Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E04027g3.495ON1581588221e-114
AFR314W3.495ON1551533572e-43
Ecym_12343.495ON1611513427e-41
KNAG0B007803.495ON1531332912e-33
Smik_6.2293.495ON1651662828e-32
NDAI0G009103.495ON1631612801e-31
Kwal_55.212463.495ON1601522722e-30
KAFR0C019903.495ON1511542713e-30
TDEL0D056303.495ON1501542661e-29
YGR133W (PEX4)3.495ON1831602682e-29
CAGL0I10450g3.495ON1621602662e-29
KLTH0F14894g3.495ON1661522644e-29
Suva_7.4213.495ON1651602627e-29
Skud_7.4443.495ON1621602628e-29
Kpol_480.133.495ON1571522618e-29
ZYRO0D09878g3.495ON1531542531e-27
NCAS0E007803.495ON1711662444e-26
SAKL0F02706g3.495ON1611562419e-26
TPHA0D042603.495ON1581542252e-23
TBLA0C045003.495ON1651552219e-23
YOR339C (UBC11)7.54ON1561541982e-19
KNAG0A048108.375ON2141141971e-18
TBLA0H031308.375ON2141191952e-18
Suva_2.2183.308ON1481161903e-18
Skud_4.3143.308ON1481161903e-18
YDR059C (UBC5)3.308ON1481161903e-18
Skud_15.5047.54ON1561531904e-18
KAFR0C002703.308ON1471451895e-18
Smik_4.2973.308ON1481161886e-18
Kpol_1030.108.375ON2151141918e-18
TPHA0L008508.375ON2161141919e-18
Smik_15.5177.54ON1561481871e-17
KLLA0C18656g8.375ON2281141911e-17
ZYRO0C03784g8.375ON2181161901e-17
TDEL0H039707.54ON1561251852e-17
Suva_4.3263.308ON1481451852e-17
Skud_4.4418.375ON2151141883e-17
Suva_2.3438.375ON2151141873e-17
Smik_4.4258.375ON2151141873e-17
NCAS0B031508.375ON2141141873e-17
KNAG0J023403.308ON1611261843e-17
Skud_2.2073.308ON1481451833e-17
Smik_2.2193.308ON1481451833e-17
YBR082C (UBC4)3.308ON1481451833e-17
SAKL0A00396g8.375ON2151401873e-17
YDR177W (UBC1)8.375ON2151141873e-17
CAGL0E00671g8.375ON2131421874e-17
NDAI0A011608.375ON2161141858e-17
CAGL0E04752g3.308ON1471161791e-16
NDAI0A054903.308ON1471161791e-16
NCAS0A108003.308ON1481161791e-16
SAKL0B10582g7.54ON1611251792e-16
NDAI0I016506.109ON1761221802e-16
Suva_8.3897.54ON1561251792e-16
Kpol_1065.127.54ON1591251773e-16
TDEL0F021003.308ON1471471764e-16
NDAI0E038707.54ON1641251765e-16
Kwal_14.18286.109ON1521221755e-16
Ecym_74313.308ON1471471746e-16
KLTH0E14300g3.308ON1471161746e-16
SAKL0B06512g3.308ON1471161746e-16
AER173C3.308ON1471161746e-16
NCAS0D032206.109ON1711221757e-16
KLTH0H06732g6.109ON1601221758e-16
Kwal_23.64858.375ON2151141779e-16
Kwal_27.124013.308ON2361131781e-15
KAFR0B060608.375ON2131421771e-15
ZYRO0G12870g3.308ON1471471731e-15
TBLA0F024406.109ON1741221741e-15
KLLA0E12563g3.308ON1481471721e-15
TBLA0I021303.308ON1481471722e-15
Ecym_60388.375ON2111171752e-15
ADR169C8.375ON2111171752e-15
SAKL0A07260g6.109ON1691221722e-15
TDEL0G036106.109ON1691221722e-15
Ecym_30776.109ON1701221722e-15
AAR156C6.109ON1701221722e-15
Smik_7.2226.109ON1711221722e-15
KLLA0C05632g6.109ON1641221712e-15
Kwal_26.70097.54ON1611251712e-15
KLTH0A07546g8.375ON2151201742e-15
Suva_7.2136.109ON1731221722e-15
TPHA0J017506.109ON1691221723e-15
YGL058W (RAD6)6.109ON1721221723e-15
TDEL0F049908.375ON2171141743e-15
KLTH0D01760g7.54ON1611521703e-15
ZYRO0D04466g7.54ON1591251704e-15
TPHA0A038503.308ON1481471694e-15
Kpol_461.86.109ON1671221704e-15
ZYRO0C04950g6.109ON1681221704e-15
Kpol_1052.23.308ON1481471685e-15
CAGL0I00352g6.109ON1671221696e-15
KAFR0A047006.109ON1531221687e-15
KNAG0F025706.109ON1511221651e-14
Skud_7.2226.109ON1701221634e-14
KAFR0H012303.308ON1101051587e-14
ZYRO0B11682g8.230ON1511341609e-14
TPHA0O009201.436ON2261291604e-13
Kwal_34.161741.436ON2131181594e-13
SAKL0H17930g8.230ON1531481554e-13
CAGL0M03399g1.436ON2141181577e-13
KLTH0H13816g1.436ON2331181578e-13
KNAG0H029808.230ON1521481512e-12
ABR059W2.569ON1651361522e-12
TDEL0A013408.230ON1571171503e-12
KAFR0H029601.436ON1871181513e-12
KNAG0H018701.436ON2101331524e-12
KNAG0M021502.569ON1701601504e-12
KLLA0A11198g1.436ON2021181515e-12
Skud_4.3528.230ON1431051485e-12
NDAI0J015408.230ON1541131486e-12
KAFR0A021602.569ON1651381487e-12
AEL045W1.436ON2111301491e-11
YDR092W (UBC13)8.230ON1531051461e-11
Kpol_1030.181.436ON2231181491e-11
Smik_4.3358.230ON1431051451e-11
KAFR0A024208.230ON1471191451e-11
CAGL0G08063g8.230ON1491191442e-11
TBLA0A012901.436ON2191181482e-11
NCAS0G031301.436ON2311181482e-11
Kpol_1075.1b8.230ON1521451442e-11
TPHA0I024602.569ON1671621452e-11
KLTH0D07986g2.569ON1651351452e-11
TDEL0B065702.569ON1651601433e-11
Ecym_45782.569ON1651391433e-11
YEL012W (UBC8)1.436ON2181181454e-11
SAKL0D13552g2.569ON1651351434e-11
KLLA0C17622g8.230ON1591051424e-11
ZYRO0E03806g1.436ON2091281454e-11
ZYRO0E06358g2.569ON1651651434e-11
SAKL0D10560g1.436ON2071181444e-11
TDEL0B056701.436ON2031181444e-11
KLTH0G14366g8.230ON1491191414e-11
NDAI0D011401.436ON2451181455e-11
Smik_5.981.436ON2151391446e-11
KLLA0E07745g2.569ON1651621416e-11
Suva_5.531.436ON2151391436e-11
Suva_2.2538.230ON1431051407e-11
Kwal_26.82242.569ON1651381417e-11
Ecym_55638.230ON1641471391e-10
TBLA0F037908.230ON1511051381e-10
CAGL0M07568g2.569ON1651371382e-10
NCAS0B040108.230ON1531051372e-10
TPHA0B034108.230ON1521051363e-10
Ecym_13481.436ON2111051393e-10
NCAS0A127402.569ON1651361363e-10
Skud_5.871.436ON2101391384e-10
Kwal_56.234828.230ON1491051345e-10
AGR121C8.230ON1541321346e-10
NDAI0B015202.569ON1651361348e-10
NCAS0A059404.49ON1931151331e-09
Skud_12.3894.49ON1871511296e-09
TBLA0H026102.569ON1651601276e-09
Kpol_1056.52.569ON1651191269e-09
Smik_12.3894.49ON1871151234e-08
Suva_2.2113.301ON2971041245e-08
Smik_4.2903.301ON2971041245e-08
Skud_4.3063.301ON2971041245e-08
CAGL0D06468g4.49ON1871131225e-08
Skud_13.1762.569ON1651391206e-08
NDAI0A055303.301ON2731041237e-08
YDR054C (CDC34)3.301ON2951041237e-08
Smik_13.1862.569ON1651391208e-08
Suva_13.1892.569ON1651391198e-08
TBLA0E015704.49ON1941241191e-07
YMR022W (UBC7)2.569ON1651391181e-07
NCAS0A107703.301ON2731041211e-07
Kpol_414.2singletonOFF1921461182e-07
Kpol_YGOB_414.24.49ON1931461182e-07
ZYRO0G19910g4.49ON1791081172e-07
KAFR0F030404.49ON1691461172e-07
AGL203C3.301ON2701041192e-07
Ecym_26693.301ON2681041183e-07
SAKL0D02530g3.301ON2721041183e-07
KLTH0C04818g3.301ON2751041183e-07
Kpol_1065.453.301ON323961184e-07
TDEL0D032603.301ON2891041174e-07
TBLA0G032703.301ON3301041175e-07
Kpol_483.164.249ON122981116e-07
NDAI0A075703.301ON239961148e-07
Suva_10.4014.49ON1871031138e-07
TPHA0F003904.49ON1931051138e-07
TPHA0M012803.301ON435961141e-06
KLLA0D09196g3.301ON292961141e-06
KAFR0H012703.301ON287961141e-06
CAGL0E04598g3.301ON295961131e-06
NCAS0I014303.301ON258961132e-06
KNAG0H010403.301ON2961041132e-06
AER056C4.249ON1571001102e-06
Ecym_32704.249ON1571001102e-06
NDAI0D029104.49ON1891061103e-06
ZYRO0G12650g3.301ON2851041104e-06
Kwal_27.104443.301ON2781041104e-06
YLR306W (UBC12)4.49ON1881051084e-06
Ecym_83714.49ON267961087e-06
KNAG0I029404.49ON1971051061e-05
KLLA0C17248g4.49ON1841391051e-05
TDEL0E055604.49ON1871071051e-05
SAKL0H03058g4.249ON157921041e-05
Skud_4.1914.249ON157961022e-05
Smik_4.1714.249ON157961022e-05
TPHA0B007704.249ON157861022e-05
YDL064W (UBC9)4.249ON157961022e-05
KNAG0J022803.301ON2171031033e-05
NCAS0A024904.249ON157911013e-05
Suva_4.1864.249ON157961004e-05
TBLA0I029604.249ON15792987e-05
CAGL0D00814g4.249ON15794971e-04
KLTH0D14344g4.249ON157100962e-04
Kwal_23.42274.249ON122100942e-04
KLLA0E05039g4.249ON15784943e-04
NDAI0D043804.249ON15771933e-04
TDEL0E012204.249ON15766934e-04
ZYRO0B12386g4.249ON15772934e-04
SAKL0H24112g4.49ON18569935e-04
KNAG0D043904.249ON15794925e-04
KAFR0G032404.249ON15792900.001
ADL035C4.49ON200104880.003
KLTH0H09504g4.49ON18480820.014
Skud_5.2257.392ON25097740.19
YER100W (UBC6)7.392ON25097710.51
Smik_5.2467.392ON25098700.62
Ecym_46837.392ON243123681.0
KLLA0E20395g7.392ON251120652.6
Suva_5.2197.392ON24997653.2
NDAI0A016507.392ON251120643.4
Skud_11.181.515ON247264645.6
Suva_11.201.515ON247364637.9
YGR100W (MDR1)3.444ON95044627.9
KLTH0C06688g7.392ON246120618.4
KLLA0E03851g3.502ON60079629.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E04027g
         (158 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   321   e-114
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   142   2e-43
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   136   7e-41
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   116   2e-33
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   113   8e-32
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   112   1e-31
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   109   2e-30
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   108   3e-30
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   107   1e-29
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   107   2e-29
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   107   2e-29
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   106   4e-29
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   105   7e-29
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   105   8e-29
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   105   8e-29
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   102   1e-27
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...    99   4e-26
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...    97   9e-26
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...    91   2e-23
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....    90   9e-23
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    81   2e-19
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    80   1e-18
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    80   2e-18
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    78   3e-18
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    78   3e-18
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    78   3e-18
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    78   4e-18
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    77   5e-18
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    77   6e-18
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    78   8e-18
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    78   9e-18
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    77   1e-17
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    78   1e-17
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    78   1e-17
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    76   2e-17
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    76   2e-17
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    77   3e-17
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    77   3e-17
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    77   3e-17
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      77   3e-17
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    75   3e-17
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    75   3e-17
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    75   3e-17
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    75   3e-17
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    77   3e-17
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    77   3e-17
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    77   4e-17
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      76   8e-17
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    74   1e-16
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    74   1e-16
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    74   1e-16
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    74   2e-16
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      74   2e-16
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    74   2e-16
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    73   3e-16
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    72   4e-16
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    72   5e-16
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    72   5e-16
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    72   6e-16
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    72   6e-16
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    72   6e-16
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    72   6e-16
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      72   7e-16
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    72   8e-16
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    73   9e-16
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    73   1e-15
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    73   1e-15
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    71   1e-15
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    72   1e-15
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    71   1e-15
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    71   2e-15
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    72   2e-15
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    72   2e-15
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    71   2e-15
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    71   2e-15
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    71   2e-15
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    71   2e-15
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    71   2e-15
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    70   2e-15
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    70   2e-15
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    72   2e-15
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    71   2e-15
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    71   3e-15
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    71   3e-15
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    72   3e-15
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    70   3e-15
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    70   4e-15
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    70   4e-15
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    70   4e-15
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    70   4e-15
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    69   5e-15
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    70   6e-15
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    69   7e-15
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    68   1e-14
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    67   4e-14
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    65   7e-14
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    66   9e-14
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    66   4e-13
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    66   4e-13
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    64   4e-13
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    65   7e-13
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    65   8e-13
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    63   2e-12
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    63   2e-12
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    62   3e-12
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    63   3e-12
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    63   4e-12
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    62   4e-12
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    63   5e-12
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    62   5e-12
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    62   6e-12
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    62   7e-12
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    62   1e-11
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    61   1e-11
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    62   1e-11
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    60   1e-11
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    60   1e-11
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    60   2e-11
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    62   2e-11
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                62   2e-11
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    60   2e-11
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    60   2e-11
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    60   2e-11
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    60   3e-11
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    60   3e-11
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    60   4e-11
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    60   4e-11
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    59   4e-11
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    60   4e-11
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    60   4e-11
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    60   4e-11
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    60   4e-11
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    59   4e-11
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    60   5e-11
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    60   6e-11
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    59   6e-11
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    60   6e-11
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    59   7e-11
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    59   7e-11
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    58   1e-10
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    58   1e-10
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    58   2e-10
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    57   2e-10
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    57   3e-10
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    58   3e-10
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    57   3e-10
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    58   4e-10
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    56   5e-10
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    56   6e-10
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    56   8e-10
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     56   1e-09
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    54   6e-09
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    54   6e-09
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    53   9e-09
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    52   4e-08
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    52   5e-08
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    52   5e-08
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    52   5e-08
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    52   5e-08
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    51   6e-08
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    52   7e-08
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    52   7e-08
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    51   8e-08
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    50   8e-08
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    50   1e-07
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    50   1e-07
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    51   1e-07
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    50   2e-07
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    50   2e-07
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    50   2e-07
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    50   2e-07
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    50   2e-07
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    50   3e-07
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    50   3e-07
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    50   3e-07
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    50   4e-07
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    50   4e-07
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    50   5e-07
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    47   6e-07
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    49   8e-07
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    48   8e-07
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    48   8e-07
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    49   1e-06
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    49   1e-06
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                49   1e-06
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    48   1e-06
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                48   2e-06
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                48   2e-06
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    47   2e-06
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    47   2e-06
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       47   3e-06
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    47   4e-06
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    47   4e-06
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    46   4e-06
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    46   7e-06
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    45   1e-05
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    45   1e-05
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    45   1e-05
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    45   1e-05
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    44   2e-05
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    44   2e-05
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    44   2e-05
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    44   2e-05
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    44   3e-05
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    44   3e-05
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    43   4e-05
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    42   7e-05
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    42   1e-04
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    42   2e-04
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    41   2e-04
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    41   3e-04
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    40   3e-04
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    40   4e-04
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    40   4e-04
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    40   5e-04
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    40   5e-04
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    39   0.001
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    39   0.003
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    36   0.014
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    33   0.19 
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    32   0.51 
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    32   0.62 
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    31   1.0  
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    30   2.6  
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    30   3.2  
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    29   3.4  
Skud_11.18 Chr11 complement(39396..46814) [7419 bp, 2472 aa] {ON...    29   5.6  
Suva_11.20 Chr11 complement(39570..46991) [7422 bp, 2473 aa] {ON...    29   7.9  
YGR100W Chr7 (690245..693097) [2853 bp, 950 aa] {ON}  MDR1Cytopl...    28   7.9  
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    28   8.4  
KLLA0E03851g Chr5 (352621..354423) [1803 bp, 600 aa] {ON} some s...    28   9.5  

