Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E04643g3.490ON22122111541e-162
Ecym_12393.490ON1931922532e-26
KLTH0F14784g3.490ON1951912507e-26
SAKL0F02816g3.490ON1921912498e-26
Kwal_55.212263.490ON1961922402e-24
TDEL0D055803.490ON1931922323e-23
AFR308W3.490ON1921882306e-23
YGR129W (SYF2)3.490ON2152122116e-20
ZYRO0D10032g3.490ON2092052054e-19
NCAS0E008203.490ON2021962011e-18
Suva_7.4173.490ON2122101968e-18
Kpol_480.153.490ON2071941951e-17
Skud_7.4403.490ON2132101899e-17
Smik_6.2253.490ON2132121853e-16
NDAI0G009503.490ON2132061845e-16
TBLA0C044703.490ON2222151696e-14
CAGL0I10538g3.490ON2001951616e-13
KNAG0B008203.490ON2071891573e-12
TPHA0D042403.490ON2092111161e-06
KAFR0C019503.490ON157184860.006
Kwal_55.221313.11ON94172760.28
NDAI0A05500singletonON24857720.71
ABR144C5.29ON23163672.9
KLLA0F06160g6.308ON859133683.0
Kwal_23.5216singletonOFF17634654.9
NDAI0H03260singletonON286121655.8
NCAS0G035401.530ON41064649.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E04643g
         (221 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...   449   e-162
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...   102   2e-26
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...   100   7e-26
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...   100   8e-26
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...    97   2e-24
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....    94   3e-23
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    93   6e-23
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...    86   6e-20
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...    84   4e-19
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    82   1e-18
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...    80   8e-18
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    80   1e-17
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...    77   9e-17
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...    76   3e-16
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    75   5e-16
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    70   6e-14
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    67   6e-13
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    65   3e-12
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    49   1e-06
KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.49...    38   0.006
Kwal_55.22131 s55 complement(1123160..1125985) [2826 bp, 941 aa]...    34   0.28 
NDAI0A05500 Chr1 complement(1242145..1242891) [747 bp, 248 aa] {...    32   0.71 
ABR144C Chr2 complement(671713..672408) [696 bp, 231 aa] {ON} Sy...    30   2.9  
KLLA0F06160g Chr6 (598549..601128) [2580 bp, 859 aa] {ON} simila...    31   3.0  
Kwal_23.5216 s23 (1064728..1065258) [531 bp, 176 aa] {OFF} [cont...    30   4.9  
NDAI0H03260 Chr8 complement(782589..783449) [861 bp, 286 aa] {ON}      30   5.8  
NCAS0G03540 Chr7 complement(662949..664181) [1233 bp, 410 aa] {O...    29   9.7  

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score =  449 bits (1154), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 221/221 (100%), Positives = 221/221 (100%)

Query: 1   MNILRYLPGDRKCSPYLNATNHIVNWTQADNKYSKMNDLMEIEKKLKSLRKQKVEVSIRN 60
           MNILRYLPGDRKCSPYLNATNHIVNWTQADNKYSKMNDLMEIEKKLKSLRKQKVEVSIRN
Sbjct: 1   MNILRYLPGDRKCSPYLNATNHIVNWTQADNKYSKMNDLMEIEKKLKSLRKQKVEVSIRN 60

Query: 61  KKAIIAEEKKNSERRVYSMADDGEDKARSNKSEPEDPIKLANYSIREYEKWEAKTQNSRH 120
           KKAIIAEEKKNSERRVYSMADDGEDKARSNKSEPEDPIKLANYSIREYEKWEAKTQNSRH
Sbjct: 61  KKAIIAEEKKNSERRVYSMADDGEDKARSNKSEPEDPIKLANYSIREYEKWEAKTQNSRH 120

Query: 121 NKSVMGDFQTIAKNSYKKEVDALPKDISHPLKGGITEDGKVQVEDNPELVEKMVNDLNER 180
           NKSVMGDFQTIAKNSYKKEVDALPKDISHPLKGGITEDGKVQVEDNPELVEKMVNDLNER
Sbjct: 121 NKSVMGDFQTIAKNSYKKEVDALPKDISHPLKGGITEDGKVQVEDNPELVEKMVNDLNER 180

