Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E04621g3.491ON38938916740.0
KLTH0F14806g3.491ON3583939091e-120
SAKL0F02794g3.491ON3974188711e-114
Kwal_55.212273.491ON3763978521e-111
TDEL0D055903.491ON3443927519e-97
Ecym_12383.491ON3934107384e-94
ZYRO0D10010g3.491ON3824087271e-92
Skud_16.4433.491ON4202786971e-87
Suva_16.4773.491ON4232726735e-84
AFR309C3.491ON3643946678e-84
Kpol_1017.73.491ON3784076601e-82
TPHA0D032703.491ON3884136497e-81
Smik_16.4013.491ON4272816474e-80
YPR148C3.491ON4352886414e-79
NDAI0B058503.491ON4732956141e-74
NCAS0F035403.491ON4442765799e-70
CAGL0L08492g3.491ON3854325697e-69
TBLA0D029803.491ON4432855563e-66
KNAG0A079303.491ON4522784998e-58
KAFR0G036803.491ON4152794862e-56
Kpol_1070.197.221ON3113902053e-17
Kwal_47.181487.221ON3234052001e-16
TDEL0H022407.221ON3383821956e-16
KLTH0A03894g7.221ON3234051922e-15
SAKL0F08162g7.221ON3303751798e-14
KLLA0E04511g7.221ON3022731717e-13
CAGL0L00891g7.221ON3413771701e-12
Suva_9.1597.221ON3252301682e-12
KAFR0I019507.221ON3302291673e-12
TBLA0D042007.221ON3313941673e-12
ADL115W7.221ON3332321663e-12
Ecym_43777.221ON3332381639e-12
Smik_9.1507.221ON3262311621e-11
Skud_9.1287.221ON3292311611e-11
KNAG0D017607.221ON3422281612e-11
NDAI0A026607.221ON3643681603e-11
YIL041W (GVP36)7.221ON3262301575e-11
NCAS0A133807.221ON3293721576e-11
TPHA0C012307.221ON3051211522e-10
Kpol_478.227.221ON3501071442e-09
TBLA0B015807.221ON3862391391e-08
TPHA0B027507.221ON363601273e-07
ZYRO0D16522g7.221ON358601265e-07
Kwal_26.72127.102ON58456712.7
Suva_11.1502.618ON88169678.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E04621g
         (389 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   649   0.0  
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   354   e-120
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   340   e-114
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   332   e-111
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   293   9e-97
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   288   4e-94
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   284   1e-92
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   273   1e-87
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   263   5e-84
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   261   8e-84
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   258   1e-82
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   254   7e-81
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   253   4e-80
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   251   4e-79
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   241   1e-74
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   227   9e-70
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   223   7e-69
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   218   3e-66
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   196   8e-58
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   191   2e-56
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    84   3e-17
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    82   1e-16
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    80   6e-16
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    79   2e-15
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    74   8e-14
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    70   7e-13
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    70   1e-12
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    69   2e-12
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    69   3e-12
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    69   3e-12
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    69   3e-12
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    67   9e-12
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    67   1e-11
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    67   1e-11
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    67   2e-11
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     66   3e-11
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    65   5e-11
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    65   6e-11
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    63   2e-10
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    60   2e-09
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    58   1e-08
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    54   3e-07
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    53   5e-07
Kwal_26.7212 s26 (267411..269165) [1755 bp, 584 aa] {ON} YAL011W...    32   2.7  
Suva_11.150 Chr11 (282785..285430) [2646 bp, 881 aa] {ON} YKL073...    30   8.4  

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/389 (84%), Positives = 330/389 (84%)

Query: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDI 60
           MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDI
Sbjct: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDI 60

Query: 61  SQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF 120
           SQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF
Sbjct: 61  SQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF 120

Query: 121 SKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQ 180
           SKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQ
Sbjct: 121 SKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQ 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNA 240
                                      NLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNA
Sbjct: 181 KPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNA 240

Query: 241 KLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQXXXXXXXXXXXXXXXXXXXXX 300
           KLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQ                     
Sbjct: 241 KLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQEKEVVASSEEAEKKVATETPE 300

Query: 301 XXXXXXXXXXXDMAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFH 360
                      DMAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFH
Sbjct: 301 TPEKKTNEEPVDMAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFH 360

Query: 361 NFQLIHYKQCVKSLEEDLEVLNSLDSEDK 389
           NFQLIHYKQCVKSLEEDLEVLNSLDSEDK
Sbjct: 361 NFQLIHYKQCVKSLEEDLEVLNSLDSEDK 389

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  354 bits (909), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 184/393 (46%), Positives = 246/393 (62%), Gaps = 46/393 (11%)

Query: 2   FSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDIS 61
           F   SLN +T+SI+N A +TQ+  S+AI  I LDDP+ +LS+  R+H LQETLGT+ DIS
Sbjct: 5   FGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTIEDIS 64

Query: 62  QLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF- 120
           +LP QY+FLE+K D+LEK+C+R+L+VTKT+EVEGYDYPPNL+ES +DWWS NK+ +F F 
Sbjct: 65  KLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGLFGFV 124

Query: 121 SKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQ 180
           S  K E   E  E ++  L+PRSFAQA+SKAA DS  ++  LK EE + +          
Sbjct: 125 SSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKAS---------- 174

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNA 240
                                      +LIK FE+W+ CQ ++DQSKAEMD+LMVKEFN 
Sbjct: 175 ----------------AEEDEEDEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNH 218

Query: 241 KLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQXXXXXXXXXXXXXXXXXXXXX 300
           KL+  +E  FK    LR KV+D+RL FDT+R+E+K+                        
Sbjct: 219 KLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELKM--------------AEEQGKTEEA 264

Query: 301 XXXXXXXXXXXDMAKTEEDPDS-----KLFERLEDQFVSATSETVEFLGELTDSSEIISL 355
                      D A+  +D DS     KL E+LED+FVS T+E VE +GE+TDS+EII+L
Sbjct: 265 AQQTESQKPQEDEAEASKDSDSSDEAQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINL 324

Query: 356 VKLFHNFQLIHYKQCVKSLEEDLEVLNSLDSED 388
           VKLFHNFQLI+YKQCV++LE  +  LN L+ ++
Sbjct: 325 VKLFHNFQLIYYKQCVQNLETSINSLNELEGDE 357

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  340 bits (871), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 192/418 (45%), Positives = 251/418 (60%), Gaps = 57/418 (13%)

Query: 2   FSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDIS 61
           FS  SL+ +T+SIS+AA +TQ++ S+AI  I LDDP+ +LS+  R+H LQETLG + DIS
Sbjct: 5   FSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDDIS 64

Query: 62  QLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF- 120
           +LP QY+FLE+K D+LEKIC+R+L+VTKTFEVEGYDYPPNL+ES +DWW  N+  + SF 
Sbjct: 65  KLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLSFM 124

Query: 121 SKKKAEVS-PEVKETAEN-GLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGA 178
             KK E S  + +E  EN G LPRSFAQALSKAA DS  +L+ LK E+    Q+E +   
Sbjct: 125 DGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDEQKEPPQDEDE--- 181

Query: 179 DQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVKEF 238
                                        +LI  FE+W+KC+  IDQ KAEMDSLM KEF
Sbjct: 182 ----------------------DEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEF 219

Query: 239 NAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQXXXXXXXXXXXXXXXXXXX 298
           N KL KLI  DFKK H LR KV+++RL FDTLR+E+ LK +                   
Sbjct: 220 NKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRYELNLKEKEQQKAKAKEEENEKVDVVE 279

Query: 299 XXXXXXXXXXXXXDMA-----------KTEEDPDSKL------------------FERLE 329
                        + +           K  ED  SK+                   E+LE
Sbjct: 280 QNAPEEKAKTEGQETSEGKEHDLKADEKLSEDTASKIPESVENEEVDNEDPEHKLLEKLE 339

Query: 330 DQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDSE 387
           D+FVS+T+E VE +GE+TDSSEI+SLVKLFH FQLI+++QCV+ LE   ++L+ LD+E
Sbjct: 340 DEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDNE 397

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  332 bits (852), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 178/397 (44%), Positives = 239/397 (60%), Gaps = 36/397 (9%)

Query: 2   FSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDIS 61
           F   S N +TD+++NAA +TQ+  S+AI  I LDDP+  LS+  R+H LQETLGT+ DIS
Sbjct: 5   FGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTIEDIS 64

Query: 62  QLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF- 120
           +LP QY+ LE+K D+LEK C+R+L+VTKTFEVEGYDYPPNL+ES +DWWS NK+ +F   
Sbjct: 65  KLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLM 124

Query: 121 SKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQ 180
           S  K +   E    A++ L+PRSFAQA++KAA DS  +L  LK +E + +          
Sbjct: 125 SSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQEQQAS---------- 174