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score =  321 bits (822), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 158/158 (100%), Positives = 158/158 (100%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60
           MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI
Sbjct: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLAD 120
           DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLAD
Sbjct: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLAD 120

Query: 121 PGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEARLARV 158
           PGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEARLARV
Sbjct: 121 PGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEARLARV 158

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  142 bits (357), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 99/153 (64%), Gaps = 7/153 (4%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPV--DDDDLSEWVCRFQGPSESPFEGFELGLNI 58
           M RI++EY  LQK+L       +  LAPV  ++ DL  W   FQGP  +P+ GF   L I
Sbjct: 1   MRRILREYKQLQKQLAL--HPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRI 58

Query: 59  TIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGAIRDL 117
            +  E YP +  P+  F P  + HPN+KW TGE+CLDLLK +AW+P+Y LL VV AI  L
Sbjct: 59  NVP-ETYP-NEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTL 116

Query: 118 LADPGLDSPLDLDIAQIYDADYEAYVQIVRYRL 150
           LA+PG+DSPLD+D++++Y  D  AY  +V YRL
Sbjct: 117 LAEPGVDSPLDVDLSRLYTTDRAAYDGVVNYRL 149

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  136 bits (342), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 72/151 (47%), Positives = 99/151 (65%), Gaps = 6/151 (3%)

Query: 2   SRIVKEYMGLQKRLQTPEFSWISFLAPVDDD-DLSEWVCRFQGPSESPFEGFELGLNITI 60
           SR++ EY  ++++LQ+ E   I  L P  D   LS+W  +F GP  +P+  F   L+I I
Sbjct: 10  SRMLAEYKQIREQLQSHES--ILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGAIRDLLA 119
             E YP +  P   F P  + HPN+KW TGE+CLDLLK + W+P+Y LL VV AIR LLA
Sbjct: 68  P-EMYP-NEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLA 125

Query: 120 DPGLDSPLDLDIAQIYDADYEAYVQIVRYRL 150
           +PG+DSPLD+D+A++Y  D +AY  +V YRL
Sbjct: 126 EPGVDSPLDVDLAKLYSVDKQAYQGLVTYRL 156

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  116 bits (291), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 83/133 (62%), Gaps = 3/133 (2%)

Query: 24  SFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHP 83
           S L P D  DL+ W    +GP  +P+EG    L +T+  +KYP +  P V F  RT+ HP
Sbjct: 22  SNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVP-DKYP-TLPPSVCFPKRTMPHP 79

Query: 84  NVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYD-ADYEAY 142
           NVKWDTGE+CLD L   WTP+  L   V A+R LLA+P  +SPL+L++A +    D++AY
Sbjct: 80  NVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAY 139

Query: 143 VQIVRYRLEEARL 155
             I++YRL  + +
Sbjct: 140 DGIIKYRLAHSSI 152

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  113 bits (282), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 97/166 (58%), Gaps = 12/166 (7%)

Query: 1   MSRIVKEYMGLQKRLQT------PEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFEL 54
           MSRI KEY  + K L +      P    I  L P+D+ DLS W  +  GPS +P+E ++ 
Sbjct: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQ- 59

Query: 55  GLNITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVG 112
             +I ID+   YP++  PR+ FE   + H NVK  TGEICLD+LK + WTP++ LL  V 
Sbjct: 60  -FHILIDVPSSYPMT-PPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVH 117

Query: 113 AIRDLLADPGLDSPLDLDIAQIYD-ADYEAYVQIVRYRLEEARLAR 157
           A+  LL +P  DSPLD+D+  I   AD  AY  IV+Y L E   +R
Sbjct: 118 AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSR 163

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  112 bits (280), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 100/161 (62%), Gaps = 12/161 (7%)

Query: 1   MSRIVKEYMGLQKRL------QTPEFSWISF-LAPVD-DDDLSEWVCRFQGPSESPFEGF 52
           MSRI+KEY  +QK+L      Q  EF+ I   LAP+D D DL++W    +GP  +P+ GF
Sbjct: 1   MSRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60

Query: 53  ELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVV 111
              L ITI  ++YP +  P   F+PR++ H NV ++TGEICLD+LK D WTP++ L+  +
Sbjct: 61  NFILYITIP-QEYP-TVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTL 118

Query: 112 GAIRDLLADPGLDSPLDLDIAQIYD-ADYEAYVQIVRYRLE 151
            AI  LL DP  +SPL++D+A +    D  AY  ++ Y L 
Sbjct: 119 KAIWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYLN 159

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  109 bits (272), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/152 (44%), Positives = 93/152 (61%), Gaps = 5/152 (3%)

Query: 3   RIVKEYMGLQKRLQT-PEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITID 61
           R+ KEY  L K L+  P +S I  L PV DD+L  W     GPS++P++G E  L ITI 
Sbjct: 4   RLAKEYKTLLKTLKEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITIP 63

Query: 62  LEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA-WTPIYTLLDVVGAIRDLLAD 120
              YP+   P+V F  R V H NV +++G IC++LL+ A W+P + LL +V AI  LLA+
Sbjct: 64  -SAYPLE-PPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLAN 121

Query: 121 PGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLE 151
           P  DSPLD+D+A +  A DY A+  +V Y L 
Sbjct: 122 PEPDSPLDVDLACLRRAGDYSAHNGLVAYYLN 153

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  108 bits (271), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 90/154 (58%), Gaps = 9/154 (5%)

Query: 2   SRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITID 61
           SRI+KEY    + LQ+    +I  L P+  DDL+ W C  +GP  SPF      L I I 
Sbjct: 3   SRILKEYKD-SRSLQS---QYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIP 58

Query: 62  LEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADP 121
            + YP++  P   FEP  + HPNV ++TGEICLD+L   W+P++ +  +V AI  LL +P
Sbjct: 59  -QTYPLTT-PICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116

Query: 122 GLDSPLDLDIAQI--YDADYEAYVQIVRYRLEEA 153
              SPL+LD+A +  +D D +AY  ++ Y L  +
Sbjct: 117 NFKSPLNLDLANLLRFD-DLKAYHDLISYHLNNS 149

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  107 bits (266), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/154 (40%), Positives = 94/154 (61%), Gaps = 6/154 (3%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60
           M+RI +EY  +Q  L + E S +  L P+D D LS W    +GP+ +P+EG    L + +
Sbjct: 1   MARIAREYKHIQATLGS-ESSLVVSLEPIDGD-LSRWAGEIRGPTGTPYEGHTFSLRLVL 58

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGAIRDLLA 119
             ++YP +  P+V F  R++ H NV ++TG ICL++L  + W+P + LL V+ AI  LL+
Sbjct: 59  G-DRYPTTP-PQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLS 116

Query: 120 DPGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLEE 152
           DP  DSPLD+D+A I  A D  AY  +V Y L+ 
Sbjct: 117 DPEPDSPLDIDLANILRAQDRSAYYGLVNYYLQS 150

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  107 bits (268), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 92/160 (57%), Gaps = 10/160 (6%)

Query: 1   MSRIVKEYMGLQKRLQT------PEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFEL 54
           MSRIVKEY  + K L +      P    I  L P+D+ DLS+W     GPS++P+E  + 
Sbjct: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78

Query: 55  GLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGA 113
            + I +    YP++  P++ F    + H NVK  TGEICL++LK + WTP++ LL  V A
Sbjct: 79  RILIEVP-SSYPMNP-PKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHA 136

Query: 114 IRDLLADPGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLEE 152
           +  LL +P  DSPLD+DI  I    D  AY  IV+Y L E
Sbjct: 137 VWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAE 176

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  107 bits (266), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 94/160 (58%), Gaps = 10/160 (6%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60
           M+RI KE + ++K L+  +  ++  LAPVDD DLS W    +GP+E+P+  +E  L I +
Sbjct: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEV 60

Query: 61  DLEKYPISGGPRVLFEP------RTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGA 113
               YP+   P + F        R   H NV   TGEICLD+LK + W+PI+ +L VV A
Sbjct: 61  P-ASYPMV-PPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQA 118

Query: 114 IRDLLADPGLDSPLDLDIAQIY-DADYEAYVQIVRYRLEE 152
           I  LL +P  DSPLD+D+A I  + D  AY  I+RY L E
Sbjct: 119 IHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  106 bits (264), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 91/152 (59%), Gaps = 5/152 (3%)

Query: 3   RIVKEYMGLQKRL-QTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITID 61
           R+ KEY  L K L + PE+++I  LAPV +++L +W     GP ++P+ G E  L I   
Sbjct: 4   RLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEAS 63

Query: 62  LEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA-WTPIYTLLDVVGAIRDLLAD 120
            E YP+   P+V F+ R + H NV +D+G ICL +L  A WTP + LL VV AI  LLA 
Sbjct: 64  -EAYPLEP-PKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLAS 121

Query: 121 PGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLE 151
           P  DSPLD+D+A +  A D  A+  ++ Y L 
Sbjct: 122 PEPDSPLDVDLACLVRAGDRSAHNSLIAYYLN 153

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  105 bits (262), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 91/160 (56%), Gaps = 10/160 (6%)

Query: 1   MSRIVKEYMGLQKRLQT------PEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFEL 54
           MSRI KEY  ++K L +      P    I  L P D+ DLS+W     GP  +P+E ++ 
Sbjct: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60

Query: 55  GLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGA 113
            + I +  + YP++  P+++FE   + H N+   TGEICLD+LK   WTP++ LL  V A
Sbjct: 61  RMLIDVP-DSYPMAP-PKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHA 118

Query: 114 IRDLLADPGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLEE 152
           +  LL +P  DSPLD+D+  I    D  AY  IV+Y L E
Sbjct: 119 VWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAE 158

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  105 bits (262), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 91/160 (56%), Gaps = 10/160 (6%)

Query: 1   MSRIVKEYMGLQKRLQT------PEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFEL 54
           MSRI KEY  +QK L +      P    I  L P+D+ DLS+W     GP+ +P+E +  
Sbjct: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60

Query: 55  GLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGA 113
            + I +    YP++  P + F+   + H N+K  TGEICLD+LK + WTP++ LL  V A
Sbjct: 61  RILIDVP-SSYPMAP-PNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHA 118

Query: 114 IRDLLADPGLDSPLDLDIAQIYD-ADYEAYVQIVRYRLEE 152
           I  LL +P  DSPLD+D+  I    D  AY  I+RY L E
Sbjct: 119 IWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAE 158

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  105 bits (261), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 90/152 (59%), Gaps = 5/152 (3%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDL 62
           R++KEY  ++K L   + + IS L P+D DDL+ W     GP  +P+ G    L I +  
Sbjct: 5   RLLKEYQVVKKELGNHK-NIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA-WTPIYTLLDVVGAIRDLLADP 121
           E YP+   P+V F    + H N+++ TG+ICL++L +A W+P++ LL VV AI  LL+DP
Sbjct: 64  E-YPLKP-PQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121

Query: 122 GLDSPLDLDIAQIYD-ADYEAYVQIVRYRLEE 152
             DSPL++D++ I    D  AY  ++ Y L  
Sbjct: 122 VTDSPLNIDLSNILKIKDTSAYYGLIEYYLNN 153

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  102 bits (253), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/154 (40%), Positives = 91/154 (59%), Gaps = 5/154 (3%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVD-DDDLSEWVCRFQGPSESPFEGFELGLNIT 59
           MSR  KEY  + K L+  +  +   +  ++  +DL+ W    +GPS +P+EG    L+++
Sbjct: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60

Query: 60  IDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLL-KDAWTPIYTLLDVVGAIRDLL 118
           +  E YP+S  P V FEP  + H NV + TGEICLD+L K  W+P + LL VV AI  LL
Sbjct: 61  LPQE-YPMSP-PYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLL 118

Query: 119 ADPGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLE 151
            +P   SPL++DIA I  A D  AY  +V Y ++
Sbjct: 119 DEPVSSSPLNVDIANILKANDMNAYYGLVHYYIK 152

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score = 98.6 bits (244), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 88/166 (53%), Gaps = 15/166 (9%)

Query: 1   MSRIVKEYMGLQKRLQTP----------EFSWI-SFLAPVDDDDLSEWVCRFQGPSESPF 49
           MSR++KEY  +Q  L             EF+ I ++L P+   DL+ W  + +GP  +P+
Sbjct: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60

Query: 50  EGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLL-KDAWTPIYTLL 108
              E  L I      YPI   P + F+P ++ H NV + TG ICLD+L K  WTP + L+
Sbjct: 61  ANHEFQLQIECP-PTYPIEP-PIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118

Query: 109 DVVGAIRDLLADPGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLEEA 153
             + AI  LL DP  DSPL++DIA I    D  AY  ++ Y L  +
Sbjct: 119 TTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSAS 164

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score = 97.4 bits (241), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 93/156 (59%), Gaps = 8/156 (5%)

Query: 1   MSRIVKEYMGLQKRL-QTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNIT 59
           + RI KE+  ++K L + P ++ I  L P D  ++  W+    GP E+P+      L++ 
Sbjct: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVE 62

Query: 60  IDLEKYPISGGPRVLFEP---RTVAHPNVKWDTGEICLDLL-KDAWTPIYTLLDVVGAIR 115
           + ++ YP+   PRV F P     + H NV + TGEICLD+L ++ W+P++ L+ V+ AI 
Sbjct: 63  LPIQ-YPLEP-PRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120