Query: 181 SKKRYMVRKQKLDKQNKINLDDGFINDKNKRFNAKLNSEFK 221
           SKKRYMVRKQKLDKQNKINLDDGFINDKNKRFNAKLNSEFK
Sbjct: 181 SKKRYMVRKQKLDKQNKINLDDGFINDKNKRFNAKLNSEFK 221

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score =  102 bits (253), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 112/192 (58%), Gaps = 12/192 (6%)

Query: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKKNSER---RVYSMADDGEDKARSNKSEP 94
           D+ +I  +L+ L+ ++V++SI+N+K I++EE     R    VYS+ D+G        +  
Sbjct: 2   DIDDISSRLRRLKSKRVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTSN 61

Query: 95  EDPIKLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKDI---SHPL 151
            +  KL NYS+ +YEKW+ K + +  + +  GD   IA ++YK E+  L K         
Sbjct: 62  TERRKLLNYSLIDYEKWDEKEKQANFDGTYSGD---IAYSTYKNEIKQLRKGGLTKGKIT 118

Query: 152 KGGITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLD--KQNKINLDDGFINDKN 209
           KG I+E GKV +ED  ELV K+   L + S++R++  K++LD  K N   L + F+N+KN
Sbjct: 119 KGRISESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGN-FVNEKN 177

Query: 210 KRFNAKLNSEFK 221
           + FN KL+ +FK
Sbjct: 178 RHFNEKLSRQFK 189

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score =  100 bits (250), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 66/191 (34%), Positives = 111/191 (58%), Gaps = 9/191 (4%)

Query: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKKNSERR---VYSMADDGEDKARSNKSEP 94
           DL +   +LK+L+++ V +S++NK+ I+ EEK+ S R    VYSM    E+   S  +E 
Sbjct: 2   DLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMK--TEEAPSSETTEE 59

Query: 95  EDPIKLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKD----ISHP 150
               KL  YS++++E+W+ K +      S +  +Q +AK +Y KEV  L K+    +  P
Sbjct: 60  SKEAKLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEKP 119

Query: 151 LKGGITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDKNK 210
            K  I + GK+ V+D+P LV  + + LN+ + +RY   ++K+ +Q   +   GFIN+KNK
Sbjct: 120 KKVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFINEKNK 179

Query: 211 RFNAKLNSEFK 221
           +FN K+  + K
Sbjct: 180 QFNDKIERQTK 190

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score =  100 bits (249), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 118/191 (61%), Gaps = 12/191 (6%)

Query: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKKNSER---RVYSMADDGEDKARSNKSEP 94
           DL ++  KLK L+++ V+VS++N+K    EEK+  +    +VYSM    ED+   ++ E 
Sbjct: 2   DLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSM---NEDETFKDQKEE 58

Query: 95  EDPIKLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKDIS----HP 150
           +   KL NYSI++YEKW+ K + ++   S     Q +AK +Y KE+  + KD S      
Sbjct: 59  DTRGKLLNYSIKDYEKWQLK-RTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKV 117

Query: 151 LKGGITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDKNK 210
            K  +   G++Q+ D+ + +E++ ++LN+ +K+RY+ RK++ +K +  +   GFINDKNK
Sbjct: 118 TKARLNGKGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDS-STTGGFINDKNK 176

Query: 211 RFNAKLNSEFK 221
           +FN KL+ +FK
Sbjct: 177 QFNEKLSRQFK 187

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score = 97.1 bits (240), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 111/192 (57%), Gaps = 11/192 (5%)

Query: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKKNSERR---VYSM-ADDGEDKARSNKSE 93
           DL +   +LK+L+++++++S++NK  +I EEK  S  R   VYSM A+  E++   + +E
Sbjct: 2   DLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVTE 61

Query: 94  PEDPIKLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPK----DISH 149
                KL  YS+ EYE+W+ K + + H       FQ +AK++Y KEV  L K     ++ 
Sbjct: 62  AN---KLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGNRVNK 118