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNA 240
                                       LIK F +W++CQ  IDQ KAEMD+LM KEFN 
Sbjct: 175 ----------------ADEEDEDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQ 218

Query: 241 KLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQXXXXXXXXXXXXXXXXXXXXX 300
           KL+ LIE  FK    LR KV+D+RL FDT+R+E+KL  Q                     
Sbjct: 219 KLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQAMENEKAQFKESDLSSK 278

Query: 301 XXXXXXXXXXXDMAKT-----EE----DPDSKLFERLEDQFVSATSETVEFLGELTDSSE 351
                      ++ K+     EE    D   +L E+LED+FVS T+E VE +GE+TDS+E
Sbjct: 279 EEGADANETSNEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAE 338

Query: 352 IISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDSED 388
           +++LVKLFHNFQL++++QCV+ LE  L  LN L+ ED
Sbjct: 339 LLNLVKLFHNFQLVYHRQCVQDLEASLSTLNELEGED 375

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  293 bits (751), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 174/392 (44%), Positives = 230/392 (58%), Gaps = 58/392 (14%)

Query: 2   FSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDIS 61
            S  SLN ITD+++NAA +TQ+  +SAI   ++ DP+ +LS+  R   LQETLGT+ D S
Sbjct: 5   LSNFSLNKITDTLANAAHKTQDTLNSAI--ANVSDPQAKLSLKARTRYLQETLGTIDDKS 62

Query: 62  QLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFS 121
           +LP QY+ LE+KSDALEK CKR+LLVT+TFEVEGYDYPPNLTES +DWWS NKD    F 
Sbjct: 63  KLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGW--FG 120

Query: 122 KKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQX 181
            KK E +        +  LPRSF+QA+SKAA D   +   L        QE   E     
Sbjct: 121 TKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNL--------QEHGDE----- 167

Query: 182 XXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNAK 241
                                     N+ K F+SW+KC  +ID+ K EMDS++ KEFN K
Sbjct: 168 ------------------DEEDEDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTK 209

Query: 242 LSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQXXXXXXXXXXXXXXXXXXXXXX 301
           L K+I  DFKK H  R KV+++RL FDT+R+EIKLK                        
Sbjct: 210 LEKIINEDFKKVHASRKKVEESRLKFDTVRYEIKLK------------------ETENAK 251

Query: 302 XXXXXXXXXXDMAKTEEDP-----DSKLFERLEDQFVSATSETVEFLGELTDSSEIISLV 356
                     D  KTEE+P     + KL E LED+FVS T+  VE +GE+T+S+EI+ L 
Sbjct: 252 KSTETDEASKDETKTEEEPPKTSEEDKLLEELEDEFVSNTTAAVEIMGEVTESAEILGLA 311

Query: 357 KLFHNFQLIHYKQCVKSLEEDLEVLNSLDSED 388
           KLF NFQL++++QCV+ +E  L++L +L+S+D
Sbjct: 312 KLFQNFQLVYFRQCVQEVEASLKILGALESDD 343

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  288 bits (738), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 166/410 (40%), Positives = 234/410 (57%), Gaps = 48/410 (11%)

Query: 2   FSKLSLNNITDSISNAAQRTQ-------EQFSSAIEKIHLDDPETRLSILKRRHQLQETL 54
           FS  SL+ I  +I+ AA +TQ       EQ + AI  I+LDDP+T LS+  R+HQLQETL
Sbjct: 5   FSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETL 64

Query: 55  GTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWW--SG 112
           GT+ DIS+LP +Y+FLE+K DA EK+C R+L+V+KTFEV+GYDYPPNL ES +DWW  S 
Sbjct: 65  GTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGSSS 124

Query: 113 NKDSIF-SFSKK------KAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAE 165
            KD +F  F KK      KAE     ++ +  G +P SFAQA+SKAA DS  ILK+L  E
Sbjct: 125 KKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDSITILKELN-E 183

Query: 166 ETRTNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQ 225
           E   N     E  D+                           +L+   E+W + Q +ID+
Sbjct: 184 EQLVNPSNGAETEDE------------------------DVDSLMPILEAWAEAQSNIDE 219

Query: 226 SKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLK----LQXX 281
           +K +MD  M+ EFN KL  L+  DF K   LR KV+++RL FDTLR+E++++     Q  
Sbjct: 220 AKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTK 279

Query: 282 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMAKTEEDPDSK---LFERLEDQFVSATSE 338
                                          +  + ++ D K   L E+ ED+FVS T++
Sbjct: 280 ETFTTIESQQVNDKDKENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTD 339

Query: 339 TVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDSED 388
            V ++ ++TDS  + +LVKLFHNFQLI++K+CV+ L+  L V+N+L  E+
Sbjct: 340 AVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTLTVEE 389

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  284 bits (727), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 159/408 (38%), Positives = 229/408 (56%), Gaps = 53/408 (12%)

Query: 2   FSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDIS 61
           FS  S  N+ DSI+NAA RTQ++ S+A+  ++L+DP+TRLSI  R   L+ETLG V +IS
Sbjct: 5   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEIS 64

Query: 62  QLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFS 121
           +LP QY  LE+KSDALEK CKR+LLVT+TFEVEGYDYPPNL ESF+DWWSG+K+  F  +
Sbjct: 65  KLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGST 124

Query: 122 KK--KAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGAD 179
           K+    E   +   ++++ L+PRSFAQA++KA+ +     +  +  E +   E+  +   
Sbjct: 125 KQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDD--- 181

Query: 180 QXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFN 239
                                       NL++ F + + C  +ID+ K EMD  + +EFN
Sbjct: 182 ---------------------------VNLVEMFNTLSICYRNIDEGKDEMDKSIAREFN 214

Query: 240 AKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKL---------------------KL 278
            KL +L+  DFKK H LR KV+++RL FDT+R+E++L                     K 
Sbjct: 215 DKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLKEKEEKEENENTANADEGPSNKN 274

Query: 279 QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMAKTEEDPDSKLFERLEDQFVSATSE 338
           Q                                     E+  D+KL E+LED+FVS TSE
Sbjct: 275 QQEPTNEPAKEEEKPTPAEPAEAQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSE 334

Query: 339 TVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDS 386
            VE +  + + SEI+ L+KLF N QL++Y+QCV+ +E  L+ LN L++
Sbjct: 335 AVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLEN 382

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  273 bits (697), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 142/278 (51%), Positives = 182/278 (65%), Gaps = 11/278 (3%)

Query: 2   FSKLSLNNITDSISNAAQRTQEQFSSAIE--KIHLDDPETRLSILKRRHQLQETLGTVHD 59
           FS  SLN ITDSI+ AA +TQ+  ++A+    ++L+DPETRLSI  R   +QE+LGTV D
Sbjct: 5   FSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLGTVSD 64

Query: 60  ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFS 119
           IS+LP QY+FLE+KSD+LEK+C+R+LLV+KTFEVEGYDYPPNLTES +DWWS NKD  F 
Sbjct: 65  ISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKDGWFG 124

Query: 120 FSKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGAD 179
            S+K    + +     ++  LPRSFAQA+SKAA D     + LK +E        + G  
Sbjct: 125 -SRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDE--------KAGLK 175

Query: 180 QXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFN 239
           +                           NLIK F+SW+ C  +ID+ KAEMDS M+KEFN
Sbjct: 176 KKSESNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFN 235

Query: 240 AKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLK 277
            KL KLI  DFKK HELR KV+D+RL FDT+R+E+K K
Sbjct: 236 KKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSK 273

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 56/66 (84%)

Query: 321 DSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEV 380
           ++KL E+LED+FVS T+  VE + E+TDSS+I+ LVKLF NFQL++++QCV+ +E +L+V
Sbjct: 355 ENKLLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKV 414

Query: 381 LNSLDS 386
           LNSL++
Sbjct: 415 LNSLEN 420

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  263 bits (673), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 141/272 (51%), Positives = 180/272 (66%), Gaps = 7/272 (2%)

Query: 8   NNITDSISNAAQRTQEQFSSAIEK--IHLDDPETRLSILKRRHQLQETLGTVHDISQLPI 65
           N ITDSI+ AA +TQ+  +SA+    ++L+DP+TRLSI  R   +QE+LGTV DIS+LP 
Sbjct: 6   NKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLGTVSDISKLPP 65

Query: 66  QYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFSKKKA 125
           QY+FLE+KSD+LEK+CKR+LLV+KTFEVEGYDYPPNLTES +DWWS NKD  F  SKK  
Sbjct: 66  QYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFG-SKKTE 124