Query: 116 DLLADPGLDSPLDLDIAQIYDA-DYEAYVQIVRYRL 150
            LL +P  +SPL++DIA +  A D EAY  +++Y +
Sbjct: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score = 91.3 bits (225), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 91/154 (59%), Gaps = 5/154 (3%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60
           + R++KE   ++K L     S I  L PV  ++  +W    +GP  +P+      L I +
Sbjct: 3   LKRLLKEKRLIEKELSGYSES-IELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIEL 61

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGAIRDLLA 119
             E YP+   P + FEP ++ H NV++ TG+ICL++L+ + W+P++ L+ V+ A+  LL 
Sbjct: 62  PSE-YPLVP-PAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQ 119

Query: 120 DPGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLEE 152
           +P +DSPL++D+A I  A D  AY  ++ Y L+E
Sbjct: 120 EPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score = 89.7 bits (221), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 60/155 (38%), Positives = 89/155 (57%), Gaps = 9/155 (5%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDD--DDLSEWVCRFQGPSESPFEGFELGLNI 58
           MSRI+KEY  ++K    P+   ++ L PV +   DLS W     GP +SP+      L I
Sbjct: 1   MSRIIKEYNHIRKLNALPDN--MTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEI 58

Query: 59  TIDLEKYPISGGPRVLFEPRTVA-HPNVKWDTGEICLDLLKD-AWTPIYTLLDVVGAIRD 116
            I  E YP S  P + F   ++  H NV + TGEICL++LK+  W+P++ LL  V AI  
Sbjct: 59  HIPTE-YP-SIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQ 116

Query: 117 LLADPGLDSPLDLDIAQIYD-ADYEAYVQIVRYRL 150
           LLA P   SPL++D++++    D +AY  +++Y L
Sbjct: 117 LLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 80.9 bits (198), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 81/154 (52%), Gaps = 10/154 (6%)

Query: 5   VKEYMGLQKRLQTPEFSWISFLA------PVDDDDLSEWVCRFQGPSESPFEGFELGLNI 58
           V+E   + KRLQ      +S         PVDD+DL+ WV    GP ++P+ G +  +++
Sbjct: 3   VEEGGCVTKRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSL 62

Query: 59  TIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLL 118
               + YP          P  + HPNV   +G ICLD+LK+ W+ +Y +  ++ +++ LL
Sbjct: 63  KFP-QNYPFHPPMIKFLSP--MWHPNVD-KSGNICLDILKEKWSAVYNVETILLSLQSLL 118

Query: 119 ADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEE 152
            +P   SPL+   A+++DAD E Y + V    EE
Sbjct: 119 GEPNNRSPLNAVAAELWDADMEEYRKKVLACYEE 152

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 70/114 (61%), Gaps = 3/114 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           V++ D+      FQGP E+P++  +  ++I + +E YP    P++ F+ + V HPNV   
Sbjct: 27  VNESDIHHLKGTFQGPPETPYDRGQFVVDIEVPME-YPFKP-PKMKFDTK-VYHPNVSSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
           TG ICLD+LK+AW+P+ TL   + +++ LL  P  + P D ++AQ Y  D E++
Sbjct: 84  TGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLKDRESF 137

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 69/119 (57%), Gaps = 3/119 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           V++ D+      F GP  +P+EG    ++I + +E YP    P++ F+ + V HPN+   
Sbjct: 27  VNESDIHHLKGSFLGPPGTPYEGGRFMIDIEVPME-YPFKP-PKMKFDTK-VYHPNISSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
           TG ICLD+LK+AW+P+ TL   + +++ LL  P  + P D ++AQ Y  D E + +  R
Sbjct: 84  TGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLKDKEGFNKTAR 142

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 77.8 bits (190), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 62/116 (53%), Gaps = 4/116 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           DDL  W     GPS+SP+ G    L+I    + YP    P+V F  + + HPN+   +G 
Sbjct: 29  DDLYHWQASIMGPSDSPYAGGVFFLSIHFPTD-YPFKP-PKVNFTTK-IYHPNIN-SSGN 84

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
           ICLD+LKD W+P  TL  V+ +I  LL D   D PL  +IAQIY  D   Y    +
Sbjct: 85  ICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEATAK 140

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 77.8 bits (190), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 62/116 (53%), Gaps = 4/116 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           DDL  W     GPS+SP+ G    L+I    + YP    P+V F  + + HPN+   +G 
Sbjct: 29  DDLYHWQASIMGPSDSPYAGGVFFLSIHFPTD-YPFKP-PKVNFTTK-IYHPNIN-SSGN 84

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
           ICLD+LKD W+P  TL  V+ +I  LL D   D PL  +IAQIY  D   Y    +
Sbjct: 85  ICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEATAK 140

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 77.8 bits (190), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 62/116 (53%), Gaps = 4/116 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           DDL  W     GPS+SP+ G    L+I    + YP    P+V F  + + HPN+   +G 
Sbjct: 29  DDLYHWQASIMGPSDSPYAGGVFFLSIHFPTD-YPFKP-PKVNFTTK-IYHPNIN-SSGN 84

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
           ICLD+LKD W+P  TL  V+ +I  LL D   D PL  +IAQIY  D   Y    +
Sbjct: 85  ICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKTDKAKYEATAK 140

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 79/153 (51%), Gaps = 10/153 (6%)

Query: 6   KEYMGLQKRLQTPEFSWISFLA------PVDDDDLSEWVCRFQGPSESPFEGFELGLNIT 59
           +E   + KRLQ      +S         PVDD+DL+ W     GP  +P+   +  +++ 
Sbjct: 4   QEGCCVTKRLQNELLQLLSSTTQSIGAFPVDDNDLTYWTGYIMGPQGTPYSDLKFKISLN 63

Query: 60  IDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLA 119
              E YP    P+V F    + HPNV   +G ICLD+LK+ W+ +Y +  ++ +++ LL 
Sbjct: 64  FP-ENYPFHP-PKVKFV-SPMWHPNVD-KSGNICLDILKEKWSAVYNVETILLSLQSLLG 119

Query: 120 DPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEE 152
           +P   SPL+   A+++D D E Y + V    EE
Sbjct: 120 EPNNRSPLNAVAAELWDKDMEGYKKKVLMCYEE 152

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 77.4 bits (189), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 71/145 (48%), Gaps = 10/145 (6%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDL 62
           RI KE   L+K   T      SF A    DDL  W     GP +SP+ G    L+I    
Sbjct: 5   RISKELNDLRKDPIT------SFSAGPVGDDLFHWQASIMGPPDSPYAGGVFFLSIHFPT 58

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPG 122
           + YP    P++ F  + + HPN+  + G ICLD+LKD W+P  TL  V+ +I  LL D  
Sbjct: 59  D-YPFKP-PKISFTTK-IYHPNINAN-GNICLDILKDQWSPALTLSKVLLSICSLLTDAN 114

Query: 123 LDSPLDLDIAQIYDADYEAYVQIVR 147
            D PL  +IA IY  D   Y    R
Sbjct: 115 PDDPLVPEIAHIYKTDRSKYETTAR 139

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 77.0 bits (188), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 62/116 (53%), Gaps = 4/116 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           DDL  W     GPS+SP+ G    L+I    + YP    P+V F  + + HPN+   +G 
Sbjct: 29  DDLYHWQASIMGPSDSPYAGGVFFLSIHFPTD-YPFKP-PKVNFTTK-IYHPNIN-SSGN 84

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
           ICLD+LKD W+P  TL  V+ ++  LL D   D PL  +IAQIY  D   Y    +
Sbjct: 85  ICLDILKDQWSPALTLSKVLLSVCSLLTDANPDDPLVPEIAQIYKTDKAKYEATAK 140

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 78.2 bits (191), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 68/114 (59%), Gaps = 3/114 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           V + D+      F GP E+P++G    ++I + +E YP    P++ F+ + V HPN+   
Sbjct: 27  VSESDIHHLKGSFLGPPETPYQGGRFIVDIEVPME-YPFKP-PKMKFDTK-VYHPNISSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
           TG ICLD+LK+AW+P+ TL   + +++ LL  P  + P D ++AQ Y  D E++
Sbjct: 84  TGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESF 137

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 78.2 bits (191), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 69/114 (60%), Gaps = 3/114 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           V + D+      F GP E+P+EG +  ++I + +E YP    P++ F+ + V HPN+   
Sbjct: 27  VSEADIHHLKGSFLGPPETPYEGGKFIVDIEVPME-YPFKP-PKMKFDTK-VYHPNISSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
           TG ICLD+LK+AW+P+ TL   + +++ LL  P  + P D ++AQ Y  D E++
Sbjct: 84  TGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESF 137

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 76.6 bits (187), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 79/148 (53%), Gaps = 12/148 (8%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLA------PVDDDDLSEWVCRFQGPSESPFEGFEL 54
           MSR  +E   + KRLQ      +S         PVDD+DL+ WV    GP  +P+ G + 
Sbjct: 1   MSR--QEGGCVTKRLQNELLQLLSSATQSISAFPVDDNDLTYWVGYITGPQGTPYSGLKF 58

Query: 55  GLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAI 114
            +++    E YP    P++ F    + HPNV   +G ICLD+LK+ W+ +Y +  ++ ++
Sbjct: 59  KISLNFP-ENYPFHP-PKIKFV-SPMWHPNVD-KSGNICLDILKEKWSAVYNVETILLSL 114

Query: 115 RDLLADPGLDSPLDLDIAQIYDADYEAY 142
           + LL +P   SPL+   A+++D +   Y
Sbjct: 115 QSLLGEPNNKSPLNAVAAELWDTNMVEY 142

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 78.2 bits (191), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 69/114 (60%), Gaps = 3/114 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           V++ D+      F GPS +P+EG +  ++I I +E YP    P++ F+ + V HPNV   
Sbjct: 27  VNESDIHHMKGSFIGPSGTPYEGGKFVVDINIPVE-YPYKP-PQMKFDTK-VYHPNVSSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
           TG ICLD+LK+AWTP+ TL   + +++ LL  P  + P D  +A+ Y  D +++
Sbjct: 84  TGAICLDILKNAWTPVITLKSALISLQALLQSPEPNDPQDAQVAKHYLTDKKSF 137

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 69/116 (59%), Gaps = 3/116 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           + + D+      F GP E+P++G    ++I + +E YP    P++ F+ + V HPN+   
Sbjct: 27  ISESDIHRLKGSFLGPPETPYQGGRFIIDIEVPME-YPFKP-PKMKFDTK-VYHPNISSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQ 144
           TG ICLD+LK+AW+P+ TL   + +++ LL  P  + P D ++AQ Y  D E++ +
Sbjct: 84  TGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDKESFSK 139

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 72/125 (57%), Gaps = 4/125 (3%)

Query: 28  PVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKW 87
           P  +DDL++W     GP  +P+E  +  L++    ++YP    P+V F    + HPNV  
Sbjct: 33  PASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFT-DQYPYQP-PKVTFV-SPMWHPNVDM 89

Query: 88  DTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            +G ICLD+LKD W+ +Y +  ++ +++ LL +P   SPL+   A+++D D + Y + + 
Sbjct: 90  -SGNICLDILKDQWSAVYNVQTILLSLQALLEEPNNGSPLNAIAAELWDTDMDEYKKRLF 148

Query: 148 YRLEE 152
            R EE
Sbjct: 149 ARYEE 153

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 71/145 (48%), Gaps = 10/145 (6%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDL 62
           RI KE   L++   T      S  A    DDL  W     GP++SP+ G    L+I    
Sbjct: 6   RIAKELSDLERDPPT------SCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPT 59

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPG 122
           + YP    P++ F  + + HPN+  + G ICLD+LKD W+P  TL  V+ +I  LL D  
Sbjct: 60  D-YPFKP-PKISFTTK-IYHPNINAN-GNICLDILKDQWSPALTLSKVLLSICSLLTDAN 115

Query: 123 LDSPLDLDIAQIYDADYEAYVQIVR 147
            D PL  +IA IY  D   Y    R
Sbjct: 116 PDDPLVPEIAHIYKTDRSKYEATAR 140

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 77.0 bits (188), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 68/114 (59%), Gaps = 3/114 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           V + D+      F GP  +P+EG +  ++I + +E YP    P++ F+ + V HPN+   
Sbjct: 27  VSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME-YPFKP-PKMQFDTK-VYHPNISSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
           TG ICLD+LK+AW+P+ TL   + +++ LL  P  + P D ++AQ Y  D E++
Sbjct: 84  TGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESF 137

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 76.6 bits (187), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 68/114 (59%), Gaps = 3/114 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           V + D+      F GP  +P+EG +  ++I + +E YP    P++ F+ + V HPN+   
Sbjct: 27  VSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME-YPFKP-PKMQFDTK-VYHPNISSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
           TG ICLD+LK+AW+P+ TL   + +++ LL  P  + P D ++AQ Y  D E++
Sbjct: 84  TGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESF 137

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 76.6 bits (187), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 68/114 (59%), Gaps = 3/114 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           V + D+      F GP  +P+EG +  ++I + +E YP    P++ F+ + V HPN+   
Sbjct: 27  VSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME-YPFKP-PKMQFDTK-VYHPNISSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
           TG ICLD+LK+AW+P+ TL   + +++ LL  P  + P D ++AQ Y  D E++
Sbjct: 84  TGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESF 137

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 76.6 bits (187), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 68/114 (59%), Gaps = 3/114 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           V++ D+      F GP  +P+EG +  ++I + +E YP    P + F+ + V HPN+   
Sbjct: 27  VNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPME-YPFKP-PMMKFDTK-VYHPNISSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
           TG ICLD+LK+AW+P+ TL   + +++ LL  P  + P D ++AQ Y  D E++
Sbjct: 84  TGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLKDRESF 137

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 75.5 bits (184), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/126 (38%), Positives = 64/126 (50%), Gaps = 8/126 (6%)

Query: 24  SFLAPVDDDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVA 81
           SF A    DDL  W     GP +SP+ G  F L ++   D   YP    P++ F  + + 
Sbjct: 34  SFSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTD---YPFKP-PKISFTTK-IY 88

Query: 82  HPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEA 141
           HPN+  + G ICLD+LKD W+P  TL  V+ +I  LL D   D PL  +IA IY  D   
Sbjct: 89  HPNINAN-GNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRSK 147

Query: 142 YVQIVR 147
           Y    R
Sbjct: 148 YEATAR 153

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 75.1 bits (183), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 71/145 (48%), Gaps = 10/145 (6%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDL 62
           RI KE   L++   T      S  A    DDL  W     GP++SP+ G    L+I    
Sbjct: 6   RIAKELSDLERDPPT------SCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPT 59

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPG 122
           + YP    P++ F  + + HPN+  + G ICLD+LKD W+P  TL  V+ +I  LL D  
Sbjct: 60  D-YPFKP-PKISFTTK-IYHPNINAN-GNICLDILKDQWSPALTLSKVLLSICSLLTDAN 115