Query: 150 PLKGGITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDKN 209
             K  +   GK+ VED+ +LV  +V  LN+ + +RY   ++K+ +Q       G+IN+KN
Sbjct: 119 NTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYINEKN 178

Query: 210 KRFNAKLNSEFK 221
           K+FN KL  + K
Sbjct: 179 KQFNDKLERQTK 190

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score = 94.0 bits (232), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 113/192 (58%), Gaps = 12/192 (6%)

Query: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKKNSER-----RVYSMADDGEDKARSNKS 92
           DL  IE + K L+K+ V+V+I+ +K  IAE +   E      ++YSM D  E   R   S
Sbjct: 2   DLESIENRFKDLKKRSVDVAIQIRK--IAEREAKDESLVGKPKIYSMEDTNEMGTRPVDS 59

Query: 93  EPEDPIKLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKDISHPLK 152
                +KL NYS+REYE+W+ K Q  +  K    + Q +AK SY+K++    ++  + + 
Sbjct: 60  SERRRLKLMNYSMREYEEWDKK-QKGKEVKRGGANVQELAKYSYEKDLSRSKQNNGNRV- 117

Query: 153 GGITEDGK---VQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDKN 209
             I+ D K   +QV+D+ +LV K+ NDL + +++R++ RK+ ++K +      G+IN+KN
Sbjct: 118 VKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYINEKN 177

Query: 210 KRFNAKLNSEFK 221
           K+FN KL+ + K
Sbjct: 178 KQFNLKLDRQMK 189

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 93.2 bits (230), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 67/188 (35%), Positives = 112/188 (59%), Gaps = 11/188 (5%)

Query: 41  EIEKKLKSLRKQKVEVSIRNKKAIIAEEKKN---SERRVYSMADDGEDKARSNKSEPEDP 97
           +I ++L+ L+K++V+ SIRN+K   +EE+      + RVYSMA++  D+A ++ ++ E  
Sbjct: 5   DINRRLRQLKKKRVDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADDTQSEQ- 63

Query: 98  IKLANYSIREYEKWEAKTQNSRHNKSVMG-DFQTIAKNSYKKEVDALPKDI---SHPLKG 153
           +KL NY I +YEKW+ K +  RH +   G D   +A ++Y+ E+  L +          G
Sbjct: 64  LKLLNYRIADYEKWDEKQK--RHKQPSDGADLGELANSTYRSELHQLHRRGVVKGRATNG 121

Query: 154 GITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDKNKRFN 213
            I+  GKV ++D PELVEK+   + + +K+R+  R++K  K        G +NDKN+ FN
Sbjct: 122 RISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGG-RATAGSLNDKNRHFN 180

Query: 214 AKLNSEFK 221
            KL+ EF+
Sbjct: 181 EKLDREFR 188

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score = 85.9 bits (211), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 111/212 (52%), Gaps = 29/212 (13%)

Query: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAI---IAEEKKNSERRVYSMAD-DGEDKARSNKSE 93
           D  ++++KLK L++++V+VSI+++K     I E   N + RVYSM D +  D++  +   
Sbjct: 2   DFYKLDEKLKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTES 61

Query: 94  PEDPIKLANYSIREYEKWEAKTQNSRHNKSVMG--DFQTIAKNSYKKEVDALPKDISH-- 149
           PE   K  +Y+++EY+ WE +    +  +S  G   +  +AK SY+K +  L     +  
Sbjct: 62  PEKE-KAFHYTVQEYDAWERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSS 120

Query: 150 --------------PLKGGI------TEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRK 189
                         P KG I      T+ GK+ + D+ +LV K+   L   SKKRY  RK
Sbjct: 121 KQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARK 180

Query: 190 QKLDKQNKINLDDGFINDKNKRFNAKLNSEFK 221
           +++     +   + FINDKNK+FN KL+ E K
Sbjct: 181 RQMQNAKTLYGVESFINDKNKQFNEKLSRESK 212

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score = 83.6 bits (205), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 111/205 (54%), Gaps = 33/205 (16%)