Query: 126 EVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQXXXXX 185
             S +     ++  LPRSFAQA+SKAA D     K L+  E    +E+ ++  +      
Sbjct: 125 HASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNE----KEDLKQKKEAKKTTQ 180

Query: 186 XXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNAKLSKL 245
                                 NLIK F+SW+ C  +ID+ KAEMDS+MVKEFN KL KL
Sbjct: 181 ETAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLEKL 240

Query: 246 IETDFKKGHELRAKVQDARLNFDTLRHEIKLK 277
           I  DFKK HELR KV+++RL FDT+R+E K K
Sbjct: 241 INEDFKKVHELRRKVEESRLKFDTMRYEGKSK 272

 Score = 83.2 bits (204), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 57/70 (81%)

Query: 317 EEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEE 376
           E+  ++KL E+LED+FVS T+  VE + E+TDSSEI+SLVKLF NFQL++++QC + +E 
Sbjct: 354 EDSEENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEA 413

Query: 377 DLEVLNSLDS 386
           +L+VLN +++
Sbjct: 414 NLKVLNGMEN 423

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  261 bits (667), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 157/394 (39%), Positives = 223/394 (56%), Gaps = 47/394 (11%)

Query: 2   FSKLSLNNITDSISNAAQRTQ-------EQFSSAIEKIHLDDPETRLSILKRRHQLQETL 54
           F  +SL+ + ++++NAAQ+TQ       E  + AI+ I +DDP+T LS+  R+ QLQETL
Sbjct: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64

Query: 55  GTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWW-SGN 113
           G+  DISQLP QY FLE+K DA+E++CK++L+V+KTFEVEGYDYPPN TES +DWW +  
Sbjct: 65  GSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTST 124

Query: 114 KDSIF-SFSKKKAEVSPEVKETAENGLL-PRSFAQALSKAATDSALILKQLKAEETRTNQ 171
           K++ F  F K   +   E K+    G   P SFA AL +AA  S  I+++LK +     +
Sbjct: 125 KETRFLKFGKGGTDKQKEDKQKQAAGSSDPPSFAHALHRAAKGSQGIIQELKEQAEEEQE 184

Query: 172 EESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMD 231
           +E +   D                            +LIK F +W   Q ++D +K EMD
Sbjct: 185 QEVEIDED--------------------------VESLIKMFGTWADAQYNMDIAKREMD 218

Query: 232 SLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQXXXXXXXXXXXX 291
             MVKEFN KL  L+E +FKKGH LR KV+++RL FDTL++E     Q            
Sbjct: 219 QFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYE-----QHERDAALAKKQD 273

Query: 292 XXXXXXXXXXXXXXXXXXXXDMAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSE 351
                               D+A   +       E  ED+FVS T+E VEF+  + D+++
Sbjct: 274 EAKQAEGATPSTGVTQSSTADLAFYAQ------LEDAEDEFVSNTAEAVEFMTSIADATK 327

Query: 352 IISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLD 385
           +ISLVKLF NFQL+++++CV+ LE  L  L SL+
Sbjct: 328 LISLVKLFQNFQLVYHRKCVQELEVSLNSLTSLE 361

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  258 bits (660), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 157/407 (38%), Positives = 225/407 (55%), Gaps = 52/407 (12%)

Query: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKI------HLDDPETRLSILKRRHQLQETL 54
           MFS  S++ +TDSISN A +TQE  ++A+  +      +L+DP T+LSI  +   +QE L
Sbjct: 1   MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL 60

Query: 55  GTVHD-ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGN 113
           GT++D  S+LP  Y  LE K+DA+EK  KRLL VTKT+E EGYDYPPNLTES +DWW+ N
Sbjct: 61  GTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWT-N 119

Query: 114 KDSIFSFSKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEE 173
            D++ +  +    +       +    LPRSFAQA+S A+ D+A  +  +     + N ++
Sbjct: 120 DDNVTNTDENDENIQ------SNKSFLPRSFAQAISNASFDAASNVNSV-TNTIKLNHKD 172

Query: 174 SQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSL 233
            +E  +                            +L K FES   C  +ID  K EMD L
Sbjct: 173 DEEEEEDDEEWS----------------------DLHKIFESLGNCYRNIDNGKTEMDKL 210

Query: 234 MVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKL------------QXX 281
           +V EFN KL  LI T+FK  H+LR  V+++RL FDT+R+E+K+K             +  
Sbjct: 211 IVNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYELKIKEWKRTXXXMEAEDKSD 270

Query: 282 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDM---AKTEEDPDSKLFERLEDQFVSATSE 338
                                         D+     TE D D+KL E+LED+FVS T  
Sbjct: 271 VSKKGTSKKETPKKEASKKETPKKEINKKEDITNEGNTENDNDNKLLEKLEDEFVSNTQN 330

Query: 339 TVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLD 385
            VE + ELTD+S+II+LVKL+ NFQL++YKQC++ +E +L++LN L+
Sbjct: 331 AVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  254 bits (649), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 165/413 (39%), Positives = 225/413 (54%), Gaps = 56/413 (13%)

Query: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIH------LDDPETRLSILKRRHQLQETL 54
           MFS  SL+ +TDSISN A +TQE F++AI  ++      L+DP T+LSI  R   +QE L
Sbjct: 1   MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQL 60

Query: 55  GTVHD-ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGN 113
           GT+ D IS+LP QY  LE K+D++EKI KRLLLVT TF  EGYDYPPNLTES +DWW+ +
Sbjct: 61  GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED 120

Query: 114 KDSIFSFSKKKAEVSPEVKETAEN-GLLPRSFAQALSKAATDSALIL----KQLKAEETR 168
                              ET EN   LPRSFAQAL+KA +DS LI     + +K + + 
Sbjct: 121 -------------------ETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSP 161

Query: 169 TNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKA 228
            N     E  +                             L KAF++ +    +ID  K 
Sbjct: 162 KNTGTKDENPEAGAEEEVEADDDEEDEDLVT---------LGKAFKALSNSFTNIDNGKN 212

Query: 229 EMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLK----LQXXXXX 284
           EMD+++V EFN KL  L+E +FK+  +LR  V+++RL FDT+R+++KLK     Q     
Sbjct: 213 EMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLKEAKAEQEEAKE 272

Query: 285 XXXXXXXXXXXXXXXXXXXXXXXXXXXDMAKTEE-DP-----------DSKLFERLEDQF 332
                                      +   TEE DP           D KL E+LED+F
Sbjct: 273 VSTDKEIEKKESETKEPETKGTEEKEPETKDTEEKDPVKENEGENEDEDYKLLEQLEDEF 332

Query: 333 VSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLD 385
           VS TS  VE + ELTDS++I+ LVKLF NFQL++Y+QCV+ +E +L+ ++ L+
Sbjct: 333 VSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  253 bits (647), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 141/281 (50%), Positives = 184/281 (65%), Gaps = 11/281 (3%)

Query: 2   FSKLSLNNITDSISNAAQRTQE--QFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHD 59
           FS  SLN ITDSI+ AA +T +    + A   ++L+DP+TRLSI  R   +QE+LGT+ D
Sbjct: 5   FSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLGTISD 64

Query: 60  ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFS 119
           IS+LP QY+FLE+KSD+LEK+CKR+LLV+KTFEVEGYDYPPNLTES +DWWS NKD    
Sbjct: 65  ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGW-- 122

Query: 120 FSKKKAEVSPEVKETA-ENGLLPRSFAQALSKAATDSALILKQLKAEETR--TNQEESQE 176
           F  KK+E++ + K +  ++  LPRSFAQA+SKAA D     + L+ +E      + ES +
Sbjct: 123 FGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRESTK 182

Query: 177 GADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVK 236
            A                             NLIK F+SW+ C  +ID+ K EMDS+MVK
Sbjct: 183 NA----QTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVK 238

Query: 237 EFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLK 277
           EFN KL KLI  DFK+ HELR KV+ +RL FDT+R+E+K K
Sbjct: 239 EFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAK 279

 Score = 83.2 bits (204), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 56/70 (80%)

Query: 317 EEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEE 376
           EE  ++KL E+LED+FVS T+  VE + E+ DSSEI+ L+KLF NFQL++++QCV+ +E 
Sbjct: 358 EESEENKLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEA 417

Query: 377 DLEVLNSLDS 386
           +L+VLN L++
Sbjct: 418 NLKVLNGLEN 427

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  251 bits (641), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 142/288 (49%), Positives = 182/288 (63%), Gaps = 22/288 (7%)

Query: 2   FSKLSLNNITDSISNAAQRTQE--QFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHD 59
           FS  SLN ITDSI+ AA +TQ+    + A   ++L+DP+TRLSI  R   +QE+LGTV D
Sbjct: 5   FSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLGTVSD 64