Query: 123 LDSPLDLDIAQIYDADYEAYVQIVR 147
            D PL  +IA IY  D   Y    R
Sbjct: 116 PDDPLVPEIAHIYKTDRPKYEATAR 140

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 75.1 bits (183), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 71/145 (48%), Gaps = 10/145 (6%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDL 62
           RI KE   L++   T      S  A    DDL  W     GP++SP+ G    L+I    
Sbjct: 6   RIAKELSDLERDPPT------SCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPT 59

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPG 122
           + YP    P++ F  + + HPN+  + G ICLD+LKD W+P  TL  V+ +I  LL D  
Sbjct: 60  D-YPFKP-PKISFTTK-IYHPNINAN-GNICLDILKDQWSPALTLSKVLLSICSLLTDAN 115

Query: 123 LDSPLDLDIAQIYDADYEAYVQIVR 147
            D PL  +IA IY  D   Y    R
Sbjct: 116 PDDPLVPEIAHIYKTDRPKYEATAR 140

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 75.1 bits (183), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 71/145 (48%), Gaps = 10/145 (6%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDL 62
           RI KE   L++   T      S  A    DDL  W     GP++SP+ G    L+I    
Sbjct: 6   RIAKELSDLERDPPT------SCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPT 59

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPG 122
           + YP    P++ F  + + HPN+  + G ICLD+LKD W+P  TL  V+ +I  LL D  
Sbjct: 60  D-YPFKP-PKISFTTK-IYHPNINAN-GNICLDILKDQWSPALTLSKVLLSICSLLTDAN 115

Query: 123 LDSPLDLDIAQIYDADYEAYVQIVR 147
            D PL  +IA IY  D   Y    R
Sbjct: 116 PDDPLVPEIAHIYKTDRPKYEATAR 140

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 76.6 bits (187), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 78/140 (55%), Gaps = 8/140 (5%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDL 62
           RI+KE   +Q     PE +    L+ V + D+      F GP  +P+EG    ++I + L
Sbjct: 6   RIIKE---IQAAKDDPEANIT--LSFVSESDIHHLKGSFYGPPGTPYEGGNFIVDIQVPL 60

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPG 122
           E YP    P++ F+ + V HPN+   TG ICLD+LK+AW+P+ TL   + +++ LL  P 
Sbjct: 61  E-YPFKP-PKMQFDTK-VYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPE 117

Query: 123 LDSPLDLDIAQIYDADYEAY 142
            + P D ++AQ +  D  ++
Sbjct: 118 PNDPQDAEVAQHFIRDKSSF 137

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 76.6 bits (187), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 68/114 (59%), Gaps = 3/114 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           V + D+      F GP  +P+EG +  ++I + +E YP    P++ F+ + V HPN+   
Sbjct: 27  VSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME-YPFKP-PKMQFDTK-VYHPNISSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
           TG ICLD+LK+AW+P+ TL   + +++ LL  P  + P D ++AQ Y  D E++
Sbjct: 84  TGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESF 137

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 76.6 bits (187), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 80/142 (56%), Gaps = 5/142 (3%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60
           MSR  +    LQ     PE + IS L  V + D+      F GP  +P+EG +  ++I +
Sbjct: 1   MSRAKRIMKELQAVKDDPEAN-IS-LEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEV 58

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLAD 120
            +E YP    P++ F+ + V HPN+   TG ICLD+LK+AW+P+ TL   + +++ LL  
Sbjct: 59  PME-YPFKP-PKMKFDSK-VYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQS 115

Query: 121 PGLDSPLDLDIAQIYDADYEAY 142
           P  + P D ++AQ Y  D +++
Sbjct: 116 PEPNDPQDAEVAQHYLRDRQSF 137

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 75.9 bits (185), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 68/114 (59%), Gaps = 3/114 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           V++ D+      F GP  +P+EG +  ++I + +E YP    P++ F+ + V HPN+   
Sbjct: 27  VNESDIHHLKGSFFGPPGTPYEGGQFIIDIEVPME-YPFKP-PKMKFDTK-VYHPNISSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
           TG ICLD+LK+AW+P+ TL   + +++ LL  P  + P D ++AQ Y  D  ++
Sbjct: 84  TGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLKDRASF 137

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 73.6 bits (179), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 60/116 (51%), Gaps = 4/116 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           DDL  W     GP +SP+ G    L+I    + YP    P++ F  + + HPN+  + G 
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTD-YPFKP-PKISFTTK-IYHPNINAN-GN 83

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
           ICLD+LKD W+P  TL  V+ +I  LL D   D PL  +IA IY  D   Y    R
Sbjct: 84  ICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYEATAR 139

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 73.6 bits (179), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 60/116 (51%), Gaps = 4/116 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           DDL  W     GP +SP+ G    L+I    + YP    P++ F  + + HPN+  + G 
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTD-YPFKP-PKISFTTK-IYHPNINAN-GN 83

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
           ICLD+LKD W+P  TL  V+ +I  LL D   D PL  +IA IY  D   Y    R
Sbjct: 84  ICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAR 139

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 73.6 bits (179), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 60/116 (51%), Gaps = 4/116 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           DDL  W     GP +SP+ G    L+I    + YP    P++ F  + + HPN+  + G 
Sbjct: 29  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTD-YPFKP-PKISFTTK-IYHPNINAN-GN 84

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
           ICLD+LKD W+P  TL  V+ +I  LL D   D PL  +IA IY  D   Y    R
Sbjct: 85  ICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAR 140

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 73/125 (58%), Gaps = 4/125 (3%)

Query: 28  PVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKW 87
           P ++DDL++W     GP  +P+EG    +++    + YP +  PRV F    + HPNV  
Sbjct: 38  PENEDDLTKWSGIITGPDGTPYEGLRFKISLQFP-QSYPYTA-PRVTFV-SPMWHPNVDM 94

Query: 88  DTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            +G ICLD+LKD W+ +Y +  ++ +++ LL +P   SPL+   A+++D + E Y + + 
Sbjct: 95  -SGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDKNMEEYKRKLM 153

Query: 148 YRLEE 152
            R EE
Sbjct: 154 ARYEE 158

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 70/122 (57%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+E+P+E     L +  D E+YPI+  P V F    + HPNV +  GE
Sbjct: 31  DNVMVWNAMIIGPAETPYEDGTFRLLLEFD-EEYPINR-PHVKFL-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      Y++ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYIKRVKETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 69/125 (55%), Gaps = 4/125 (3%)

Query: 28  PVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKW 87
           P DD+DL+ W     GP  +P+   +  +++    E YP    P+V F    + HPNV  
Sbjct: 32  PEDDNDLTYWTGYITGPQGTPYSDLKFKISLNFP-ESYPFHP-PKVKFV-SPMWHPNVDM 88

Query: 88  DTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            +G ICLD+LK+ W+ +Y +  ++ +++ LL +P   SPL+   A+++D D E Y + V 
Sbjct: 89  -SGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDKDMEEYKKKVL 147

Query: 148 YRLEE 152
              EE
Sbjct: 148 ACYEE 152

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 72/125 (57%), Gaps = 4/125 (3%)

Query: 28  PVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKW 87
           P  +++L++W     GP +SP+ G    +++T   ++YP    P+V F    + HPNV  
Sbjct: 36  PDHEENLTKWSGTITGPDDSPYAGLRFKISLTFP-DRYPYEP-PKVKFV-SPMWHPNVDL 92

Query: 88  DTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            +G ICLD+LK+ W+ +Y +  ++ +++ LL +P   SPL+   A+++D D E Y + + 
Sbjct: 93  -SGNICLDVLKEKWSAVYNVQTILLSLQALLGEPNNSSPLNAIAAELWDGDKEEYARKLA 151

Query: 148 YRLEE 152
              EE
Sbjct: 152 TIYEE 156

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 72.4 bits (176), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 70/147 (47%), Gaps = 10/147 (6%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60
           + RI KE   L +   T      S  A    DD+  W     GP +SP+ G    L+I  
Sbjct: 3   LKRITKELNDLGRDPPT------SCSAGPVGDDIYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLAD 120
             + YP    P++ F  + + HPN+  + G ICLD+LKD W+P  T+  V+ +I  LL D
Sbjct: 57  PTD-YPFKP-PKIAFTTK-IYHPNINAN-GNICLDILKDQWSPALTISKVLLSICSLLTD 112

Query: 121 PGLDSPLDLDIAQIYDADYEAYVQIVR 147
              D PL  +IA IY  D   Y    R
Sbjct: 113 ANPDDPLVPEIAHIYKTDRAKYEATAR 139

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 72.4 bits (176), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 68/125 (54%), Gaps = 4/125 (3%)

Query: 28  PVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKW 87
           P D++DL+ W     GP ++P++G    L+     + YP +        P  + HPNV  
Sbjct: 40  PNDEEDLTHWSAIITGPKDTPYDGLRFKLSFQFS-DSYPYAPPLVKFISP--MWHPNVDM 96

Query: 88  DTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            +G ICLD+LKD W+ +Y +  ++ +++ LL +P   SPL+   A+++D D   Y + + 
Sbjct: 97  -SGNICLDILKDQWSAVYNVETILLSLQALLEEPNNSSPLNAVAAELWDDDMNEYKKRLL 155

Query: 148 YRLEE 152
            R E+
Sbjct: 156 ARYED 160

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 72.0 bits (175), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+E+P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 16  DNVMVWNAMIIGPAETPYEDGTFRLLLEFD-EEYP-NKPPHVKFL-SEIFHPNV-YANGE 71

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      Y++ V+  +E
Sbjct: 72  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYIKRVKETVE 131

Query: 152 EA 153
           ++
Sbjct: 132 KS 133

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 71.6 bits (174), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 70/147 (47%), Gaps = 10/147 (6%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60
           + RI KE   L +   T      S  A    DDL  W     GP +SP+ G    L+I  
Sbjct: 3   LKRITKELNDLGRDPPT------SCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLAD 120
             + YP    P++ F  + + HPN+  + G ICLD+LKD W+P  T+  V+ +I  LL D
Sbjct: 57  PTD-YPFKP-PKISFTTK-IYHPNINAN-GNICLDILKDQWSPALTISKVLLSICSLLTD 112

Query: 121 PGLDSPLDLDIAQIYDADYEAYVQIVR 147
              D PL  +IA IY  D   Y    +
Sbjct: 113 ANPDDPLVPEIAHIYKTDRAKYEATAK 139

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 71.6 bits (174), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 60/116 (51%), Gaps = 4/116 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           DDL  W     GP +SP+ G    L+I    + YP    P++ F  + + HPN+  + G 
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTD-YPFKP-PKISFTTK-IYHPNINAN-GN 83

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
           ICLD+LKD W+P  T+  V+ +I  LL D   D PL  +IA IY  D   Y    +
Sbjct: 84  ICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYEATAK 139

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 71.6 bits (174), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 60/116 (51%), Gaps = 4/116 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           DDL  W     GP +SP+ G    L+I    + YP    P++ F  + + HPN+  + G 
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTD-YPFKP-PKISFTTK-IYHPNINAN-GN 83

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
           ICLD+LKD W+P  T+  V+ +I  LL D   D PL  +IA IY  D   Y    +
Sbjct: 84  ICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYEATAK 139

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 71.6 bits (174), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 60/116 (51%), Gaps = 4/116 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           DDL  W     GP +SP+ G    L+I    + YP    P++ F  + + HPN+  + G 
Sbjct: 28  DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTD-YPFKP-PKISFTTK-IYHPNINAN-GN 83

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
           ICLD+LKD W+P  T+  V+ +I  LL D   D PL  +IA IY  D   Y    +
Sbjct: 84  ICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYEATAK 139

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 72.0 bits (175), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+E+P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMVWNAMIIGPAETPYEDGTFRLLLEFD-EEYP-NKPPHVKFL-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      Y++ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYIKRVKETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 72.0 bits (175), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+E+P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 27  DNVMVWNAMIIGPAETPYEDGTFRLLLEFD-EEYP-NKPPHVKFL-SEMFHPNV-YANGE 82

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      Y++ V+  +E
Sbjct: 83  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYIKRVKETVE 142

Query: 152 EA 153
           ++
Sbjct: 143 KS 144

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 72.8 bits (177), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 68/114 (59%), Gaps = 3/114 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           V+++D+      F GP  +P+E  +  ++I + +E YP    P++ F+ + V HPNV   
Sbjct: 27  VNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPME-YPFKP-PKMKFQTK-VYHPNVSSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
           TG ICLD+LK+AW+P+ TL   + +++ LL  P  + P D ++AQ Y  D  ++
Sbjct: 84  TGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYIRDKASF 137

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 73.2 bits (178), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/113 (38%), Positives = 60/113 (53%), Gaps = 8/113 (7%)

Query: 32  DDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDT 89
           DDL  W     GP +SP+ G  F L ++   D   YP    P++ F  + + HPN+  + 
Sbjct: 117 DDLYHWQASIMGPPDSPYAGGVFFLSIHFPTD---YPFKP-PKISFTTK-IYHPNINAN- 170

Query: 90  GEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
           G ICLD+LKD W+P  T+  V+ +I  LL D   D PL  +IA IY  D   Y
Sbjct: 171 GNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKY 223

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 75/142 (52%), Gaps = 5/142 (3%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60
           MSR  +    LQ     PE      L  V + D+      F GP  +P+E     ++I +
Sbjct: 1   MSRAKRIMKELQAVKDDPEAKIT--LEFVIESDIHHLKGSFIGPPGTPYENGAFVVDIEV 58

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLAD 120
            +E YP    P++ F+ + V HPN+   TG ICLD+LK+AW+P+ TL   + +++ LL  
Sbjct: 59  PME-YPFKP-PQMKFDTK-VYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQS 115

Query: 121 PGLDSPLDLDIAQIYDADYEAY 142
           P  + P D ++AQ Y  D E++
Sbjct: 116 PEPNDPQDAEVAQHYLRDRESF 137

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 70/147 (47%), Gaps = 10/147 (6%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60
           + RI KE   L +   T      S  A    DD+  W     GP +SP+ G    L+I  
Sbjct: 3   LKRITKELNDLGRDPPT------SCSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLAD 120
             + YP    P++ F  + + HPN+  + G ICLD+LKD W+P  T+  V+ +I  LL D
Sbjct: 57  PTD-YPFKP-PKIAFTTK-IYHPNINAN-GNICLDILKDQWSPALTISKVLLSICSLLTD 112

Query: 121 PGLDSPLDLDIAQIYDADYEAYVQIVR 147
              D PL  +IA IY  D   Y    R
Sbjct: 113 ANPDDPLVPEIAHIYKTDRAKYEAQAR 139

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GPS++P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMLWNAMIIGPSDTPYEDGTFRLVLEFD-EEYP-NKPPHVKFL-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      YV+ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFKDHRAQYVKKVKETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 70.9 bits (172), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 70/147 (47%), Gaps = 10/147 (6%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60
           + RI KE   L +   T      S  A    DD+  W     GP +SP+ G    L+I  
Sbjct: 4   LKRITKELNDLGRDPPT------SCSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLAD 120
             + YP    P++ F  + + HPN+  + G ICLD+LKD W+P  T+  V+ +I  LL D
Sbjct: 58  PTD-YPFKP-PKISFTTK-IYHPNINAN-GNICLDILKDQWSPALTISKVLLSICSLLTD 113