Query: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKK---NSERRVYSMADDGEDKARSNKSEP 94
           DL +  K   +L+K+  E+S+ N+K + AE K+     + RVY +             EP
Sbjct: 12  DLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLE----------APEP 61

Query: 95  EDPIK-------LANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKDI 147
             P +       L NY+I++YE+W ++ Q  + NK   G+ Q +AK +Y KE++ L KD 
Sbjct: 62  SLPTQDDKHGNQLMNYTIQQYEEWNSR-QRDQTNKRDSGNLQDMAKYTYDKELNKLHKDT 120

Query: 148 ---SHPLKGGITE-------DGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNK 197
              +    GG  +        GK+ ++D+ +LV+K+  D+++ + +RY  R++++++ N 
Sbjct: 121 MLQNRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNV 180

Query: 198 INLDD--GFINDKNKRFNAKLNSEF 220
            N     G+IN+KNK+FN KL+ + 
Sbjct: 181 QNASSGGGYINEKNKQFNEKLDRQM 205

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score = 82.0 bits (201), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 112/196 (57%), Gaps = 14/196 (7%)

Query: 36  MNDLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKKNSER----RVYSMADDGEDKARSNK 91
           M DL    +KLK L+++  + +I N+  ++  E K+ E     RVY+M DD +++  + +
Sbjct: 1   MIDLEGYSRKLKELKRKAQDATIENR-LLVDRESKDIESSGKPRVYNMQDDQDNQLETQE 59

Query: 92  SEPEDPI-KLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPK----- 145
            + +D + KL NY++R+YE+WE K ++ +         + +A  SY K V  L +     
Sbjct: 60  EDADDKVAKLMNYTLRQYEEWEKKQKDKKIKDDSSD-MKQLAMFSYDKGVSNLNRFRTDK 118

Query: 146 -DISHPLKGGI-TEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDG 203
                 ++  + ++ GKV ++D  +LV  +  +L + + KRYMV K+KLD ++K +  +G
Sbjct: 119 TTTEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEG 178

Query: 204 FINDKNKRFNAKLNSE 219
           +IN++NK FN KL+ E
Sbjct: 179 YINERNKHFNEKLDRE 194

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score = 80.1 bits (196), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 108/210 (51%), Gaps = 32/210 (15%)

Query: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAI---IAEEKKNSERRVYSMADDGEDK-ARSNKSE 93
           DL E+  KLK L++++V+ S++ +K     I E   N + RVYSM D  +D+  R  KS+
Sbjct: 2   DLEELGNKLKELKRRRVDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKSD 61

Query: 94  PEDPIKLANYSIREYEKWEAKTQNSRHNKS--VMGDFQTIAKNSYKKEVDALP------- 144
            +D  +  +Y+++EY  WE K +  +  K+      +  +AK SY K +  L        
Sbjct: 62  DKD--RAFHYTVQEYNAWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKH 119

Query: 145 ------KDISHPL---------KGGITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRK 189
                 KD    L         K  IT  GK+++ D+ ELV K+ + L   SKKR+  RK
Sbjct: 120 ESSVNEKDSKGSLGKSRIEKIQKNSIT--GKIRIVDDDELVNKLASTLESDSKKRHDARK 177

Query: 190 QKLDKQNKINLDDGFINDKNKRFNAKLNSE 219
           ++++     +  + FINDKNK+FN KL  E
Sbjct: 178 RQMENVKTPSGVESFINDKNKQFNEKLGRE 207

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 79.7 bits (195), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/194 (36%), Positives = 110/194 (56%), Gaps = 18/194 (9%)

Query: 40  MEIEKKL---KSLRKQKVEVSIRNKKAIIA---EEKKNSERRVYSMADDGEDKARSNKSE 93
           MEI++ L   K L+++ V++ I N+K + A   E KKNS+ + YSM +  ED    N   
Sbjct: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDT-VNTGT 61

Query: 94  PEDPIKLANYSIREYEKWEAKTQNSRHN----KSVMGDFQTIAKNSYKKEVDALPKDIS- 148
            ++  +L NYSIREYE+WE K    + N    KS +     IAK +Y K++  L K  S 
Sbjct: 62  VDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKST 121