Query: 60  ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFS 119
           IS+LP QY+FLE+KSD+LEK+CKR+LLV+KTFEVEGYDYPPNLTES +DWWS NKD  F 
Sbjct: 65  ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFG 124

Query: 120 FSKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLK----------AEETRT 169
             K ++    +     ++  LPRSFAQA+SKAA D     + L+           E  +T
Sbjct: 125 SKKSESSTK-KKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKKKESIKT 183

Query: 170 NQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAE 229
            Q    +GAD                            NLIK F+SW+ C  +ID+ KAE
Sbjct: 184 AQTTEAQGADH---------NEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAE 234

Query: 230 MDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLK 277
           MDS+MVKEFN KL  LI  DFKK H+LR KV+++RL FDT+R+E+K K
Sbjct: 235 MDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAK 282

 Score = 86.7 bits (213), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 57/74 (77%)

Query: 312 DMAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCV 371
           D    EE  D+KL E+LED+FVS T+  VE + E+TDSSEI+ L+KLF NFQL++++QCV
Sbjct: 361 DEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCV 420

Query: 372 KSLEEDLEVLNSLD 385
           + +E +L+VLN L+
Sbjct: 421 QEVEANLKVLNGLE 434

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  241 bits (614), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 138/295 (46%), Positives = 174/295 (58%), Gaps = 25/295 (8%)

Query: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDI 60
           MFS  SL+ IT+SI NAAQ+     ++AI      DP+T+LSI  +    QE LGT+HDI
Sbjct: 1   MFSSFSLDKITNSIGNAAQKATNTLNNAINTAT--DPQTKLSIKSQTRLFQEQLGTIHDI 58

Query: 61  SQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF 120
           S+LP QYK LE K+D+LEK  KR+LLV+KTFE+EGYDYPPNLTESF+DWW+  K S  S 
Sbjct: 59  SKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKS-SSH 117

Query: 121 SKKK------------------AEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQL 162
            KK+                    V P   +   +  LPRSFAQA+SK+A D   I +QL
Sbjct: 118 RKKQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQL 177

Query: 163 KAEETRTNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLS 222
             +ET T +   ++                               NLIKAFESW+ C  +
Sbjct: 178 SIQETATKETTIKD----ENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCYKN 233

Query: 223 IDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLK 277
           IDQ K+EMDS+M KEFN KL  LI  +FKK + LR KV D+RL FDT+RHEIK+K
Sbjct: 234 IDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKIK 288

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 57/77 (74%), Gaps = 3/77 (3%)

Query: 312 DMAKTEEDPDS---KLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYK 368
           D  K +E  DS   KL E+LED+FVS+T+  VE + E+T+SS II L+KLF NFQL++Y+
Sbjct: 395 DAEKQDEQDDSEEHKLLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYR 454

Query: 369 QCVKSLEEDLEVLNSLD 385
           QCV+ +E +L+ LN LD
Sbjct: 455 QCVQEIEANLKTLNELD 471

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  227 bits (579), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 123/276 (44%), Positives = 170/276 (61%), Gaps = 29/276 (10%)

Query: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDI 60
           MFS  SL+ IT+S++ AAQ+T +  S+AI      DP T+LS+  ++   QE++GTVHDI
Sbjct: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAI--TTATDPATKLSLRSQKRLFQESIGTVHDI 58

Query: 61  SQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF 120
           S LP QY  LE ++DALEK  +R+L+V+KTFE+EGYDYPPNL+ESF+DWWS +       
Sbjct: 59  STLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLS------- 111

Query: 121 SKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQ 180
               ++   E ++  + G LPRSFAQA+S +A D   I + +             +G D+
Sbjct: 112 ----SKKKKEQEKEDKKGFLPRSFAQAISNSAEDCVEIYQHV------------NDGDDE 155

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNA 240
                                      NLIK F+SW KC  +IDQ KAEMDS+M+KEFNA
Sbjct: 156 ----DKEENANNEEENEEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNA 211

Query: 241 KLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKL 276
           KL KL+  +FKK H LR +V+D+RL FDT+R+E+K+
Sbjct: 212 KLEKLLNEEFKKVHTLRKRVKDSRLKFDTVRYELKV 247

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 56/74 (75%)

Query: 312 DMAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCV 371
           D A  ++  + KL E+LED FVS+T+  VE + E+TDSSEII LVKLF NFQL++Y+QCV
Sbjct: 370 DKAIEDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCV 429

Query: 372 KSLEEDLEVLNSLD 385
           + +E +L+ LN L+
Sbjct: 430 QEIEANLKTLNELE 443

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  223 bits (569), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 145/432 (33%), Positives = 218/432 (50%), Gaps = 93/432 (21%)

Query: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDI 60
           MF K +L +IT SIS   Q   +QF         +DP+T+LSI  +   LQE +G   DI
Sbjct: 1   MF-KFNLESITQSISEGTQSLVQQF---------NDPKTKLSIKAKTRFLQEAIGNERDI 50

Query: 61  SQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF 120
           S+LP QY  LE+K D++EK+ KR+L+VTKT+E+EGYDYPPN++ES + WW   +   F+ 
Sbjct: 51  SKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKE--WFNI 108

Query: 121 SKKKAEVSPEV----------------KETAENGLLPRSFAQALSKAATDSALILKQLKA 164
           S+    V P+                 KE +  G  P SFA A+++A  DS LI + ++ 
Sbjct: 109 SELTKNVIPKHGNVEKAGTEASKTLTDKEVSHEG--PPSFASAIARAGKDSQLIFESIET 166

Query: 165 EETRTNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSID 224
           ++    ++  +                                 L+K F+ W+ C   I 
Sbjct: 167 KDEDEKEDIDE---------------------------------LVKIFKIWSDCFYEIS 193

Query: 225 QSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQXXXXX 284
            SK EMD +M+KEFN KL   ++ +F+K H LRAKV+++RLNFDT+R+E+    +     
Sbjct: 194 DSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQTSKQTDSK 253

Query: 285 XXXXXXXXXXXXXXXXXXXXXXXXXXXDMAKTEEDP------------------------ 320
                                      D  +T+E                          
Sbjct: 254 ELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETKETKDTKDSEDLKE 313

Query: 321 DSK------LFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSL 374
           DSK      L E+LED+FVS T+E VE + E++++SE++SL+KLF  FQL +++ CVKSL
Sbjct: 314 DSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSL 373

Query: 375 EEDLEVLNSLDS 386
           E+ L+ LN++D+
Sbjct: 374 EQSLKDLNAIDN 385

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  218 bits (556), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/285 (42%), Positives = 177/285 (62%), Gaps = 32/285 (11%)

Query: 2   FSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLD--DPETRLSILKRRHQLQETLGTVHD 59
           FS  SL+ + DS+ +AAQ+TQ+  S+AI+ +++D  DP+TRL++L ++H LQE++G +++
Sbjct: 30  FSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIGQINE 89

Query: 60  ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGN-----K 114
           IS+LP QY  LE+K+DALEKI KR+L+VT TFE+EGYDYPPNL+ES ++WW  +     +
Sbjct: 90  ISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPLAFLR 149

Query: 115 DSIFSFSKKKAEVSPE-----VKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRT 169
           D+  +  K K+  +P          +E+  LPRSF  A+SKA++DS+ IL       T  
Sbjct: 150 DNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAIL-------TNL 202

Query: 170 NQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAE 229
           N  E  E A                              LIK F+SW+ C  +ID+SK +
Sbjct: 203 NNNEKLEFAKTKTEDEEYEDDEDIQL-------------LIKVFDSWSLCNKNIDKSKFQ 249

Query: 230 MDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEI 274
            D L++K+FN KL+ L++ +FK    LR KVQDARL FDT+R+EI
Sbjct: 250 RDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRYEI 294

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 51/67 (76%)

Query: 321 DSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEV 380
           D KL E LED+FVS TS  VE + E+T+SS+I+ L+KLF NFQL+HY+QC+K +E ++++
Sbjct: 377 DEKLLEHLEDEFVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKL 436

Query: 381 LNSLDSE 387
           L  L  E
Sbjct: 437 LTDLTHE 443

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  196 bits (499), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 166/278 (59%), Gaps = 20/278 (7%)

Query: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHD- 59
           MFS  SL+ +T +I+NAAQ  Q+   + I      D +T+L  LK     QE +GT+ + 
Sbjct: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTILS---PDAQTKLQFLKTTRYFQEKVGTISED 57

Query: 60  -ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIF 118
            I++LP  Y+ L++KS+A+EK+ KRLL+VTKTFE+EGYDYPPN+TES N WW  N+D   
Sbjct: 58  EIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWW--NEDE-- 113

Query: 119 SFSKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEE----TRTNQEES 174
             +KKK     + ++  ++ +L RSFA A+ KA  DS  IL  LK ++    T   + + 
Sbjct: 114 --NKKK-----KTQDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKR 166