Query: 121 PGLDSPLDLDIAQIYDADYEAYVQIVR 147
              D PL  +IA +Y  D   Y    R
Sbjct: 114 ANPDDPLVPEIAHLYKTDRAKYEATAR 140

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 70/147 (47%), Gaps = 10/147 (6%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60
           + RI KE   L +   T      S  A    DD+  W     GP +SP+ G    L+I  
Sbjct: 4   LKRITKELNDLGRDPPT------SCSAGPVGDDIYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLAD 120
             + YP    P++ F  + + HPN+  + G ICLD+LKD W+P  T+  V+ +I  LL D
Sbjct: 58  PTD-YPFKP-PKISFTTK-IYHPNINAN-GNICLDILKDQWSPALTISKVLLSICSLLTD 113

Query: 121 PGLDSPLDLDIAQIYDADYEAYVQIVR 147
              D PL  +IA IY  D   Y    +
Sbjct: 114 ANPDDPLVPEIAHIYKTDRPKYEATAK 140

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 69/117 (58%), Gaps = 3/117 (2%)

Query: 26  LAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNV 85
           L+ V + D+      F GP  +P+ G +  ++I + LE YP    P++ F+ + V HPN+
Sbjct: 24  LSFVSESDIHHLKGTFLGPPGTPYHGGKFVVDIQVPLE-YPFKP-PKMQFDTK-VYHPNI 80

Query: 86  KWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
              TG ICLD+LK++W+P+ TL   + +++ LL  P  + P D ++A+ Y +D  ++
Sbjct: 81  SSVTGAICLDILKNSWSPVLTLKTSLISLQALLQSPEPNDPQDAEVAKHYLSDRSSF 137

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 68/117 (58%), Gaps = 3/117 (2%)

Query: 26  LAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNV 85
           LA V + D+      F GP  +P+ G    ++I + LE YP    P++ F+ + V HPN+
Sbjct: 24  LAFVSESDIHHLKGTFLGPPGTPYHGGTFIVDIQVPLE-YPFKP-PKMQFDTK-VYHPNI 80

Query: 86  KWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
              TG ICLD+LK++W+P+ TL   + +++ LL  P  + P D ++A+ Y +D  ++
Sbjct: 81  SSVTGAICLDILKNSWSPVLTLKTSLISLQALLQSPEPNDPQDAEVAKHYLSDRASF 137

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+++P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFD-EEYP-NKPPHVKFL-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      YV+ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+++P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFD-EEYP-NKPPHVKFL-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      YV+ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+++P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFD-EEYP-NKPPHVKFL-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      YV+ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+++P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFD-EEYP-NKPPHVKFL-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      YV+ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+++P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFD-EEYP-NKPPHVKFL-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      YV+ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+++P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMIWNAMIIGPADTPYEDGTFRLLLEFD-EEYP-NKPPHVKFL-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      YV+ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFQDHKSQYVKRVKETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 71/125 (56%), Gaps = 4/125 (3%)

Query: 28  PVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKW 87
           P  +DDL++W     GP  +P+EG    + +    + YP +  P+V F    + HPNV  
Sbjct: 38  PESEDDLTKWCGIITGPDGTPYEGLRFKIALEF-AQTYPYTA-PKVRFV-SPMWHPNVDM 94

Query: 88  DTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            +G ICLD+LKD W+ +Y +  ++ +++ LL +P   SPL+   A+++D D + Y + + 
Sbjct: 95  -SGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDTDMQEYKKKLY 153

Query: 148 YRLEE 152
            R EE
Sbjct: 154 ARYEE 158

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 71.6 bits (174), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 70/120 (58%), Gaps = 3/120 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           V+++D+      F GP  +P+E  +  ++I + +E YP    P++ F+ + V HPNV   
Sbjct: 27  VNENDIHLLKGSFLGPPGTPYENGKFIVDIEVPME-YPFKP-PKMKFDTK-VYHPNVSSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRY 148
           TG ICLD+LK+AW+P+ TL   + +++ LL  P  + P D ++AQ +  D  ++ +   +
Sbjct: 84  TGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHFLRDKASFDKTAAF 143

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+++P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFD-EEYP-NKPPHVKFL-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      YV+ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 70.9 bits (172), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GPS++P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMIWNAMIIGPSDTPYEDGTFRLLLEFD-EEYP-NKPPHVKFI-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      Y++ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYIKKVQETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 70.9 bits (172), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+++P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFD-EEYP-NKPPHVKFL-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      YV+ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 71.6 bits (174), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 67/114 (58%), Gaps = 3/114 (2%)

Query: 29  VDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           V + D+      F GP  +P++G    ++I + +E YP    P++ F+ + V HPNV   
Sbjct: 27  VTESDIHHLKGSFLGPPGTPYDGGLFIVDIEVPME-YPFKP-PKMKFDTK-VYHPNVSSV 83

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAY 142
           TG ICLD+LK+AW+P+ TL   + +++ LL  P  + P D ++AQ Y  D +++
Sbjct: 84  TGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDKDSF 137

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 83/152 (54%), Gaps = 9/152 (5%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60
           +SR+  E M L   + +P     +F  P D++DL++W     GP  +P+EG    + +  
Sbjct: 16  VSRLQSELMQL---MLSPSPGLSAF--PEDEEDLTKWCGIITGPDGTPYEGMRFKIALEF 70

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLAD 120
             + YP +  P+V F    + HPNV   +G ICLD+LKD W+ +Y +  ++ +++ LL +
Sbjct: 71  -AQTYPYTA-PKVRFV-SPMWHPNVDM-SGNICLDILKDQWSAVYNVQTILLSLQSLLEE 126

Query: 121 PGLDSPLDLDIAQIYDADYEAYVQIVRYRLEE 152
           P   SPL+   A+++D D   Y + +  R EE
Sbjct: 127 PNNSSPLNAVAAELWDKDMREYKKKLIARYEE 158

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 70.1 bits (170), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 69/125 (55%), Gaps = 4/125 (3%)

Query: 28  PVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKW 87
           P ++DDL +W     GP  +P+E  +  +++    + YP    P+V F    + HPNV  
Sbjct: 36  PNNEDDLRDWSGMIVGPEGTPYESLKFKISLHFP-DSYPYVP-PKVKFI-SPMWHPNVDM 92

Query: 88  DTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            +G ICLD+LKD W+ +Y +  ++ +++ L  +P   SPL+   A+++D D   Y + + 
Sbjct: 93  -SGNICLDILKDQWSAVYNVQTILLSLQSLFEEPNNSSPLNAVAAELWDKDMVEYKKRLL 151

Query: 148 YRLEE 152
            R EE
Sbjct: 152 SRYEE 156

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 69.7 bits (169), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 70/147 (47%), Gaps = 10/147 (6%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60
           + RI KE   L +   T      S  A    DD+  W     GP +SP+ G    L+I  
Sbjct: 4   LKRITKELNDLGRDPPT------SCSAGPVGDDIYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLAD 120
             + YP    P++ F  + + HPN+  + G ICLD+LKD W+P  T+  V+ +I  LL D
Sbjct: 58  PTD-YPFKP-PKISFTTK-IYHPNINAN-GNICLDILKDQWSPALTISKVLLSICSLLTD 113

Query: 121 PGLDSPLDLDIAQIYDADYEAYVQIVR 147
              D PL  +IA +Y  D   Y    +
Sbjct: 114 ANPDDPLVPEIAHLYKTDRPKYEATAK 140

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 70.1 bits (170), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+++P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFD-EEYP-NKPPHVKFV-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      Y++ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYIKRVQETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 70.1 bits (170), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 69/122 (56%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+++P+E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFD-EEYP-NKPPHVKFL-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      Y++ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYIKRVKETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 69.3 bits (168), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 70/147 (47%), Gaps = 10/147 (6%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITI 60
           + RI KE   L +   T      S  A    DD+  W     GP +SP+ G    L+I  
Sbjct: 4   LKRITKELNDLGRDPPT------SCSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLAD 120
             + YP    P++ F  + + HPN+  + G ICLD+LKD W+P  T+  V+ +I  LL D
Sbjct: 58  PTD-YPFKP-PKISFTTK-IYHPNINAN-GNICLDILKDQWSPALTISKVLLSICSLLTD 113

Query: 121 PGLDSPLDLDIAQIYDADYEAYVQIVR 147
              D PL  +IA +Y  D   Y    +
Sbjct: 114 ANPDDPLVPEIAHLYKTDRAKYEATAK 140

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 69.7 bits (169), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+++P+E     L +  D E YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMVWNAMIIGPADTPYEDGTFRLLLEFD-EDYP-NKPPHVKFL-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      Y++ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYIKRVKETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 69.3 bits (168), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+++P+E     L +  D E YP +  P V F    + HPNV +  GE
Sbjct: 16  DNVMVWNAMIIGPADTPYEDGTFRLLLEFD-EDYP-NKPPHVKFL-SEMFHPNV-YANGE 71

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      YV+ V+  +E
Sbjct: 72  ICLDILQNRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVE 131

Query: 152 EA 153
           ++
Sbjct: 132 KS 133

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 68.2 bits (165), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+++P+E     L +  D E YP +  P V F    + HPNV +  GE
Sbjct: 16  DNVMVWNAMIIGPADTPYEDGTFRLLLEFD-EDYP-NKPPHVKFL-SEMFHPNV-YANGE 71

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      YV+ V+  +E
Sbjct: 72  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDYKSQYVKRVKETVE 131

Query: 152 EA 153
           ++
Sbjct: 132 KS 133

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 67.4 bits (163), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 32  DDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGE 91
           D++  W     GP+++ +E     L +  D E+YP +  P V F    + HPNV +  GE
Sbjct: 31  DNVMVWNAMIIGPADTSYEDGTFRLLLEFD-EEYP-NKPPHVKFL-SEMFHPNV-YANGE 86

Query: 92  ICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLE 151
           ICLD+L++ WTP Y +  ++ +I+ L  DP   SP +++ A ++      YV+ V+  +E
Sbjct: 87  ICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVE 146

Query: 152 EA 153
           ++
Sbjct: 147 KS 148

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 65.5 bits (158), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 56/105 (53%), Gaps = 4/105 (3%)

Query: 43  GPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWT 102
           GP +SP+ G    L+I    + YP    P++ F  + + HPN+  + G ICLD+LKD W+
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTD-YPFKP-PKISFTTK-IYHPNINAN-GNICLDILKDQWS 57

Query: 103 PIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
           P  TL  V+ +I  LL D   D PL  +IA IY  D   Y    R
Sbjct: 58  PALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAR 102

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 66.2 bits (160), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 73/134 (54%), Gaps = 14/134 (10%)

Query: 2   SRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEG--FELGLNIT 59
            RI+KE     +RL +     IS  A   +D+L  +    +GP ESP+E   FEL L + 
Sbjct: 6   KRIIKE----TERLASDPVPGIS--AEPHEDNLRYFAVTIEGPEESPYENGVFELELYLP 59

Query: 60  IDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLA 119
            D   YP+   P+V F  R + HPN+    G ICLD+LK+ W+P   +  V+ +I+ LLA
Sbjct: 60  DD---YPMEA-PKVRFLTR-IYHPNID-RLGRICLDVLKNNWSPALQIRTVLLSIQALLA 113

Query: 120 DPGLDSPLDLDIAQ 133
            P  + PL  D+A+
Sbjct: 114 SPNPNDPLANDVAE 127

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 66.2 bits (160), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 74/129 (57%), Gaps = 5/129 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           +D++ E+  +F GP ++P+EG    L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 28  NDNMQEFYVKFHGPKDTPYEGGVWRLHVELP-DNYPYKS-PSIGFVNK-IFHPNIDIASG 84

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYR 149
            ICLD++   W+P+Y LL+++   I  LL +P    PL+ + A +   D + Y + ++  
Sbjct: 85  SICLDVINSTWSPLYDLLNIIEWMIPGLLKEPNGSDPLNNEAAGLQLHDKKIYEEKIKEY 144

Query: 150 LEE-ARLAR 157
           +++ A LA+
Sbjct: 145 IDKYATLAK 153

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 65.9 bits (159), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 67/118 (56%), Gaps = 4/118 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           +D++ E+  +F GP E+P+EG    L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 14  NDNMQEFHVKFHGPRETPYEGGVWRLHVEL-PDNYPYKS-PSIGFVNK-IFHPNIDAASG 70

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            ICLD++  AW+P+Y LL+++   I  LL +P    PL+ + A +     E Y + +R
Sbjct: 71  SICLDVINSAWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATLQLKSKELYERKIR 128

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 64.3 bits (155), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 78/148 (52%), Gaps = 14/148 (9%)

Query: 2   SRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEG--FELGLNIT 59
            RI+KE     +RL +     IS  A   DD+L  +    +GP +SP+E   FEL L + 
Sbjct: 6   KRIIKE----TERLVSDPVPGIS--AEPHDDNLRYFQVTIEGPQQSPYENGVFELELFLP 59

Query: 60  IDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLA 119
              E YP+   P+V F  + + HPN+    G ICLD+LK+ W+P   +  V+ +I+ LLA
Sbjct: 60  ---EDYPMEA-PKVRFLTK-IYHPNID-RLGRICLDVLKNNWSPALQIRTVLLSIQALLA 113

Query: 120 DPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            P  + PL  D+A+ +  + E  +   +
Sbjct: 114 SPNPNDPLANDVAEDWIKNEEGAIATAK 141

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 65.1 bits (157), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 66/118 (55%), Gaps = 4/118 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           +D + E+  +F GP ++P+EG    L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 27  EDSMQEFHVKFYGPKDTPYEGGVWRLHVELP-DNYPYKS-PSIGFVNK-IFHPNIDIASG 83

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            ICLD++   W+P+Y LL++V   +  LL +P    PL+ + A +   D + Y + VR
Sbjct: 84  SICLDVINSTWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAANLQLKDKKVYEEKVR 141

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 65.1 bits (157), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 65/118 (55%), Gaps = 4/118 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           DD++ E+  +F GP  +P+E     L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 26  DDNMQEFHIKFHGPQGTPYEAGVWRLHVELP-DNYPYKS-PSIGFVNK-IFHPNIDAASG 82

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            ICLD++   W+P+Y L+++V   I  LL +P    PL+ + A +   + E Y Q +R
Sbjct: 83  SICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKNKELYEQKIR 140

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 77/148 (52%), Gaps = 14/148 (9%)

Query: 2   SRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEG--FELGLNIT 59
            RI+KE     +RL T     I+  A   DD+L  +    +GP  SP+E   F+L L + 
Sbjct: 6   KRIIKE----TERLITDPVPGIT--AEPHDDNLRYFEVTVEGPVGSPYENGIFQLELYLP 59

Query: 60  IDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLA 119
            D   YP+   P+V F  + + HPN+    G ICLD+LK  W+P   +  V+ +I+ LLA
Sbjct: 60  DD---YPMEA-PKVRFLTK-IYHPNID-RLGRICLDVLKTNWSPALQIRTVLLSIQALLA 113

Query: 120 DPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            P  + PL  D+A+ +  D EA  Q  +
Sbjct: 114 SPNPNDPLANDVAEDWIKDEEAAKQTAK 141

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 63.2 bits (152), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 74/136 (54%), Gaps = 24/136 (17%)