Query: 149 HPLKGGITE------DGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDD 202
           +  +G I++       GK+ V D+ +L++++  DLN+ +K+RY    QK  K +  N + 
Sbjct: 122 NDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNENY 181

Query: 203 GFINDKNKRFNAKL 216
            +IN+KNK FN KL
Sbjct: 182 SYINEKNKEFNDKL 195

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 77.4 bits (189), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 108/210 (51%), Gaps = 27/210 (12%)

Query: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAI---IAEEKKNSERRVYSMADDGEDKARSNKSEP 94
           +L ++++KLK L+++ V VSI+N+K     I E   N + +VYSM D  +       +E 
Sbjct: 2   ELDKLDQKLKVLKRKGVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAET 61

Query: 95  EDPIKLANYSIREYEKWEAKTQNSRHN---KSVMGDFQTIAKNSYKKEVDALPKDISH-- 149
            D  K  +Y+++EY  W+ K QN R N   +     +  +AK SY+K +  L    S+  
Sbjct: 62  SDKDKAFHYTVQEYNAWKQK-QNQRKNGQGQRSGNSYDQVAKLSYEKTLRNLVTQNSNKN 120

Query: 150 ------------PLKGGI------TEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQK 191
                       P  G I       + GK+++ D+ +LV K+   L   SKKRY  R+++
Sbjct: 121 ENSVNKNDSNSSPKNGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQ 180

Query: 192 LDKQNKINLDDGFINDKNKRFNAKLNSEFK 221
           ++     +  + FINDKNK+FN KL+ E K
Sbjct: 181 MENAKTPSSVESFINDKNKQFNEKLSREPK 210

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 75.9 bits (185), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 109/212 (51%), Gaps = 35/212 (16%)

Query: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAI---IAEEKKNSERRVYSMADDGEDKARSNKSEP 94
           +L ++E++LK L+K++V VSI+N+K     I E   N + RVY+M D  +       +E 
Sbjct: 2   NLDQLEQRLKELKKKRVNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTES 61

Query: 95  EDPIKLANYSIREYEKWEAKTQNSRHNKSVMG-------DFQTIAKNSYKKEVDALP-KD 146
            D  +  +Y+ +EY  WE      RH++  +G        +  +AK SY+K +  L  +D
Sbjct: 62  SDKDRAFHYTAQEYIAWE-----QRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQD 116

Query: 147 IS----------HPLKGGI---------TEDGKVQVEDNPELVEKMVNDLNERSKKRYMV 187
           +S          H     I         T+ GK+++ D+ +LV K+   L   SKKRY  
Sbjct: 117 LSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEA 176

Query: 188 RKQKLDKQNKINLDDGFINDKNKRFNAKLNSE 219
           RK++++     +  + FINDKNK+FN KL+ E
Sbjct: 177 RKRQMESAVIPSGVESFINDKNKQFNEKLSRE 208

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 75.5 bits (184), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 116/206 (56%), Gaps = 20/206 (9%)

Query: 35  KMNDLMEIEKKLKSLRKQKVEVSIRNKKAI---IAEEKKNSERRVYSM-ADDGEDKARSN 90
           K  +L   E+ LK+L++  +++   N+K     + E+ ++S+ +VY + A + +D   ++
Sbjct: 2   KQEELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTD 61

Query: 91  --------KSEPEDPIKLANYSIREYEKWEAKTQNSRHNKSVMG-DFQTIAKNSYKKEVD 141
                     E +   KL NY+IREYE+W+ K Q  +  K V G D   +A  +Y+KE+ 
Sbjct: 62  YDGLGDFSNEEEKRKFKLMNYTIREYEEWD-KQQKDKQRKRVDGSDLTELATFTYEKELS 120

Query: 142 AL---PKDISHPLKGGI---TEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQ 195
            L    ++ISH  K  I   T +GK+ V+D   L+  +VN+LNE +KKRYMVRK+KL  +
Sbjct: 121 KLNSKLENISHEQKHQIGVNTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSK 180