Query: 175 QEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLM 234
           +E A+                            N+I AF  W+ C  +IDQSKAEMDS++
Sbjct: 167 EEEAEAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQSKAEMDSMI 226

Query: 235 VKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRH 272
           VKEFN KL+ ++E DFK  H+L  +VQD+RL FDTLRH
Sbjct: 227 VKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 45/58 (77%)

Query: 330 DQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDSE 387
           D+FVS  +  VE + ELTDSSE+ISLVKLF N QL+HY+QCV+ LE  ++ L+ L++E
Sbjct: 391 DEFVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAE 448

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  191 bits (486), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 124/279 (44%), Positives = 154/279 (55%), Gaps = 36/279 (12%)

Query: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHD- 59
           MFS  + + IT+SIS AAQ  Q++ +  I      D +T+L   K     QE +G + D 
Sbjct: 1   MFSNFNFDKITNSISTAAQSAQQKINDTI---LTPDVQTKLHFKKTARFWQEKVGQIPDK 57

Query: 60  -ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIF 118
            IS+LP  Y  LE K DALEKI KRLL+VTKT+E+EGYDYPPNL+ES NDWW  +     
Sbjct: 58  EISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWWWSD----L 113

Query: 119 SFSKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGA 178
             SKK  E S           +  SF  A+SKAA DS  IL  LK         E Q+  
Sbjct: 114 KKSKKHQEKS---------SFMNNSFPMAISKAAFDSKSILDDLK---------EKQQDL 155

Query: 179 DQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVKEF 238
            +                           NL++ F S + C  +ID+SKAEMD+++VKEF
Sbjct: 156 PKEGEEPEEEVEEEDDDEFL---------NLLEVFNSLSNCYKNIDKSKAEMDAMIVKEF 206

Query: 239 NAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLK 277
           N KL  LI  DFKK  +LR KVQD+RL FDTLRHEIKLK
Sbjct: 207 NFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLRHEIKLK 245

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 39/69 (56%), Positives = 54/69 (78%)

Query: 317 EEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEE 376
           EE  + KL E+LED+FVS T   VE + ELT++SE+I+LVKLF NFQLIHYKQCV+ +E 
Sbjct: 347 EETEEYKLLEKLEDEFVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIEN 406

Query: 377 DLEVLNSLD 385
           +++ L+ L+
Sbjct: 407 NMKFLDQLE 415

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 98/390 (25%), Positives = 164/390 (42%), Gaps = 99/390 (25%)

Query: 5   LSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQ--LQETLGTVHDISQ 62
           +S N+ T+S+S   Q+ QE  ++  EK    +  T +  L    Q  +QE LG V DISQ
Sbjct: 1   MSFNSFTNSLS---QKFQELSTAVSEKTQ--EFSTSIPTLAESTQRLVQEKLGNVTDISQ 55

Query: 63  LPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFSK 122
           LP +Y  LE++ D ++ + +  L +T  +E E YDYP  +++S ND+          F+ 
Sbjct: 56  LPQEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVSDSVNDFSK-------VFAN 108

Query: 123 KKAEVSPEVK-ETAENGLL-------PRSFAQALSKAATDSALILKQLKAEETRTNQEES 174
           K  E+S     + A+N L+       PR+   ALSK A +S+  L QL          + 
Sbjct: 109 KVTELSHATSAQEAQNILVTPGPAKEPRTLNYALSKVALNSSESLAQLA---------DP 159

Query: 175 QEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLM 234
            EG                               +  A   ++  Q  I Q++   D+L+
Sbjct: 160 NEGP------------------------------VADALLKFSDVQAKIAQTRLHQDTLI 189

Query: 235 VKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQXXXXXXXXXXXXXXX 294
             +FN +L + +E D  K  + R  VQ  RL +D  R ++                    
Sbjct: 190 QTKFNKQLREKLELDIGKASKARKDVQYKRLQYDVARSKLT------------------- 230

Query: 295 XXXXXXXXXXXXXXXXXDMAKTEEDPDSKL-FERLEDQFVSATSETVEFLGELTDSSEII 353
                              AK E++   ++  E LE+QF  +T +    + E+   S+ +
Sbjct: 231 ------------------QAKPEKEASLRVEMESLEEQFAQSTEDATIIMQEVIADSKFL 272

Query: 354 SLVKLFHNFQLIHYKQCVKSLEEDLEVLNS 383
           S +K     QL +++   + L+E + VL+S
Sbjct: 273 SSLKELAEAQLSYFETSAQLLKEFMPVLDS 302

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 100/405 (24%), Positives = 161/405 (39%), Gaps = 109/405 (26%)

Query: 5   LSLNNITDSISNAAQRTQEQFSSAIEKIHLD---------------DPETRLSILKRRHQ 49
           +S N+  DS++   Q    Q S   ++  LD               D  T+L  L +  Q
Sbjct: 1   MSFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQ 60

Query: 50  --LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFN 107
             +QE LG V DISQLP  Y  LE K D ++ + +  L VT+ +E E YDYP N+ +S N
Sbjct: 61  RLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVN 120

Query: 108 DWWS--GNKDSIFSFSKKKAE-----VSPEVKETAENGLLPRSFAQALSKAA-TDSALIL 159
           ++ S  G K    S +    E     +SP   +       P++   ALSK A T S  + 
Sbjct: 121 EFSSIVGTKLHELSRATSTNEAQSVLISPGPHKD------PKTLNYALSKVALTSSEYLN 174

Query: 160 KQLKAEETRTNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKC 219
           K   AE++  +                                     +L+K    ++  
Sbjct: 175 KSPGAEDSEVS------------------------------------SSLLK----YSDV 194

Query: 220 QLSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQ 279
           Q  I Q++   D+L+  +FN KL   +  D  +  + R  V++ RL +D  R  +     
Sbjct: 195 QAKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRLQYDIARANLA---- 250

Query: 280 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMAKTEEDPDSKL-FERLEDQFVSATSE 338
                                             A+ E++   ++  E LED+F  AT +
Sbjct: 251 ---------------------------------NARPEKEASLRVQMESLEDEFAQATDD 277

Query: 339 TVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNS 383
            V  + ++ +SSE++  ++     Q  +YKQ  + L E L  L S
Sbjct: 278 AVVIMQKVAESSELLKDLRELVAAQAEYYKQSAELLSEFLPQLES 322

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 79.7 bits (195), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 93/382 (24%), Positives = 156/382 (40%), Gaps = 99/382 (25%)

Query: 6   SLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQL-QETLGTVHDISQLP 64
           + NN T+S++   Q      S   ++I  + P    S+ +   +L QE LG V DISQLP
Sbjct: 3   TFNNFTNSLNQKFQELSTAVSQRTQEISTNLP----SLTQSTQRLVQERLGQVTDISQLP 58

Query: 65  IQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWS--GNKDSIFSFSK 122
            +Y  LE+K D ++ I +  L VT  +E E YDYP  +TES ND+     +K    S + 
Sbjct: 59  REYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVTESVNDFSKIVAHKVQELSHAS 118

Query: 123 KKAEVSPEVKETAENGLL-------PRSFAQALSKAATDSALILKQLKAEETRTNQEESQ 175
             +E        A+N L+       PR+   ALSK +  S+  L  +       + +E+Q
Sbjct: 119 SASE--------AQNILITPTPAKEPRTLNYALSKVSLISSEYLNHIG------DHDEAQ 164

Query: 176 EGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMV 235
             +                              L+K    ++  Q  + Q++ + D+++ 
Sbjct: 165 VAS-----------------------------VLLK----YSDLQAKVAQARLQQDTMIQ 191

Query: 236 KEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQXXXXXXXXXXXXXXXX 295
             FN +L   +E +FKK  + R  V+  RL +D  R  +                     
Sbjct: 192 TRFNKQLKDNLEHNFKKAQKARKDVEYKRLQYDVARSNLA-------------------- 231

Query: 296 XXXXXXXXXXXXXXXXDMAKTEEDPDSKL-FERLEDQFVSATSETVEFLGELTDSSEIIS 354
                             AK E++   ++  E LEDQF  AT +    + E+  +++   
Sbjct: 232 -----------------QAKPEKEASLRVQMETLEDQFAQATEDATIIMQEVLSNAKFTE 274

Query: 355 LVKLFHNFQLIHYKQCVKSLEE 376
            +K   N QL +++     +EE
Sbjct: 275 EIKEMANAQLTYHQTSASLIEE 296

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 93/405 (22%), Positives = 155/405 (38%), Gaps = 109/405 (26%)