Query: 27  APVDDDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPN 84
            PV +D+L  W C  +GP++SP+EG  F   L    D   YP+S  P++ F P ++ HPN
Sbjct: 27  GPVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFPRD---YPLS-PPKLTFTP-SILHPN 81

Query: 85  VKWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDI 131
           V +  GE+C+ +L              + W+P+ ++  ++ ++  +L++P ++S  ++D 
Sbjct: 82  V-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSMLSEPNVESGANIDA 140

Query: 132 AQIY---DADYEAYVQ 144
             ++    AD+E  VQ
Sbjct: 141 CILWRDNRADFERQVQ 156

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 62.4 bits (150), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 64/117 (54%), Gaps = 4/117 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           +D+L  +    +GP +SP+E     L + +  + YP+   P+V F  + + HPN+    G
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFNLELFLP-DDYPMEA-PKVRFLTK-IYHPNID-KLG 84

Query: 91  EICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            ICLD+LK  W+P   +  V+ +++ LLA P  + PL  D+A+ +  D E  ++  R
Sbjct: 85  RICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKDEEGAIKTAR 141

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 62.8 bits (151), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 65/118 (55%), Gaps = 4/118 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           +D++ E+  +F GP ++P+E     L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 26  NDNMQEFHVKFHGPKDTPYEHGVWRLHVELP-DNYPYKS-PSIGFVNK-IFHPNIDVASG 82

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            ICLD++   W+P+Y L+++V   I  LL +P    PL+ + A +   D   Y Q ++
Sbjct: 83  SICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKVLYEQKIK 140

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 63.2 bits (152), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 9/133 (6%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           +D + E+  +F GP ++P+E     L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 27  NDSMQEFHIKFHGPKDTPYENGVWRLHVEL-PDNYPFKS-PSIGFVNK-IYHPNIDIASG 83

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQ----- 144
            ICLD++   W+P+Y LL++V   I  LL +P    PL+ + A +   D + Y +     
Sbjct: 84  SICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKMYEEKIKEY 143

Query: 145 IVRYRLEEARLAR 157
           I +Y  EE   A+
Sbjct: 144 IDKYATEEKYEAQ 156

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 62.4 bits (150), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 86/160 (53%), Gaps = 26/160 (16%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEG--FELGLNITI 60
           R++KE   LQ+ ++ P    ++   P D+ DL  W C  QGP +SP+EG  FE  L    
Sbjct: 8   RLLKE---LQQLMRDPPPGIVA--GPQDESDLFLWDCLVQGPPDSPYEGGVFEAQLRFPR 62

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLL-------------KDAWTPIYTL 107
           D   YP+S  P++ F P +V HPNV +  GE+C+ +L             ++ W+P+ ++
Sbjct: 63  D---YPLS-PPKLTFVP-SVLHPNV-YPNGEVCISILHAPGEDPNQYELAEERWSPVQSV 116

Query: 108 LDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
             ++ ++  +L++P ++S  ++D   ++  +   + + V+
Sbjct: 117 EKILLSVVSMLSEPNVESGANIDACVLWRDNRPEFERQVK 156

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 62.8 bits (151), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 64/118 (54%), Gaps = 4/118 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           +D + E+  +F GP ++P+E     L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 27  EDKMQEFHIKFHGPKDTPYEKGVWRLHVELP-DNYPYKS-PSIGFVNK-IFHPNIDAASG 83

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            ICLD++   W+P+Y LL++V   I  LL +P    PL+ + A +   D + Y Q + 
Sbjct: 84  SICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKDKDMYEQKIH 141

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 61.6 bits (148), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 60/105 (57%), Gaps = 8/105 (7%)

Query: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           DD+L  +    +GP +SP+E   FEL L +  D   YP+   P+V F  R + HPN+   
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGVFELELYLPDD---YPMEA-PKVRFLTR-IYHPNID-R 72

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQ 133
            G ICLD+LK  W+P   +  V+ +I+ LLA P  + PL  D+A+
Sbjct: 73  LGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 117

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 61.6 bits (148), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 65/113 (57%), Gaps = 8/113 (7%)

Query: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           DD+L  +    +GP++SP+E   F+L L +  D   YP+   P+V F  + + HPN+   
Sbjct: 29  DDNLRYFNVTVEGPTQSPYENGIFKLELYLPDD---YPMEA-PKVRFLTK-IYHPNID-R 82

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEA 141
            G ICLD+LK  W+P   +  V+ +I+ LLA P  + PL  D+A+ +  + EA
Sbjct: 83  LGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEEA 135

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 61.6 bits (148), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 76/138 (55%), Gaps = 19/138 (13%)

Query: 27  APVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEK-YPISGGPRVLFEPRTVAHPNV 85
            P  +D++ +W C  QGP +SP+EG     N  +D  K YP+S  P++ F P ++ HPN+
Sbjct: 27  GPKTEDNIFQWDCLVQGPPDSPYEGGV--FNAQLDFPKDYPLS-PPKLTFTP-SILHPNI 82

Query: 86  KWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIA 132
            +  GE+C+ +L             ++ W+P+ ++  ++ ++  +L++P ++S  ++D  
Sbjct: 83  -YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDAC 141

Query: 133 QIYDADYEAYVQIVRYRL 150
            ++  + + + + V+  +
Sbjct: 142 ILWRDNRKEFERQVKLNI 159

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 62.0 bits (149), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 69/130 (53%), Gaps = 13/130 (10%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           DD++ E+  +F GP  +P+E     L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 26  DDNMQEFHVKFHGPKGTPYERGVWRLHVEL-PDNYPYKS-PSIGFVNK-IFHPNIDAASG 82

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIA-------QIYDADYEAY 142
            ICLD++   W+P+Y LL++V   I  LL +P    PL+ + A       Q+Y+   + Y
Sbjct: 83  SICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKNPQMYEEKIQEY 142

Query: 143 VQIVRYRLEE 152
           +   +Y  EE
Sbjct: 143 ID--KYATEE 150

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 60/105 (57%), Gaps = 8/105 (7%)

Query: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           DD+L  +    +GP +SP+E   FEL L +  D   YP+   P+V F  + + HPN+   
Sbjct: 29  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDD---YPMEA-PKVRFLTK-IYHPNID-R 82

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQ 133
            G ICLD+LK  W+P   +  V+ +I+ LLA P  + PL  D+A+
Sbjct: 83  LGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 127

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 62.0 bits (149), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 65/118 (55%), Gaps = 4/118 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           +D++ E+  +F GP ++P+E     L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 27  NDNMQEFYVKFCGPKDTPYENGCWRLHVELP-DNYPYKS-PSIGFVNK-IFHPNIDIASG 83

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            ICLD++   W+P+Y LL++V   I  LL +P    PL+ + A +   D   Y Q ++
Sbjct: 84  SICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAGLQLHDKTLYEQKIK 141

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 60/105 (57%), Gaps = 8/105 (7%)

Query: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           DD+L  +    +GP +SP+E   FEL L +  D   YP+   P+V F  + + HPN+   
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGIFELELYLPDD---YPMEA-PKVRFLTK-IYHPNID-R 72

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQ 133
            G ICLD+LK  W+P   +  V+ +I+ LLA P  + PL  D+A+
Sbjct: 73  LGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 117

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 64/119 (53%), Gaps = 8/119 (6%)

Query: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           DD+L  +    +GP +SP+E   F+L L +  D   YP+   P+V F  + + HPN+   
Sbjct: 25  DDNLRYFKVSIEGPEQSPYEKGIFQLELYLPDD---YPMEA-PKVRFLTK-IYHPNID-R 78

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            G ICLD+LK  W+P   +  V+ +++ LLA P  + PL  D+A+ +  + E      R
Sbjct: 79  LGRICLDILKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEEGAKNTAR 137

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 65/119 (54%), Gaps = 8/119 (6%)

Query: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           +D+L  +    +GPS+SP+E   F+L L +    E YP+   P+V F  + + HPN+   
Sbjct: 29  EDNLRYFDVTIEGPSQSPYEKGIFKLELYLP---EDYPMEA-PKVRFLTK-IYHPNID-R 82

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            G ICLD+LK  W+P   +  V+ +I+ LLA P  + PL  D+A+ +  D     Q  +
Sbjct: 83  LGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAK 141

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 61.6 bits (148), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 66/118 (55%), Gaps = 4/118 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           +D++ E+  +F GP E+P+E     L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 26  NDNMQEFFIKFFGPDETPYEKGVWRLHVELP-DNYPYKS-PSIGFVNK-IFHPNIDIASG 82

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            ICLD++   W+P+Y L+++V   I  LL +P    PL+ + A +   D + Y + ++
Sbjct: 83  SICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGTDPLNNEAAGLQLRDKKLYEEKIK 140

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 61.6 bits (148), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 65/118 (55%), Gaps = 4/118 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           ++ + E+  +F GP ++P+E     L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 49  NNSMQEFHIKFHGPKDTPYEKGVWRLHVELP-DNYPYKS-PSIGFVNK-IFHPNIDIASG 105

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            ICLD++   W+P+Y LL++V   I  LL +P    PL+ + A +   D + Y + +R
Sbjct: 106 SICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLELRDKKLYEEKIR 163

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 76/145 (52%), Gaps = 10/145 (6%)

Query: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEG--FELGLNI 58
           MS + K  +   +RL +     I+  A   DD+L  +    +GP +SP+E   F+L L +
Sbjct: 1   MSSLPKRIIKETERLVSDPVPGIT--AEPHDDNLRYFEVTIEGPQQSPYENGVFDLELFL 58

Query: 59  TIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLL 118
             D   YP+   P+V F  + + HPN+    G ICLD+LK  W+P   +  V+ +I+ LL
Sbjct: 59  PDD---YPMEA-PKVRFLTK-IYHPNID-RLGRICLDVLKTNWSPALQIRTVLLSIQALL 112

Query: 119 ADPGLDSPLDLDIAQIYDADYEAYV 143
           A P  + PL  D+A+ +  D  + +
Sbjct: 113 ASPNPNDPLANDVAEDWIKDESSAI 137

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 84/162 (51%), Gaps = 24/162 (14%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDL 62
           R++KEY  L  R   P         P D++++ EW C   GP E+P+E      N T+  
Sbjct: 10  RLLKEYQQL-IRESPPGI----VAGPSDENNMFEWDCLISGPPETPYENG--VFNATLLF 62

Query: 63  EK-YPISGGPRVLFEPRTVAHPNVKWDTGEICLDLL-------------KDAWTPIYTLL 108
            K YP+S  P++ F P ++ HPN+ +  GE+C+ +L             ++ W+P+ ++ 
Sbjct: 63  PKDYPLS-PPKLTFTP-SLLHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVE 119

Query: 109 DVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRL 150
            ++ ++  +L++P ++S  ++D + +Y  +   + + V+  +
Sbjct: 120 KILLSVMSMLSEPNIESGANIDASILYRDNRPEFERQVKLSI 161

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 74/135 (54%), Gaps = 19/135 (14%)

Query: 27  APVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEK-YPISGGPRVLFEPRTVAHPNV 85
            P  +D+L  W C   GP +SP++G     N T++  K YP+S  P++LF P ++ HPN+
Sbjct: 27  GPRSEDNLFLWDCLISGPPDSPYQGGV--FNATLEFPKDYPLS-PPKLLFTP-SILHPNI 82

Query: 86  KWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIA 132
            +  GE+C+ +L             ++ W+P+ ++  ++ ++  +L++P ++S  ++D  
Sbjct: 83  -YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANIDAC 141

Query: 133 QIYDADYEAYVQIVR 147
            ++    E + + V+
Sbjct: 142 ILWRDSREEFEKQVK 156

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 59.7 bits (143), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 88/160 (55%), Gaps = 26/160 (16%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGL-NITID 61
           R++KEY   Q+ ++ P    ++  AP  + +L  W C  QGP ++P+EG   G+ N  +D
Sbjct: 8   RLLKEY---QQLIRDPPPGILA--APKSESNLFLWDCLIQGPPDTPYEG---GIFNARLD 59

Query: 62  LEK-YPISGGPRVLFEPRTVAHPNVKWDTGEICLDLL-------------KDAWTPIYTL 107
             K YP+S  P++ F P ++ HPN+ +  GE+C+ +L             ++ W+P+ ++
Sbjct: 60  FPKDYPLS-PPKLTFTP-SILHPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSV 116

Query: 108 LDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
             ++ ++  +L++P ++S  ++D   ++  +   + + V+
Sbjct: 117 EKILLSVMSMLSEPNIESGANVDACILWRDNRPEFERRVK 156

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 59.7 bits (143), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 74/139 (53%), Gaps = 21/139 (15%)

Query: 27  APVDDDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPN 84
            PV+++++  W C   GP +SP+EG  F   L    D   YP+S  P++ F P ++ HPN
Sbjct: 27  GPVNEENMFLWDCLIAGPPDSPYEGGIFNARLQFPTD---YPLS-PPKLTFTP-SILHPN 81

Query: 85  VKWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDI 131
           V +  GE+C+ +L              + W+P+ ++  ++ ++  +L++P ++S  ++D 
Sbjct: 82  V-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSMLSEPNVESGANIDA 140

Query: 132 AQIYDADYEAYVQIVRYRL 150
             ++  +   +V+ V+  +
Sbjct: 141 CILWRDNRPDFVKQVKISI 159

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 60.5 bits (145), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 65/118 (55%), Gaps = 4/118 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           +D + E+  +F GP ++P+E     L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 26  NDSMQEFHVKFLGPKDTPYENGVWRLHVELP-DNYPYKS-PSIGFVNK-IFHPNIDIASG 82

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            ICLD++   W+P+Y L+++V   I  LL +P    PL+ + A +   D + Y + ++
Sbjct: 83  SICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIK 140

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 59.7 bits (143), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 73/135 (54%), Gaps = 19/135 (14%)

Query: 27  APVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEK-YPISGGPRVLFEPRTVAHPNV 85
            P  +D+L  W C   GP +SP+EG     N  ++  K YP+S  PR+ F P ++ HPN+
Sbjct: 27  GPKSEDNLFLWDCLITGPPDSPYEGGV--FNAMLEFPKDYPLS-PPRLTFTP-SILHPNI 82

Query: 86  KWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIA 132
            +  GE+C+ +L             ++ W+P+ ++  ++ ++  +L++P ++S  ++D  
Sbjct: 83  -YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVTSMLSEPNVESGANIDAC 141

Query: 133 QIYDADYEAYVQIVR 147
            ++  +   Y++ V+
Sbjct: 142 ILWRDNRPEYMRRVK 156

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 59.3 bits (142), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 61/105 (58%), Gaps = 8/105 (7%)

Query: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           +D+L  +    +GP +SP+E   F+L L +  D   YP+   P+V F  + + HPN+   
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFQLELFLPDD---YPMEA-PKVRFLTK-IYHPNID-R 82

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQ 133
            G ICLD+LK+ W+P   +  V+ +++ LLA P  + PL  D+A+
Sbjct: 83  LGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 60.5 bits (145), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 69/128 (53%), Gaps = 4/128 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           +D++ E+  +F GP ++P+E     L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 28  NDNMQEFHVKFHGPKDTPYETGVWRLHVELP-DNYPYKS-PSIGFVNK-IFHPNIDIASG 84