Query: 196 NKINLDDGFINDKNKRFNAKLNSEFK 221
              ++   +  DKNK+FN KL  E K
Sbjct: 181 ASSDIAGNYFKDKNKQFNEKLERELK 206

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 69.7 bits (169), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 106/215 (49%), Gaps = 31/215 (14%)

Query: 36  MNDLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKK---NSERRVYSMADD--------GE 84
           M D+ E+E   K+L+++     I N+  + +   K   N++ +VYSM D+         +
Sbjct: 1   MYDINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPIND 60

Query: 85  DKARSNKSEPEDPIKLANYSIREYEKWEAK----TQNSRHNK--SVMGDFQTIAKNSYKK 138
           + AR N SE E   KL NY++REY+ WE K    T  S+ N     +    ++AK +Y K
Sbjct: 61  ENARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDK 120

Query: 139 EVDALPKDISHP------------LKGGITEDGKVQVEDNPELVEKMVNDLNERSKKRYM 186
           ++  L K +               +K    E  K+ ++D+  LVE++VN+L  +S + Y 
Sbjct: 121 DIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLYK 180

Query: 187 VRKQKLDKQNKINLDDGFINDKNKRFNAKLNSEFK 221
              ++  ++N      G +N KN+ FN KL  E+K
Sbjct: 181 HLGER--RKNYSTTLSGHVNTKNQEFNEKLTREWK 213

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 66.6 bits (161), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 106/195 (54%), Gaps = 16/195 (8%)

Query: 39  LMEIEKKLKSLRKQKVEVSIRNKKAII--AEEK-KNSERRVYSMADDGED--KARSNKSE 93
           L +  +KLK L+K   ++ IRN+  +   AEEK K  + RVYSM DD +D  + RS+  +
Sbjct: 3   LEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSDEQ 62

Query: 94  PEDPIKLANYSIREYEKWEAKTQNSRHNKSVMGD---FQTIAKNSYKKEVDALPKDISHP 150
            +    L  Y+++++  WE + Q  + +K         Q +AKN+Y KE+  LP+     
Sbjct: 63  SDMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPR-PEFK 121

Query: 151 LKGGITE------DGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGF 204
           +K   T+       GKV ++DN ELV+++  +L E +K+RY   ++  + +   +L  G 
Sbjct: 122 MKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRKIANDKEHTSL-SGS 180

Query: 205 INDKNKRFNAKLNSE 219
           IN KN +FN  L+ +
Sbjct: 181 INAKNLQFNKSLDDD 195

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/189 (32%), Positives = 96/189 (50%), Gaps = 36/189 (19%)

Query: 39  LMEIEKKLKSLRK--QKVEVSIRNKKAIIAEEKKNSERRVYSM-----ADDGEDKARSNK 91
           L E+  K K+L +  Q++ V IR ++A + + K      VYS+     + DG D A    
Sbjct: 37  LTELRDKFKTLSQESQRLRVRIRKQQAEVEKPK------VYSLQAAEPSVDGIDGA---- 86

Query: 92  SEPED--PIKLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKDISH 149
            E  D   +KL N  +R+ E  EA+   +  +     +   +AK++YKKE+  L +  + 
Sbjct: 87  -EVVDNVTVKLLNTPLRQLEAREARRGENGDDAVARVEGDRVAKDTYKKELALLGRKST- 144

Query: 150 PLKGGITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLD--DGFIND 207
                     +    DN   VE++V  LN+ SKKRY+VRK K+ +Q        DG+IN+
Sbjct: 145 ----------RGTYRDN---VERLVTHLNDVSKKRYLVRKNKMKRQGARGGSSLDGYINE 191

Query: 208 KNKRFNAKL 216
           KNK+FN KL
Sbjct: 192 KNKQFNKKL 200

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/211 (28%), Positives = 103/211 (48%), Gaps = 37/211 (17%)

Query: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKKNSER---RVYSM------ADDGEDKAR 88
           D++ +  + K L+KQ ++  I ++K + A+EK+       +VYS+        D  D   
Sbjct: 2   DMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDLL 61