Query: 5   LSLNNITDSISNAAQRTQEQFSSAIEKIHLD---------------DPETRLSILKRRHQ 49
           +S NN  DS++   Q    Q S   +   LD               D  T+L    +  Q
Sbjct: 1   MSFNNFADSVNKKLQELSSQVSQRAQDAQLDKKFRDLSSAVSQRTQDLTTQLPSFAQSTQ 60

Query: 50  --LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFN 107
             +QE LG V DISQLP +Y  LE K D +  + +  L VT+ +E E YDYP N+ +S N
Sbjct: 61  RLVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVRDSVN 120

Query: 108 DWWSGNKDSIFSFSKKKAEVSPEVKETAENGLL-------PRSFAQALSKAA-TDSALIL 159
           ++ S     +   S+  +         A++ L+       P++   ALSK A T S  + 
Sbjct: 121 EFSSVVAGKLHDLSRATS------TNEAQSVLIAPGPHKDPKTLNYALSKVALTSSEYLN 174

Query: 160 KQLKAEETRTNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKC 219
           K +  +++  +                                         A   ++  
Sbjct: 175 KSVGGDDSEVS----------------------------------------NALLKYSDV 194

Query: 220 QLSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQ 279
           Q  + Q++ + D+L+   FN KL  ++  D  +  + R  V+  RL +D  R  +     
Sbjct: 195 QAKVAQARLQQDTLIQTRFNKKLRDILANDLNEAQKARKNVEHKRLQYDIARSNLA---- 250

Query: 280 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMAKTEEDPDSKL-FERLEDQFVSATSE 338
                                             AK E++   ++  E LED+F  AT +
Sbjct: 251 ---------------------------------NAKPEKEASLRVQMESLEDEFAQATDD 277

Query: 339 TVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNS 383
            V  + ++  SSE++  ++     Q  ++KQ  + L E L  L S
Sbjct: 278 AVVVMQKVAGSSELLKELRELVAAQADYHKQSYELLSEFLPQLES 322

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 89/375 (23%), Positives = 148/375 (39%), Gaps = 101/375 (26%)

Query: 10  ITDSISNAAQRTQ-----EQFSSAIEKIHLDDPETRLSILKRRHQ--LQETLGTVHDISQ 62
           ++ S+S  AQ  Q     +  S A+ +    D  T L  L +  Q  +QE LG V DISQ
Sbjct: 17  LSTSVSQKAQEAQLDKKFKDLSQAVSQ-RTQDLTTSLPSLAQSTQRLVQERLGQVTDISQ 75

Query: 63  LPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFSK 122
           LP +Y  LE + D +  + +  L VT+ +E E YDYP N+ +S N++       +   S 
Sbjct: 76  LPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVNEFSKTVSSKLHELSH 135

Query: 123 KKAEVSPEVKETAENGLL-------PRSFAQALSKAA-TDSALILKQLKAEETRTNQEES 174
             +       + A+N L+       P++   ALSK A T S  + K    +ET       
Sbjct: 136 ASS------TDEAQNILISPGPAKDPKTLNYALSKVALTSSEYLSKSGHEDET------- 182

Query: 175 QEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLM 234
                                             +  A   ++  Q  I Q++ + D+L+
Sbjct: 183 ----------------------------------IATALLKYSDVQAKIAQARLQQDTLI 208

Query: 235 VKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQXXXXXXXXXXXXXXX 294
             +FN KL + + +D  K  + R +V++ RL +D  R  +                    
Sbjct: 209 QTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIARANLA------------------- 249

Query: 295 XXXXXXXXXXXXXXXXXDMAKTEEDPDSKL-FERLEDQFVSATSETVEFLGELTDSSEII 353
                              AK E++   ++  E LED+F  AT +    + ++  SSE +
Sbjct: 250 ------------------NAKPEKEASLRVQMESLEDEFAQATEDATGVMQDVIASSEFL 291

Query: 354 SLVKLFHNFQLIHYK 368
             +    + QL +YK
Sbjct: 292 KDLSELVSAQLAYYK 306

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 70.5 bits (171), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 111/273 (40%), Gaps = 64/273 (23%)

Query: 12  DSISNAAQRTQEQFSSAIEKIHLD----DPETRLSILKRRHQ--LQETLGTVHDISQLPI 65
           DS S   Q      S   ++  LD    D +T L +L    Q  LQE LG V DISQLP 
Sbjct: 6   DSFSKKVQELSTSVSQKAQEAQLDQKFKDLKTNLPLLANSTQRMLQEKLGQVTDISQLPD 65

Query: 66  QYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFSKKKA 125
           +Y  LE + + ++ I +  L VTK +E E YDYP N+ ES +++       +   SK   
Sbjct: 66  EYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSKLVGGKLHDLSKVTN 125

Query: 126 EVSPEVKETAENGLL-------PRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGA 178
                 +E A+N LL       P++   ALSK A  S                  S+   
Sbjct: 126 ------REQAQNVLLSSPQMKEPKTLNYALSKVALTS------------------SEHVE 161

Query: 179 DQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVKEF 238
           D+                           +L      ++  Q  I Q + + D+++  +F
Sbjct: 162 DE---------------------------SLANFLAKYSDSQTKIAQLRLQQDTMIQTKF 194

Query: 239 NAKLSKLIETDFKKGHELRAKVQDARLNFDTLR 271
           N  + + +E D +   + R  V+  RL +D +R
Sbjct: 195 NKAIKEKLEQDIETSTKARKLVEQKRLQYDVVR 227

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 84/377 (22%), Positives = 148/377 (39%), Gaps = 96/377 (25%)

Query: 12  DSISNAAQRTQEQFSSAI-EKIHLDDPETRLSILKRRHQ--LQETLGTVHDISQLPIQYK 68
           +S +N+ +   + FS+ + +K H  +  T +  L +  Q  +QE LG V DISQLP +Y 
Sbjct: 5   NSFANSLRENLQSFSNTVSQKTH--ELSTNIPTLAQSTQRMVQEKLGQVTDISQLPQEYL 62

Query: 69  FLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFSKKKAE-- 126
            LE K D ++ + +  L VT  +E E YDYP  ++ES N++       +   SK  +   
Sbjct: 63  ELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAKVQELSKATSATE 122

Query: 127 -----VSP-EVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGADQ 180
                V+P  VKE       P++   A+SK A +++  L                     
Sbjct: 123 AQNILVAPGPVKE-------PKTLNYAMSKVALNASEYLNH------------------- 156

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNA 240
                                       L K   +++  Q  + Q++ + D+ +  +FN 
Sbjct: 157 -------------------SFDDPMDAKLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNK 197

Query: 241 KLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQXXXXXXXXXXXXXXXXXXXXX 300
            + + +     + ++ R  VQ  RL +D  R  ++                         
Sbjct: 198 VIRENLAESIARANKARKDVQSKRLQYDVARTNLQ------------------------- 232

Query: 301 XXXXXXXXXXXDMAKTEEDPDSKL-FERLEDQFVSATSETVEFLGELTDSSEIISLVKLF 359
                        AK E++   ++  E LEDQF  AT +    + E+  S+  +  +K  
Sbjct: 233 ------------NAKPEKEAGLRVQMETLEDQFAQATEDATVVMQEVIASANFLPSLKEL 280

Query: 360 HNFQLIHYKQCVKSLEE 376
              QL +Y+Q  K ++E
Sbjct: 281 ATAQLEYYEQSAKLMKE 297

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 97/230 (42%), Gaps = 54/230 (23%)

Query: 50  LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDW 109
           +QE LG V DISQLP +Y  LE K D ++ I    L VT  +E   YDYP  + ES N++
Sbjct: 39  VQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEF 98

Query: 110 WSGNKDSIFSFSKKKAEVSPEVKET-AENGLL-------PRSFAQALSKAATDSALILKQ 161
            S       S + K  E++     + A+N L+       P++   ALSK A +S+  L +
Sbjct: 99  SS-------SLASKLTELTHATSASQAQNILVAPGPIKEPKTLNYALSKVALNSSECLNK 151

Query: 162 LKAEETRTNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQL 221
           +   E +                                        L  +   ++  Q 
Sbjct: 152 MFPTEEQP---------------------------------------LASSLLQFSDVQA 172

Query: 222 SIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLR 271
            I Q++ + D+L+  +FN KL + +  +  K  + R +V   RL +D  R
Sbjct: 173 KIAQARIQQDTLIQTKFNKKLRERVSFEIGKADKCRKEVHSMRLRYDVAR 222

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 98/229 (42%), Gaps = 51/229 (22%)

Query: 50  LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDW 109
           +QE LG V DISQLP +Y  LE+K D+++ I +  L VT  +E E YDYP  + +S ND+
Sbjct: 44  VQEKLGQVTDISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIKDSVNDF 103