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYR 149
            ICLD++   W+P+Y L ++V   I  LL +P    PL+ + A +   D + Y + ++  
Sbjct: 85  SICLDVINSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIKEY 144

Query: 150 LEEARLAR 157
           +++   A 
Sbjct: 145 IDKYACAE 152

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 59.7 bits (143), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 84/165 (50%), Gaps = 27/165 (16%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEG--FELGLNITI 60
           R++KE   L K   T   +      P  ++DL  W C  QGP ++P+EG  F   L    
Sbjct: 8   RLLKELQQLMKDSSTGIVA-----GPRSENDLFVWDCLIQGPPDTPYEGGIFNAKLEFPK 62

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLL-------------KDAWTPIYTL 107
           D   YP+S  P++ F P ++ HPN+ +  GE+C+ +L             ++ W+P+ ++
Sbjct: 63  D---YPLS-PPKLTFTP-SILHPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSV 116

Query: 108 LDVVGAIRDLLADPGLDSPLDLDIAQIY-DADYEAYVQIVRYRLE 151
             ++ ++  +L++P ++S  ++D   ++ D   E  +Q+ R  L+
Sbjct: 117 EKILLSVMSMLSEPNVESGANVDACILWRDNRPEFELQVKRSILQ 161

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 60.1 bits (144), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 64/118 (54%), Gaps = 4/118 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           +D + E+  +F GP ++P+E     L++ +  + YP    P + F    + HPN+   +G
Sbjct: 14  NDSMQEFHVKFHGPKDTPYEKGVWRLHVEL-PDNYPYKS-PSIGF-VNKIFHPNIDAASG 70

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            ICLD++   W+P+Y L+++V   I  LL +P    PL+ + A +   + E Y + ++
Sbjct: 71  SICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLKNKELYEEKIQ 128

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 60.1 bits (144), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 66/118 (55%), Gaps = 4/118 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           +D++ E+  +F+GP ++P+E     L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 14  NDNMQEFHVKFRGPKDTPYEKGVWRLHVELP-DNYPYKS-PSIGFVNK-ILHPNIDVASG 70

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            ICLD++   W+P+Y L ++V   I  LL +P    PL+ + A +   D + Y + ++
Sbjct: 71  SICLDVINSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIK 128

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 58.9 bits (141), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 66/119 (55%), Gaps = 8/119 (6%)

Query: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           +D+L  +    +GP +SP+E   F+L L +  D   YP+   P+V F  + + HPN+   
Sbjct: 29  EDNLRYFQVTIEGPQQSPYESGVFQLELFLPDD---YPMEA-PKVRFLTK-IYHPNID-R 82

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            G ICLD+LK  W+P   +  V+ +++ LLA P  + PL  D+A+ +  + +A +   R
Sbjct: 83  LGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIRNEDAAIAKAR 141

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 60.5 bits (145), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 66/118 (55%), Gaps = 4/118 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           +D++ E+  +F GP ++P+E     L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 44  NDNMQEFYIKFCGPKDTPYENGVWRLHVEL-PDNYPYKS-PSIGFVNK-IFHPNIDIASG 100

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
            ICLD++   W+P+Y LL++V   I  LL +P    PL+ + A +   D + Y + ++
Sbjct: 101 SICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLELKDKKLYEERIK 158

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 60.1 bits (144), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 74/139 (53%), Gaps = 6/139 (4%)

Query: 12  QKRLQTPEFSWISFLAPVD--DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISG 69
           ++R++T     +     VD  +D + E+  +F GP ++P+E     L++ +  + YP   
Sbjct: 5   KRRIETDVMKLLMSDHQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELP-DNYPYKS 63

Query: 70  GPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLD 128
            P + F  + + HPN+   +G ICLD++   W+P+Y L+++V   I  LL +P    PL+
Sbjct: 64  -PSIGFVNK-IFHPNIDIASGSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLN 121

Query: 129 LDIAQIYDADYEAYVQIVR 147
            + A +   D + Y + ++
Sbjct: 122 NEAATLQLRDKKLYEEKIK 140

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 58.9 bits (141), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 85/162 (52%), Gaps = 24/162 (14%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDL 62
           R++KE   L K   +PE    S   P+DD +L +W C   GP +S +EG     N  +D 
Sbjct: 8   RLLKELEKLTK--DSPEGILAS---PIDDSNLFQWDCLIMGPPDSCYEGGV--FNARLDF 60

Query: 63  EK-YPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-------------DAWTPIYTLL 108
            K YP++  P++ F+P ++ HPN+ +  GE+C+ +L              + W+P+ ++ 
Sbjct: 61  PKDYPLN-PPKLTFQP-SILHPNI-YPNGEVCISILHSPGSDPNMYEHECERWSPVQSVE 117

Query: 109 DVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRL 150
            ++ ++  +L++P ++S  ++D   ++  +   + + V+  L
Sbjct: 118 MILLSVMSILSEPNIESGANIDACILWRDNRPEFERQVKLNL 159

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 59.7 bits (143), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 74/139 (53%), Gaps = 6/139 (4%)

Query: 12  QKRLQTPEFSWISFLAPVD--DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISG 69
           ++R++T     +     VD  +D + E+  +F GP ++P+E     L++ +  + YP   
Sbjct: 5   KRRIETDVMKLLMSDHEVDLVNDSMQEFHVKFLGPKDTPYENGVWRLHVELP-DNYPYKS 63

Query: 70  GPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLD 128
            P + F  + + HPN+   +G ICLD++   W+P+Y L+++V   I  LL +P    PL+
Sbjct: 64  -PSIGFVNK-IFHPNIDIASGSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLN 121

Query: 129 LDIAQIYDADYEAYVQIVR 147
            + A +   D + Y + ++
Sbjct: 122 NEAATLQLRDKKLYEEKIK 140

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 58.5 bits (140), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 60/105 (57%), Gaps = 8/105 (7%)

Query: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           DD+L  +    +GP +SP+E   F+L L +  D   YP+   P+V F  + + HPN+   
Sbjct: 19  DDNLRYFQVTIEGPEQSPYEDGVFKLELFLPDD---YPMEA-PKVRFLTK-IYHPNID-R 72

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQ 133
            G ICLD+LK  W+P   +  V+ +I+ LLA P  + PL  D+A+
Sbjct: 73  LGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 117

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 58.9 bits (141), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 75/138 (54%), Gaps = 19/138 (13%)

Query: 27  APVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEK-YPISGGPRVLFEPRTVAHPNV 85
            P  +D+L  W C   GP +SP++G     N T++  K YP+S  P++LF P ++ HPN+
Sbjct: 27  GPKSEDNLFVWDCLISGPPDSPYQGGV--FNATLEFPKDYPLS-PPKLLFTP-SILHPNI 82

Query: 86  KWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIA 132
            +  GE+C+ +L             ++ W+P+ ++  ++ ++  +L++P ++S  ++D  
Sbjct: 83  -YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANIDAC 141

Query: 133 QIYDADYEAYVQIVRYRL 150
            ++  +   + + V+  +
Sbjct: 142 ILWRDNRPEFERQVKLSI 159

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 78/147 (53%), Gaps = 10/147 (6%)

Query: 2   SRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITID 61
            RI+KE     +RL +     IS  A   +D+L  +    +GP +S +E     L + + 
Sbjct: 6   KRIIKE----TERLVSDPVPGIS--AEPHEDNLRYFDVSIEGPQQSAYENGVFRLELFLP 59

Query: 62  LEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADP 121
            ++YP+   P+V F  + + HPN+    G ICLD+LK  W+P   +  V+ +I+ LLA P
Sbjct: 60  -DEYPMEP-PKVRFLTK-IYHPNID-RLGRICLDVLKTNWSPALQIRTVLLSIQALLATP 115

Query: 122 GLDSPLDLDIAQIYDADYEAYVQIVRY 148
             + PL  D+A+ + AD +A +   ++
Sbjct: 116 NPNDPLANDVAEDWIADEDAAIAKAKH 142

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 57.8 bits (138), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 8/105 (7%)

Query: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           +D+L  +    +GP +S +E   FEL L +  D   YP+   P+V F  + + HPN+   
Sbjct: 29  EDNLRYFSVTIEGPKDSAYENGVFELELFLPDD---YPMEA-PKVRFLTK-IYHPNID-R 82

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQ 133
            G ICLD+LK+ W+P   +  V+ +I+ LLA P  + PL  D+A+
Sbjct: 83  LGRICLDVLKNNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 127

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 73/137 (53%), Gaps = 24/137 (17%)

Query: 27  APVDDDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPN 84
            P  DD+L  W C  QGP ++P+ G  F   L    D   YP+S  P++ F P ++ HPN
Sbjct: 27  GPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKD---YPLS-PPKLTFTP-SILHPN 81

Query: 85  VKWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDI 131
           + +  GE+C+ +L             ++ W+P+ ++  ++ ++  +L++P ++S  ++D 
Sbjct: 82  I-YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDA 140

Query: 132 AQIY---DADYEAYVQI 145
             ++    A++E  V++
Sbjct: 141 CILWRDNRAEFEKQVKL 157

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 8/105 (7%)

Query: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           +D+L  +    +GP+ SP+E   F+L L +  D   YP+   P+V F  + + HPN+   
Sbjct: 29  EDNLRYFNVTVEGPAGSPYENGIFQLELYLPDD---YPMEA-PKVRFLTK-IYHPNID-R 82

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQ 133
            G ICLD+LK  W+P   +  V+ +++ LLA P  + PL  D+A+
Sbjct: 83  LGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 8/105 (7%)

Query: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           DD+L  +    +GP  SP+E   F+L L +  D   YP+   P+V F  + + HPN+   
Sbjct: 29  DDNLRYFSVTIEGPEGSPYEHGIFDLELFLPDD---YPMES-PKVRFLTK-IYHPNID-R 82

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQ 133
            G ICLD+LK  W+P   +  V+ +I+ LLA P  + PL  D+A+
Sbjct: 83  LGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 127

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 58.2 bits (139), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 59/105 (56%), Gaps = 4/105 (3%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTG 90
           DD++ E+  +F GP  +P+E     L++ +  + YP    P + F  + + HPN+   +G
Sbjct: 26  DDNMQEFHVKFLGPRGTPYERGVWRLHVELP-DNYPYKS-PSIGFVNK-IFHPNIDAASG 82

Query: 91  EICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLDLDIAQI 134
            ICLD++   W+P+Y L+++V   I  LL +P    PL+ + A +
Sbjct: 83  SICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATL 127

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 73/136 (53%), Gaps = 21/136 (15%)

Query: 27  APVDDDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPN 84
            P ++++L  W C  QGP ++ +EG  F   L    D   YP+S  P++ F P ++ HPN
Sbjct: 27  CPKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPKD---YPLSP-PKLTFTP-SILHPN 81

Query: 85  VKWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDI 131
           + +  GE+C+ +L             ++ W+P+ ++  ++ ++  +L++P ++S  ++D 
Sbjct: 82  I-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEKILLSVMSMLSEPNIESGANIDA 140

Query: 132 AQIYDADYEAYVQIVR 147
             ++  + E + + VR
Sbjct: 141 CILWRDNREEFERQVR 156

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 57.8 bits (138), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 74/139 (53%), Gaps = 6/139 (4%)

Query: 12  QKRLQTPEFSWISFLAPVD--DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISG 69
           ++R++T     +     VD  +D + E+  +F GP ++P+E     L++ +  + YP   
Sbjct: 4   KRRIETDVMKLLMSDHQVDLVNDSMQEFHVKFLGPKDTPYENGVWRLHVEL-PDNYPYKS 62

Query: 70  GPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVG-AIRDLLADPGLDSPLD 128
            P + F  + + HPN+   +G ICLD++   W+P+Y L++++   I  LL +P    PL+
Sbjct: 63  -PSIGFVNK-IFHPNIDIASGSICLDVINSTWSPLYDLINILEWMIPGLLKEPNGSDPLN 120

Query: 129 LDIAQIYDADYEAYVQIVR 147
            + A +   D + Y + ++
Sbjct: 121 NEAATLQLRDKKLYEEKIK 139

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 56.2 bits (134), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 60/105 (57%), Gaps = 8/105 (7%)

Query: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88
           +++L  +    +GP +SP+E   F+L L +  D   YP+   P+V F  + + HPN+   
Sbjct: 29  EENLRYFQVTIEGPQQSPYENGVFKLELFLPDD---YPMEA-PKVRFLTK-IYHPNID-R 82

Query: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQ 133
            G ICLD+LK  W+P   +  V+ +++ LLA P  + PL  D+A+
Sbjct: 83  LGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 56.2 bits (134), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 71/132 (53%), Gaps = 10/132 (7%)

Query: 2   SRIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITID 61
            RI+KE     +RL +     IS  A   +D+L  +    +GP +SP+E     L + + 
Sbjct: 6   KRIIKE----TERLVSDPVPGIS--AEPHEDNLRYFDVSIEGPQQSPYEHGVFRLELFLP 59

Query: 62  LEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADP 121
            ++YP+   P+V F  + + HPN+    G ICLD+LK  W+P   +  V+ +I+ LLA P
Sbjct: 60  -DEYPMEP-PKVRFLTK-IYHPNID-RLGRICLDVLKTNWSPALQIRTVLLSIQALLATP 115

Query: 122 GLDSPLDLDIAQ 133
             + PL  D+A+
Sbjct: 116 NPNDPLANDVAK 127

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 56.2 bits (134), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 76/136 (55%), Gaps = 21/136 (15%)

Query: 27  APVDDDDLSEWVCRFQGPSESPFEGFELGL-NITIDLEK-YPISGGPRVLFEPRTVAHPN 84
            P ++++L  W C  QGP ++ +EG   G+ N  +D  K YP+S  P++ F P ++ HPN
Sbjct: 27  GPANENNLFVWDCLVQGPPDTAYEG---GIFNARLDFPKDYPLS-PPKLTFTP-SILHPN 81

Query: 85  VKWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDI 131
           + +  GE+C+ +L             ++ W+P+ ++  ++ ++  +L++P ++S  ++D 
Sbjct: 82  I-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDA 140

Query: 132 AQIYDADYEAYVQIVR 147
             ++  + + + + V+
Sbjct: 141 CILWRDNRKEFERQVK 156

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 58/115 (50%), Gaps = 6/115 (5%)

Query: 47  SPFEGFELGLNITIDLE---KYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTP 103
           SP EG+    +    LE    YP+   P+V+   R + HPN+    G++CL++L++ W+P
Sbjct: 76  SPDEGYYKNGHFRFSLEFNDNYPMEP-PKVVCRNR-IYHPNIDVQ-GKVCLNILREDWSP 132

Query: 104 IYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEARLARV 158
              L  ++  +  L  +P    PL+ D A ++  D  A+ + VR  +E   L  V
Sbjct: 133 ALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVFSKDSNAFAKFVRKTMEGYSLNSV 187

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 54.3 bits (129), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 73/151 (48%), Gaps = 16/151 (10%)