Query: 89  SNKSEPEDPIKLANYSIREYEKWEA----KTQNSRHNKSVMGDFQTIAKNSYKKEVDALP 144
           +N SE      L  Y+IR+YE+WE     K +N  +  +     Q  AK +Y KE+  + 
Sbjct: 62  TNNSERA----LLTYTIRDYEEWEESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIHRMK 117

Query: 145 K-----DISHPLKGG-----ITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDK 194
           K          +  G     + +DGK+ ++D+  LV   ++D+N+ S  RY +++ KL+ 
Sbjct: 118 KRQGKFATDEEITRGSAMKEVLDDGKLLIKDDKHLVNGFISDINKVSNDRY-IKRMKLNA 176

Query: 195 QN------KINLDDG---FINDKNKRFNAKL 216
            N      K++ D G   + N KNK FN KL
Sbjct: 177 VNNDATGSKVSHDKGKTSYNNAKNKDFNDKL 207

>KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.490
           YGR129W
          Length = 157

 Score = 37.7 bits (86), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 88/184 (47%), Gaps = 38/184 (20%)

Query: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAI-IAEEKKNSERRVYSMADDGEDKARSNKSEPE- 95
           D+  + ++ + LRK+  E+ I N+K I IA     S+ + YS+ ++      S++ E + 
Sbjct: 4   DMANLREEFRDLRKKCREIKIENRKLISIA-----SKPKTYSIREEEIGAEVSDEDEDDS 58

Query: 96  DPIKLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKDISHPLKGGI 155
           + IKL    +RE+E      +N           + I + +Y KEV +L            
Sbjct: 59  EIIKLLTKPLREFETEAHVAENK----------EDIDRLTYNKEVMSL------------ 96

Query: 156 TEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDKNKRFNAK 215
              GK +  D    VE +V+++N  S +RY    QK  ++   + + GFIN++NK FN +
Sbjct: 97  ---GKREKRD----VESLVSEMNRISDERYKKGAQK--RRRLKDTERGFINEQNKAFNLR 147

Query: 216 LNSE 219
           L  E
Sbjct: 148 LEKE 151

>Kwal_55.22131 s55 complement(1123160..1125985) [2826 bp, 941 aa]
           {ON} YNR044W (AGA1) - anchorage subunit of a-agglutinin
           [contig 124] FULL
          Length = 941

 Score = 33.9 bits (76), Expect = 0.28,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 48  SLRKQKVEVSIRNKKAIIAEEKKNSERRVYSMADDGEDKARSNKSEPEDPIKLANYSIRE 107
           S+RKQ V  SI +   I++  KK +E    S     ED   SNK  P    K A  S+  
Sbjct: 682 SIRKQSVSTSITSNTTIVSSPKK-TETNSASHFTSIEDIITSNKGTPTSQSKSAQVSVSS 740

Query: 108 YEKWEAKTQNSR 119
             +   K+Q+S+
Sbjct: 741 TPRSLVKSQSSQ 752

>NDAI0A05500 Chr1 complement(1242145..1242891) [747 bp, 248 aa] {ON}
           
          Length = 248

 Score = 32.3 bits (72), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 5/57 (8%)

Query: 58  IRNKKAIIAEEKKNSERRVYSMADDGEDKARSNKSE----PEDPIKLANYSIREYEK 110
            RN K ++ +E KN E R  S  D G+  +RS   E     EDPIK     +REY+K
Sbjct: 85  FRNYKGLV-KETKNDENRNDSYKDSGKFFSRSTGMEKYVYGEDPIKFVQQFLREYQK 140

>ABR144C Chr2 complement(671713..672408) [696 bp, 231 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR295C and
           YGR273C
          Length = 231

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 26/63 (41%)

Query: 82  DGEDKARSNKSEPEDPIKLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVD 141
           D  +  RS    P D I+   Y+I   ++W  + +  R+  SV  DF  +   +Y     
Sbjct: 137 DISNPTRSRDERPLDTIRGFEYAITGDQQWMQQLETHRYGFSVRPDFPGLPVGAYMAGAG 196