Query: 110 WSGNKDSIFSFSKKKAEVSPEVKETAENGLL-------PRSFAQALSKAATDSALILKQL 162
                  I   S   +         A+N L+       P++   ALSK +  ++ ++ Q+
Sbjct: 104 SKTMAAKITDLSHASS------ASEAQNILISPGPIRDPKTLNYALSKVSLTASEVINQV 157

Query: 163 KAEETRTNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLS 222
            +    T  E +                                  L      ++  Q  
Sbjct: 158 GS----TPNESA----------------------------------LSSKLLEFSNVQSK 179

Query: 223 IDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLR 271
           I Q++ + D+L+  +FN  L   + T   K ++ R +VQ+ RL +D  R
Sbjct: 180 IAQARLQQDTLIQTKFNKALRDDLSTSLAKANKFRKEVQNKRLQYDVAR 228

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 87/394 (22%), Positives = 150/394 (38%), Gaps = 95/394 (24%)

Query: 5   LSLNNITDSISNAAQRTQEQFSSAIEKIHLDDP-----ETRLSILKRRHQLQETLGTVHD 59
           +S NN+  SI  A Q   E  S   +++    P     + RL+        QE LG + D
Sbjct: 1   MSFNNLKSSIGQALQGLSESVSQKTQEMASTWPAYAQVQQRLA--------QEKLGQITD 52

Query: 60  ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWS--GNKDSI 117
           ISQ+P +Y  LE + D L+   + LL VT+ +E   YD+P +  ES  DW    G++   
Sbjct: 53  ISQMPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQESVQDWSRAIGSRVQE 112

Query: 118 FSFSKKKAEVSPEVKETA--ENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQ 175
            S +   +E    +K     ENG  PR+   ALS+A    +L +  L +        E  
Sbjct: 113 LSRASSASEAGNLLKSPVGPENG--PRTLNYALSQA----SLAVSTLTSSNMPGPNGEG- 165

Query: 176 EGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMV 235
                                            L     +++  Q  + Q +   D+ + 
Sbjct: 166 ---------------------------------LSSGLIAYSDTQAKLAQIRIAQDTQVQ 192

Query: 236 KEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQXXXXXXXXXXXXXXXX 295
            +FN +L +++     K ++ R  VQ  R+ +D  R  ++                    
Sbjct: 193 TKFNKQLREILNNPIAKANKYRKDVQYKRVLYDIARTNLQ-------------------- 232

Query: 296 XXXXXXXXXXXXXXXXDMAKTEEDPDSKL-FERLEDQFVSATSETVEFLGELTDSSEIIS 354
                             A+ E++   ++  E LEDQF   T E    + E   ++ ++ 
Sbjct: 233 -----------------NARPEKEASLRVEMETLEDQFAQITEEATIVMQETLSNTHLLK 275

Query: 355 LVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDSED 388
            V      Q  +YKQ ++ + + + V N+   +D
Sbjct: 276 NVAELAEIQKNYYKQSLELMNDLMPVFNTAKGDD 309

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 100/232 (43%), Gaps = 53/232 (22%)

Query: 47  RHQLQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESF 106
           + ++QE LG V DISQ+P +Y  LEQ+ D  + I    L V++ +E E YDYP ++++S 
Sbjct: 60  QRRVQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSV 119

Query: 107 NDWWSGNKDSIFSFSKKKAEVSPEVKETAENGLL-------PRSFAQALSKAATDSALIL 159
           ND+       +   +K          E A++ L+       P++   ALSK A  S+  L
Sbjct: 120 NDFSKTVTGKVQELTK------ATTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYL 173

Query: 160 KQLKAEETRTNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKC 219
                         S+ G+D                             L+K    ++  
Sbjct: 174 --------------SKSGSDDVVTADI----------------------LLK----YSDV 193

Query: 220 QLSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLR 271
           Q  I Q++ + D+L+   FN +L + + T F +  + R +V   RL +D  R
Sbjct: 194 QAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIAR 245

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 102/238 (42%), Gaps = 54/238 (22%)

Query: 42  SILKRRHQL-QETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPP 100
           SI +  H++ QE LG + DISQ+P +Y  +E++ D +  I +  L VT+ +E E YDYP 
Sbjct: 54  SIAQTTHRMVQEKLGQITDISQMPEEYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQ 113

Query: 101 NLTESFNDWWSGNKDSIFSFSKKKAEVSPEVKETAENGLL-------PRSFAQALSKAAT 153
           +++ES N+        I   +K  +       E A+N L+       P++   ALSK + 
Sbjct: 114 HVSESVNEISKTVTGKIQELTKATS------TEEAQNILISPGPAKDPKTLNYALSKVSL 167

Query: 154 DSALILKQLKAEETRTNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAF 213
            S+  L              S+ G+D                             L+K  
Sbjct: 168 TSSEYL--------------SKSGSDSNVTADI----------------------LLK-- 189

Query: 214 ESWTKCQLSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLR 271
             ++  Q  I Q++ + D L+   FN +L + +  +F      R +V + RL +D  R
Sbjct: 190 --YSDIQAQIAQARLQQDMLIRTRFNKQLKEKLNNEFAAAARARKEVDNKRLQYDIAR 245

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 95/231 (41%), Gaps = 56/231 (24%)

Query: 50  LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDW 109
           +QE LG V DISQLP +Y  LE+K D ++ I    L VT  +E   YDYP  + ES N++
Sbjct: 39  VQERLGQVTDISQLPREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEF 98

Query: 110 WSGNKDSIFSFSKKKAEVSPEVKET-AENGLL-------PRSFAQALSKAATDSALIL-K 160
                    S + K  E++     + A+N L+       P++   ALSK A +S+  L K
Sbjct: 99  SR-------SVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNK 151

Query: 161 QLKAEETRTNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQ 220
            L  EE                                          L  A   ++  Q
Sbjct: 152 MLPTEE----------------------------------------QPLASALLQFSDVQ 171

Query: 221 LSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLR 271
             I Q++ + D+L+  +FN  L + +  +  K  + R  V   RL +D  R
Sbjct: 172 AKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKTRKDVHSMRLRYDVAR 222

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 95/231 (41%), Gaps = 56/231 (24%)

Query: 50  LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDW 109
           +QE LG V DISQLP +Y  LE K D ++ I    L VT  +E   YDYP  + ES N++
Sbjct: 39  VQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEF 98

Query: 110 WSGNKDSIFSFSKKKAEVSPEVKET-AENGLL-------PRSFAQALSKAATDSALIL-K 160
                    S + K  E++     + A+N L+       P++   ALSK + +S+  L K
Sbjct: 99  SR-------SVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVSLNSSECLNK 151

Query: 161 QLKAEETRTNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQ 220
              AEE                                          L  A   ++  Q
Sbjct: 152 MFPAEE----------------------------------------QPLASALLQFSDVQ 171

Query: 221 LSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLR 271
             I Q++ + D+L+  +FN KL + +  +  K  + R  V   RL +D  R
Sbjct: 172 AKIAQTRIQQDTLIQTKFNKKLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 95/228 (41%), Gaps = 47/228 (20%)

Query: 50  LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDW 109
           +QE LG V DISQLP +Y  LE++ DAL+ + +  L VT  +E E YDYP  + +S N+W
Sbjct: 44  VQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVRDSVNEW 103

Query: 110 WS--GNKDSIFSFSKKKAE----VSPEVKETAENGLLPRSFAQALSKAATDSALILKQLK 163
                 + S        AE    ++   +ET      P++   ALSK A + + ++  L 
Sbjct: 104 SRTVATRVSELRHVSSAAEAQHVIAAPTQETE-----PKTLHYALSKVALNGSQLVDNLD 158

Query: 164 AEETRTNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSI 223
           A   RT +E                                    L      ++  +  +
Sbjct: 159 A--PRTPRE----------------------------------TQLSSGLLEFSGVEAEL 182

Query: 224 DQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLR 271
            Q++ E D+ +  +FN KL   +  +  +    R +V   RL +D  R
Sbjct: 183 AQARLEQDAAVKAQFNEKLRGQLSGEIARAAAARKEVFQKRLQYDVAR 230

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 90/368 (24%), Positives = 148/368 (40%), Gaps = 105/368 (28%)

Query: 17  AAQRTQEQFSSAIEKIH-LDDPETRLSILKRRHQLQETLGTVHDISQLPIQYKFLEQKSD 75
            +Q+TQE FS+ +  I+ L     R+        +QE LG V DISQLP +Y  LE+K D
Sbjct: 22  VSQKTQE-FSTNMPDINSLAQSTQRM--------VQERLGQVTDISQLPEEYLQLERKID 72

