE-HTFNY 353

Query: 396 ERIIKQLH-ICKKIENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFK--- 451
           ++II  L+   K    FD IFF+  ++ KE+YT+ DRFL + D L ++I+ +  N+K   
Sbjct: 354 DKIIVDLNKAVKNPSKFDKIFFEKFNIKKEHYTEADRFLVNQDFLAKVIELILQNYKFDT 413

Query: 452 --DEYPKALTYLLTHPLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNIT 509
             + YPK LTYLLTHPLFP    K LL K + +PRL+KQAIVTCPN+PL +LL +LF I 
Sbjct: 414 DGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIE 473

Query: 510 NAELCFDITLRVLQDYKKESIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQL 569
           N EL  DI+LRVLQDY K+SIK  I+ + K+DI NF++ +      D D +++  Q+FQL
Sbjct: 474 NNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFV----TQDEDQQVSS-QLFQL 528

Query: 570 MSLIIDSIGLFALDDEYLEKLSSFVDAQVSVVSQNIELLHLAEH 613
           +SLIIDSIGLFALD + L ++S+F++ +  V  QN ELLHL ++
Sbjct: 529 LSLIIDSIGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDY 572

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  195 bits (496), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 100/213 (46%), Positives = 133/213 (62%), Gaps = 8/213 (3%)

Query: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60
           M SISQPFRL+ALPKI SLNNYA Q  YLQV D L+P+ N+VN+GISGS+ISQY+INPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVADTLTPATNRVNVGISGSAISQYVINPTP 60

Query: 61  KLVFNLPIPSTNIVTACDVVEDAANT--------EVWCYGLEARKVSHLHLATKPMIQDA 112
           KLV+NLPI STN+VTACDV E A           EV CY L+A K   +    KP+   A
Sbjct: 61  KLVYNLPISSTNVVTACDVAEVAGTNNEGTAEAHEVLCYALQANKTFSICAVKKPIPSAA 120

Query: 113 VSSSNAEITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDD 172
             SS  E  +  K  L ++ V++K++   + ++ +L +GLIQ FDY+LKL ++ID SY +
Sbjct: 121 TDSSFGETYATHKVALANQAVNVKVFPATKSIVAVLSSGLIQFFDYDLKLQHSIDSSYGN 180

Query: 173 IRXXXXXXXXXXXXXXXXLCQLSDEKICYKLFQ 205
           ++                L  L   K+ +KL +
Sbjct: 181 VQFVQHFVSESKQDFMFLLSDLDGRKVSFKLLK 213

>Smik_16.448 Chr16 (764670..769280) [4611 bp, 1536 aa] {ON} YPR184W
            (REAL)
          Length = 1536

 Score = 35.0 bits (79), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query: 88   VWCYGLEARKVSHLHLATKPMIQDAVSSS-NAEITSQFKYKLKS--EVVSIKIYS 139
            VW YG   R   H H  T P  Q+A     ++ +  Q  Y+LK   E +S  ++S
Sbjct: 1440 VWLYGYFLRAFHHFHFKTSPRCQNAAKEKPSSYLYQQLYYRLKGNREWISNSVWS 1494

>TDEL0F04400 Chr6 complement(825031..830097) [5067 bp, 1688 aa] {ON}
           Anc_8.313 YDR141C
          Length = 1688

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 16/96 (16%)

Query: 51  ISQYLINPTPKLVFNLPIPSTNIVTACDVVEDAANTEVWCYGLEARKVSHLHLATKPMIQ 110
           + ++L+  TP+  F +P+ S+ I T      D  N+EV        K+S  +      + 
Sbjct: 525 LCRHLLEKTPERAF-VPLESSEIRT-----NDEHNSEV------LEKISKFYCR----VS 568

Query: 111 DAVSSSNAEITSQFKYKLKSEVVSIKIYSKAEKVLV 146
           D  +S NAE +S       S V+S++I+S A K+L+
Sbjct: 569 DPATSQNAEKSSNQTAPFDSHVLSLQIFSHAYKLLI 604

>YLR060W Chr12 (260979..262766) [1788 bp, 595 aa] {ON}  FRS1Beta
           subunit of cytoplasmic phenylalanyl-tRNA synthetase,
           forms a tetramer with Frs2p to generate active enzyme;
           able to hydrolyze mis-aminoacylated tRNA-Phe, which
           could contribute to translational quality control
          Length = 595

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 56/119 (47%), Gaps = 18/119 (15%)

Query: 62  LVFNLPIPSTNIVTACDVVEDAANTEVWCYGL----EARKVSHLHLATKPMIQDAVSSSN 117
           L  ++P+   +I+ ACD++EDAA      YG     +  K+S+ +   KP+  + VS   
Sbjct: 338 LHVDIPVTRPDILHACDIMEDAA----VGYGFNNLPKGEKLSNANFIAKPLPINKVSDIF 393

Query: 118 AEITSQFKYKLKSEVVSIKIYSKAE--KVLVILRNGLIQTFDYELKLSNTIDISYDDIR 174
              +SQ  +    EV+ + + S  E  K L    NG     D  +KL+N   + Y  +R
Sbjct: 394 RVASSQATW---VEVLPLTLCSHDENFKFLRQSDNG-----DLAVKLANPKTLEYQVVR 444

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,544,963
Number of extensions: 3016166
Number of successful extensions: 10192
Number of sequences better than 10.0: 49
Number of HSP's gapped: 10390
Number of HSP's successfully gapped: 51
Length of query: 647
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 531
Effective length of database: 40,180,143
Effective search space: 21335655933
Effective search space used: 21335655933
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)