Query: 142 ALP 144
             P
Sbjct: 197 GYP 199

>KLLA0F06160g Chr6 (598549..601128) [2580 bp, 859 aa] {ON} similar
           to uniprot|P27514 Saccharomyces cerevisiae YNR013C PHO91
           Low-affinity phosphate transporter deletion of pho84
           pho87 pho89 pho90 and pho91 causes synthetic lethality
           transcription independent of Pi and Pho4p activity
           overexpression results in vigorous growth
          Length = 859

 Score = 30.8 bits (68), Expect = 3.0,   Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 55/133 (41%), Gaps = 13/133 (9%)

Query: 21  NHIVNWTQADNKYSKMNDLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKKNSERRVYSMA 80
           N +  WT     YS++  L+   +K K  R       + +     A  + + E+R     
Sbjct: 10  NAVPEWTTKYIGYSQLKKLIYTLQKEKLYRSTSESSDLESTPLTTAVTRDSYEQRFIDAL 69

Query: 81  DDGEDKARSNKSEPEDPIKLANYSIREYEKWEAKT--QNSRHNKSV----MGDF--QTIA 132
           D   DK  S  +  E  I LANYS    E +E  T  QN   N+S+     GD   Q   
Sbjct: 70  DKELDKIDSFYTMQETSI-LANYS----EVYEDVTTFQNELMNRSIHNTSTGDLNRQGTR 124

Query: 133 KNSYKKEVDALPK 145
           ++S   E ++ P+
Sbjct: 125 RSSSISEYNSQPE 137

>Kwal_23.5216 s23 (1064728..1065258) [531 bp, 176 aa] {OFF}
          [contig 8] FULL
          Length = 176

 Score = 29.6 bits (65), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (70%)

Query: 35 KMNDLMEIEKKLKSLRKQKVEVSIRNKKAIIAEE 68
          KM  ++E  ++   +RKQ+  +S+R+KKAI +EE
Sbjct: 16 KMATVLESSEEDSMMRKQRGMISVRSKKAITSEE 49

>NDAI0H03260 Chr8 complement(782589..783449) [861 bp, 286 aa] {ON} 
          Length = 286

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 51/121 (42%), Gaps = 26/121 (21%)

Query: 58  IRNKKAIIAEEKKNSERRVYSMADDGEDKARSNKSE----PEDPIKLANYSIREYEKWEA 113
            RN K ++ +E K+ + R  S  + G   +RS   E     EDPIK     +REY+K   
Sbjct: 44  FRNYKGLV-KETKDDDNRNDSYKESGTSFSRSTGMEKYVYGEDPIKFVQQFLREYQK--- 99

Query: 114 KTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKDISHPLKGGITEDGKVQVEDNPELVEKM 173
             +N   +KS +          Y      LP  ++       T DGK   ED   L+E+ 
Sbjct: 100 --RNILESKSTI----------YTTFRSLLPAKLTAMCA---TSDGK---EDPDALIEQF 141

Query: 174 V 174
           V
Sbjct: 142 V 142

>NCAS0G03540 Chr7 complement(662949..664181) [1233 bp, 410 aa] {ON}
           Anc_1.530
          Length = 410

 Score = 29.3 bits (64), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 10/64 (15%)

Query: 121 NKSVMGDFQTIAKNSYKKEVDALPKDISHPLKGGITEDGKVQVEDNPELVEKMVNDLNER 180
           NKS M D QTI +N        LPK+I++ +    +++G     D  + +EKM+ +LNE+
Sbjct: 30  NKSKMNDLQTILQN--------LPKEINNAILLDRSQEG--SESDMLKKLEKMIEELNEK 79

Query: 181 SKKR 184
           +++R
Sbjct: 80  NQER 83

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.128    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,169,897
Number of extensions: 1231288
Number of successful extensions: 7716
Number of sequences better than 10.0: 504
Number of HSP's gapped: 7352
Number of HSP's successfully gapped: 552
Length of query: 221
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 116
Effective length of database: 41,441,469
Effective search space: 4807210404
Effective search space used: 4807210404
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 63 (28.9 bits)