Query: 76  ALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFSK----KKAEVSPEV 131
            ++ +    L VT TFE + YDY PN+           ++S+  FSK    K  E+S   
Sbjct: 73  TIKSVYDNFLSVTNTFEHQSYDY-PNVA----------RESVIEFSKSAVSKVEELSHAT 121

Query: 132 KETAENGLL---------PRSFAQALSKAATDSALIL-KQLKAEETRTNQEESQEGADQX 181
             +    +L         P++   ALSKA+  S+  L KQ   +      +++   +D  
Sbjct: 122 SASEAQQILTNNSNQIKEPKTLNYALSKASLISSEQLNKQFSTD------DDNNSNSDFK 175

Query: 182 XXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFNAK 241
                                      L+K    ++  Q  I Q++ + D L+ ++FN  
Sbjct: 176 LVSSI----------------------LLK----FSDIQAKIAQARLQQDLLIKQKFNNN 209

Query: 242 LSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQXXXXXXXXXXXXXXXXXXXXXX 301
           L   + T F++  ++R  VQ+ RL +D  R  +                           
Sbjct: 210 LRNDLNTSFERAQKVRKDVQNKRLQYDVARTNLL-------------------------- 243

Query: 302 XXXXXXXXXXDMAKTEEDPDSKL-FERLEDQFVSATSETVEFLGELTDSSEIISLVKLFH 360
                       AK E++   ++  E LEDQF  AT      + E+ ++S  +  +    
Sbjct: 244 -----------NAKPEKEASLRVQMELLEDQFAQATEHATLVMNEIIENSNFMEYLNELA 292

Query: 361 NFQLIHYK 368
             QL +Y+
Sbjct: 293 RAQLAYYQ 300

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 94/230 (40%), Gaps = 54/230 (23%)

Query: 50  LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDW 109
           +QE LG V DISQLP +Y  LE K D ++ I    L VT  +E   YDYP  + ES N++
Sbjct: 39  VQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEF 98

Query: 110 WSGNKDSIFSFSKKKAEVSPEVKET-AENGLL-------PRSFAQALSKAATDSALILKQ 161
                    S + K  E++     + A+N L+       P++   ALSK A +S+  L +
Sbjct: 99  SR-------SVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNK 151

Query: 162 LKAEETRTNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQL 221
           +   E +                                        L  A   ++  Q 
Sbjct: 152 MFPTEEQP---------------------------------------LASALLQFSDVQA 172

Query: 222 SIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLR 271
            I Q++ + D+L+  +FN  L + +  +  K  + R  V   RL +D  R
Sbjct: 173 KIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 89/372 (23%), Positives = 147/372 (39%), Gaps = 103/372 (27%)

Query: 12  DSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQ--LQETLGTVHDISQLPIQYKF 69
           +S +N+  +T  + SS + +    +  T L  L +  Q  +QE LG V DISQLP +Y  
Sbjct: 5   NSFTNSFSKTLSELSSTVSQ-KTQELSTNLPNLAQSTQRMVQERLGQVTDISQLPEEYLE 63

Query: 70  LEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFSKKKAEVSP 129
           LE K D++++I    L V+  +E + YDYP         + +  K+S+  FSK  A    
Sbjct: 64  LEMKLDSIKQIYDNFLAVSSVYEQQSYDYP---------YVA--KESLIEFSKTAASKVE 112

Query: 130 EVKET-----AENGLL--------PRSFAQALSKAATDSALILKQLKAEETRTNQEESQE 176
           E+        A+N L         P++   ALSK A  S+  L Q        N  E+ +
Sbjct: 113 ELSHASSAHEAQNILTTSSTQIKEPKTLNFALSKVALKSSEHLNQF-------NDNEAFK 165

Query: 177 GADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKAFESWTKCQLSIDQSKAEMDSLMVK 236
            +                                 A  +++  Q  I Q++ + D L+ +
Sbjct: 166 SS-------------------------------ASALLNFSNIQAKIAQARLQQDLLIKQ 194

Query: 237 EFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQXXXXXXXXXXXXXXXXX 296
           +FN  L   + T+  K  ++R +VQ  RL +D  R  +                      
Sbjct: 195 KFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLM--------------------- 233

Query: 297 XXXXXXXXXXXXXXXDMAKTEEDPDSKL-FERLEDQFVSATSETVEFLGELTDSSEIISL 355
                            AK E++   ++  E LED F  AT      + ++ D+S+I+S 
Sbjct: 234 ----------------NAKPEKEASLRVQMETLEDDFAQATEHATIVMQDVIDNSDIVSR 277

Query: 356 VKLFHNFQLIHY 367
           V      QL ++
Sbjct: 278 VNELARAQLAYF 289

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 65/121 (53%), Gaps = 13/121 (10%)

Query: 50  LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDW 109
           +QE LG V DISQLP +Y  LE++ D ++ + +  L +T  ++ E YDYP  +++S ND+
Sbjct: 43  VQEKLGNVTDISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPKYVSDSVNDY 102

Query: 110 WSGNKDSIFSFSKKKAEVSPEVKETAENGLL-------PRSFAQALSKAATDSALILKQL 162
               +  I   S+  +       E A+N L+       PR+   ALSK A  S+  L QL
Sbjct: 103 SKLFQSKIEDLSRATS------AEEAQNILVTPGPITEPRTLNYALSKVALTSSESLNQL 156

Query: 163 K 163
           +
Sbjct: 157 Q 157

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 54/107 (50%), Gaps = 7/107 (6%)

Query: 50  LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDW 109
           ++E LG V DIS LP +Y  LE K D  + + +  L +T  +E E YDYP   +ES N++
Sbjct: 39  VKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFSESVNEF 98

Query: 110 WSGNKDSIFSFSKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSA 156
                + ++ FS         V     +G  PR+   A+SK +  ++
Sbjct: 99  TDSIGNKMYEFSNG-------VSTEGSSGKTPRTLNYAVSKVSMGAS 138

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 89/239 (37%), Gaps = 61/239 (25%)

Query: 50  LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDW 109
           +QE  G V DIS LP +Y  LEQ+ D+++ +    L +T  +E E YDYP ++ +S  ++
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

Query: 110 WSGNKDSIFSFSKK----------KAEVSPEVKETAENGLL-------PRSFAQALSKAA 152
                  +     K             V P     +  G +       PR+   ALSKAA
Sbjct: 61  QKTASSRVQELQTKISNSSDNSHSSGSVEPMRTSVSSVGSINNYNQNSPRTLNNALSKAA 120

Query: 153 TDSALILKQLKAEETRTNQEESQEGADQXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIKA 212
             +A  LK  K   T                                             
Sbjct: 121 LFAAEQLKMDKDSST--------------------------------------------V 136

Query: 213 FESWTKCQLSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLR 271
           F S+++ +  I   + + D ++ K FN +L  ++       ++ R  VQ+ RL +D  R
Sbjct: 137 FHSFSEAESIISDERIKQDKIIQKSFNTELKNVLTNRIDVANKHRKDVQNKRLQYDISR 195

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 50  LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDW 109
           ++E LG   DIS LP +Y  LE K D +++I +  L VT  +E E YDYP    ESF  W
Sbjct: 39  MKEKLGQAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESF--W 96

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 37/60 (61%)

Query: 50  LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDW 109
           +QE LG   DIS++P +Y  L  K DA++ I    L VT+ ++ E YDYP  + ES N++
Sbjct: 39  MQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYINESINEF 98

>Kwal_26.7212 s26 (267411..269165) [1755 bp, 584 aa] {ON} YAL011W -
           Hypothetical ORF [contig 47] FULL
          Length = 584

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%)

Query: 38  ETRLSILKRRHQLQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEV 93
           ETR   +KRR + +ET  T    SQ P Q K L Q +D  + I    L+  K  E+
Sbjct: 218 ETRKQPIKRRSRKEETTQTQRSRSQTPRQKKVLPQSTDDQKMITNLNLMAQKNSEL 273

>Suva_11.150 Chr11 (282785..285430) [2646 bp, 881 aa] {ON} YKL073W
           (REAL)
          Length = 881

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%), Gaps = 13/69 (18%)

Query: 211 KAFESWTKCQLSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTL 270
           KA  +W +  +S  +S  E+++L+ K                G +LR ++ + +L FDT 
Sbjct: 745 KALSTWEETLISFKKSITEIEALLAKNL-------------FGEDLRERLFEVKLGFDTY 791

Query: 271 RHEIKLKLQ 279
           R  ++ KL+
Sbjct: 792 RANLEEKLR 800

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,311,017
Number of extensions: 1261471
Number of successful extensions: 4635
Number of sequences better than 10.0: 64
Number of HSP's gapped: 4737
Number of HSP's successfully gapped: 110
Length of query: 389
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 278
Effective length of database: 40,753,473
Effective search space: 11329465494
Effective search space used: 11329465494
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)