Query: 15  LQTPEFSWISFLAPVDDDDLSEWVCRFQGP----SESPFEGF--ELGLNITIDL-EKYPI 67
           L  P    ++ + P D  D      R Q P    + SP EG+     +N  +D  E YPI
Sbjct: 38  LDLPPTVTLNVITPPDSTD------RMQSPKLEVTVSPDEGYYNHGSINFGLDFNEVYPI 91

Query: 68  SGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPL 127
              P+V    + + HPN+    G +CL++L++ W+P   L  ++  +  L  +P  + PL
Sbjct: 92  EP-PKVACL-KKIFHPNIDL-KGNVCLNILREDWSPALDLQSIITGLLFLFLEPNPNDPL 148

Query: 128 DLDIAQIYDADYEAYVQIVRYRLEEARLARV 158
           + D A+++  + + + +IVR  +    + +V
Sbjct: 149 NKDAAKLFCQNEKKFAEIVRSTMSGGSVNQV 179

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 53.5 bits (127), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 81/160 (50%), Gaps = 26/160 (16%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEG--FELGLNITI 60
           R++KE   LQ+  + P    I+  AP  + DL  W C   GP ++P+ G  F   L    
Sbjct: 8   RLLKE---LQQLTRDPPPGIIA--APKTESDLFTWDCLVAGPPDTPYAGGLFNCQLQFPT 62

Query: 61  DLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLL-------------KDAWTPIYTL 107
           D   YP+S  P + F P ++ HPNV +  GE+C+ +L             ++ W+P+ ++
Sbjct: 63  D---YPLS-PPTLTFTP-SILHPNV-YPNGEVCISILHAPGSDPNMYELPEERWSPVQSV 116

Query: 108 LDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
             ++ ++  +L++P ++S  ++D   ++    + + + V+
Sbjct: 117 EKILLSVVSMLSEPNVESGANIDACILWRDHRDDFNKKVK 156

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 53.1 bits (126), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 63/119 (52%), Gaps = 21/119 (17%)

Query: 27  APVDDDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPN 84
            P +++DL  W C  QGP ++P+E   F   L    D   YP+S  P + F P  + HPN
Sbjct: 27  GPANENDLFLWDCLIQGPPDTPYEHGVFNAQLRFPRD---YPLS-PPTLTFTP-AILHPN 81

Query: 85  VKWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLD 130
           + +  GE+C+ +L             ++ W+P+ ++  ++ ++  +L++P ++S  ++D
Sbjct: 82  I-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANID 139

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 52.0 bits (123), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 60/115 (52%), Gaps = 6/115 (5%)

Query: 47  SPFEGF--ELGLNITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTP 103
           +P EG+     +N ++D  E YPI   P+V    R + HPN+ +  G +CL++L++ W+P
Sbjct: 68  NPDEGYYTHGSINFSLDFNEVYPIEP-PKVACLKR-IFHPNIDF-KGNVCLNILREDWSP 124

Query: 104 IYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEARLARV 158
              L  +V  +  L  +P  + PL+ D A++   D + + + VR  +    +  V
Sbjct: 125 ALDLQSIVTGLLFLFLEPNPNDPLNKDAAKLLCQDEKEFAEAVRSTMSGGSINHV 179

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 52.4 bits (124), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 54/104 (51%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P+  F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP ++SP ++D A  Y  + E Y Q V+  +E ++
Sbjct: 125 LISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERSK 168

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 52.4 bits (124), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 54/104 (51%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P+  F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP ++SP ++D A  Y  + E Y Q V+  +E ++
Sbjct: 125 LISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERSK 168

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 52.4 bits (124), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 54/104 (51%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P+  F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP ++SP ++D A  Y  + E Y Q V+  +E ++
Sbjct: 125 LISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERSK 168

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 51.6 bits (122), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 59/113 (52%), Gaps = 4/113 (3%)

Query: 44  PSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTP 103
           P E  ++G +     T  LE YPI   P+V+   + + HPN+    G+ICL++L++ W+P
Sbjct: 71  PDEGFYKGGKFRFTATF-LETYPIDP-PKVICNNK-IFHPNID-PHGKICLNILREDWSP 126

Query: 104 IYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEARLA 156
              L  +V  +  L  +P  + PL+ + A++ + D   +  +VR  +  A + 
Sbjct: 127 ALDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLNKDKLEFGNLVRLAMSGAMVG 179

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 50.8 bits (120), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 74/139 (53%), Gaps = 21/139 (15%)

Query: 27  APVDDDDLSEWVCRFQGPSESPF-EGFELGLNITIDLEK-YPISGGPRVLFEPRTVAHPN 84
            P  ++++  W C  QGP ++P+ +G     N  ++  K YP+S  P++ F P ++ HPN
Sbjct: 27  GPKSENNIFVWDCLIQGPPDTPYADGI---FNAKLEFPKDYPLSP-PKLTFTP-SILHPN 81

Query: 85  VKWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDI 131
           + +  GE+C+ +L             ++ W+P+ ++  ++ ++  +L++P ++S  ++D 
Sbjct: 82  I-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDA 140

Query: 132 AQIYDADYEAYVQIVRYRL 150
             ++  +   + + V+  +
Sbjct: 141 CILWRDNRPEFEKQVKLSI 159

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 52.0 bits (123), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 53/104 (50%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P+  F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PQFRFTP-AIYHPNVYRD-GRLCISILHQGGDPMTDEPDAETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP + SP ++D A  Y  + E Y Q V+  +E ++
Sbjct: 125 LISIVSLLEDPNISSPANVDAAVDYRKNQEQYKQRVKMEVERSK 168

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 52.0 bits (123), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 54/104 (51%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P+  F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP ++SP ++D A  Y  + E Y Q V+  +E ++
Sbjct: 125 LISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERSK 168

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 50.8 bits (120), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 74/139 (53%), Gaps = 21/139 (15%)

Query: 27  APVDDDDLSEWVCRFQGPSESPF-EGFELGLNITIDLEK-YPISGGPRVLFEPRTVAHPN 84
            P  ++++  W C  QGP ++P+ +G     N  ++  K YP+S  P++ F P ++ HPN
Sbjct: 27  GPKSENNIFVWDCLIQGPPDTPYADGV---FNAKLEFPKDYPLSP-PKLTFTP-SILHPN 81

Query: 85  VKWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDI 131
           + +  GE+C+ +L             ++ W+P+ ++  ++ ++  +L++P ++S  ++D 
Sbjct: 82  I-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDA 140

Query: 132 AQIYDADYEAYVQIVRYRL 150
             ++  +   + + V+  +
Sbjct: 141 CILWRDNRPEFEKQVKLSI 159

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 50.4 bits (119), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 74/139 (53%), Gaps = 21/139 (15%)

Query: 27  APVDDDDLSEWVCRFQGPSESPF-EGFELGLNITIDLEK-YPISGGPRVLFEPRTVAHPN 84
            P  ++++  W C  QGP ++P+ +G     N  ++  K YP+S  P++ F P ++ HPN
Sbjct: 27  GPKSENNIFVWDCLIQGPPDTPYADGV---FNTKLEFPKDYPLSP-PKLTFTP-SILHPN 81

Query: 85  VKWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDI 131
           + +  GE+C+ +L             ++ W+P+ ++  ++ ++  +L++P ++S  ++D 
Sbjct: 82  I-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDA 140

Query: 132 AQIYDADYEAYVQIVRYRL 150
             ++  +   + + V+  +
Sbjct: 141 CILWRDNRPEFERQVKLSI 159

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 18/124 (14%)

Query: 39  CRFQGPSESPFEGFELGLNITID---------------LEKYPISGGPRVLFEPRTVAHP 83
            R + P E P E  EL + I  D                + YPI   P V+   + + HP
Sbjct: 54  VRIKSPIEFPAESPELLITIHPDEGIYKDGYFPFSMVFKDSYPIE--PPVVKFLKKIYHP 111

Query: 84  NVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYV 143
           N+  + G+ICL++L++ W+P+  L  ++  +  L  +P    PL+L   ++   + + ++
Sbjct: 112 NIDLN-GKICLNILREDWSPVLDLQSIIIGLMFLFLEPNPRDPLNLKAGELLKENKQEFI 170

Query: 144 QIVR 147
            IVR
Sbjct: 171 DIVR 174

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 74/139 (53%), Gaps = 21/139 (15%)

Query: 27  APVDDDDLSEWVCRFQGPSESPF-EGFELGLNITIDLEK-YPISGGPRVLFEPRTVAHPN 84
            P  ++++  W C  QGP ++P+ +G     N  ++  K YP+S  P++ F P ++ HPN
Sbjct: 27  GPKSENNIFIWDCLIQGPPDTPYADGV---FNAKLEFPKDYPLSP-PKLTFTP-SILHPN 81

Query: 85  VKWDTGEICLDLL-------------KDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDI 131
           + +  GE+C+ +L             ++ W+P+ ++  ++ ++  +L++P ++S  ++D 
Sbjct: 82  I-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDA 140

Query: 132 AQIYDADYEAYVQIVRYRL 150
             ++  +   + + V+  +
Sbjct: 141 CILWRDNRPEFERQVKLSI 159

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 53/104 (50%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P+  F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PQFRFTP-AIYHPNVYRD-GRLCISILHQGGDPMTDEPDAETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP + SP ++D A  Y  + E Y Q V+  +E ++
Sbjct: 125 LISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVKMEVERSK 168

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 68/146 (46%), Gaps = 4/146 (2%)

Query: 13  KRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPR 72
             L+ P    +S L+ + D   S  +     P E  ++  +   ++  + E YPI   P 
Sbjct: 45  NNLELPPGVNLSILSVLSDLKESPHLTLLISPDEGYYKSGKFKFDLKFN-ENYPIE--PP 101

Query: 73  VLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIA 132
           ++     + HPN+  D G+ICL++L++ W+P   L  ++  +  L  +     PL+ + A
Sbjct: 102 IVLCMNKIFHPNIDLD-GKICLNILREDWSPALDLNSIIIGLLYLFLECNAKDPLNKEAA 160

Query: 133 QIYDADYEAYVQIVRYRLEEARLARV 158
            I  +D + + + VR  +   +L  +
Sbjct: 161 NILHSDEDMFRKYVRDSMAGKKLFNI 186

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 68/146 (46%), Gaps = 4/146 (2%)

Query: 13  KRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPR 72
             L+ P    +S L+ + D   S  +     P E  ++  +   ++  + E YPI   P 
Sbjct: 46  NNLELPPGVNLSILSVLSDLKESPHLTLLISPDEGYYKSGKFKFDLKFN-ENYPIE--PP 102

Query: 73  VLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIA 132
           ++     + HPN+  D G+ICL++L++ W+P   L  ++  +  L  +     PL+ + A
Sbjct: 103 IVLCMNKIFHPNIDLD-GKICLNILREDWSPALDLNSIIIGLLYLFLECNAKDPLNKEAA 161

Query: 133 QIYDADYEAYVQIVRYRLEEARLARV 158
            I  +D + + + VR  +   +L  +
Sbjct: 162 NILHSDEDMFRKYVRDSMAGKKLFNI 187

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 57/108 (52%), Gaps = 8/108 (7%)

Query: 47  SPFEGFELGLNITIDL---EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTP 103
            P EG+  G N T +L   E+YP+   P+V    R + HPN+  D G +CL++L+  WTP
Sbjct: 60  KPDEGYYKGGNFTFELLFNEQYPMEP-PKVKCLNR-IYHPNIDTD-GRVCLNILRQDWTP 116

Query: 104 IYTLLDV-VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRL 150
              L  V +G +   L   G+D PL+   A+ ++ + + +   VR  +
Sbjct: 117 ALDLQSVIIGLLFLFLEISGVD-PLNKQAAETFNRNRQNFAHAVRQSM 163

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 62/146 (42%), Gaps = 4/146 (2%)

Query: 13  KRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPR 72
             L  P    ++ L P +D   S  +     P E  + G     N+T   E YPI     
Sbjct: 22  NSLDVPPTVSLTTLVPPEDTSRSPLLQITICPDEGFYNGGRFKFNLTTS-ESYPIDPPSV 80

Query: 73  VLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIA 132
           V  +   + HPN+  + G+ICL++L++ W+P   +  V+  +  L  +P    PL+ D A
Sbjct: 81  VCLQ--KIYHPNIDLN-GKICLNILREDWSPALDIQSVIVGLLFLFLEPNPRDPLNKDAA 137

Query: 133 QIYDADYEAYVQIVRYRLEEARLARV 158
                +   + ++V   ++      V
Sbjct: 138 STLIRNSHDFARLVEKTMQGGNYMNV 163

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 52/104 (50%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P   F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PSFRFTP-AIYHPNVYRD-GRLCISILHQSGDPTSDEPDSETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP + SP ++D A  Y  + E Y Q V+  +E ++
Sbjct: 125 LISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVKLEVERSK 168

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 52/104 (50%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P   F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PSFRFTP-AIYHPNVYRD-GRLCISILHQSGDPTSDEPDSETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP + SP ++D A  Y  + E Y Q V+  +E ++
Sbjct: 125 LISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVKLEVERSK 168

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 51/104 (49%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P   F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PNFRFTP-AIYHPNVYRD-GRLCISILHQSGDPTSDEPDSETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP + SP ++D A  Y  + E Y Q V   +E ++
Sbjct: 125 LISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVHLEVERSK 168

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 52/104 (50%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P   F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PTFRFTP-AIYHPNVYRD-GRLCISILHTSGDPTSEEPDSETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP + SP ++D A  Y  + E Y Q V+  +E ++
Sbjct: 125 LISIVSLLEDPNISSPANVDAAVDYRKNIEQYKQRVQLEVERSK 168

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 14/96 (14%)

Query: 71  PRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDVVGAIRDLL 118
           P+  F P  + HPNV  D G +C+ +L             + W+P+ T+  V+ +I  LL
Sbjct: 75  PQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDELDAETWSPVQTVESVLISIVSLL 132

Query: 119 ADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
            DP + SP ++D A  Y  + E Y Q V+  +E ++
Sbjct: 133 EDPNISSPANVDAAVDYRKNPEQYKQRVKMEVERSK 168

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P+  F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP + SP ++D A  Y  + + Y Q V+  +E ++
Sbjct: 125 LISIVSLLEDPNISSPANVDAAVDYRKNPDQYKQRVKMEVERSK 168

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P+  F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPTTDEPDAETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP + SP ++D A  Y  + E Y Q ++  +E ++
Sbjct: 125 LISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRIKMEVERSK 168

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 47.4 bits (111), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 53/98 (54%), Gaps = 6/98 (6%)

Query: 58  ITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAI 114
           ITI+  ++YP S  P+V+F P+   HPNV + +G ICL +L +   W P  TL  +V  +
Sbjct: 25  ITIEYPDEYP-SKPPKVMF-PKGFYHPNV-YPSGTICLSILNEEQDWRPAITLKQIVLGV 81

Query: 115 RDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEE 152
           +DLL  P  +SP      + +  +   Y + V  + ++
Sbjct: 82  QDLLDSPNPNSPAQEPAWRAFSRNKSEYEKKVSSQAKQ 119

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 48.5 bits (114), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 51/96 (53%), Gaps = 14/96 (14%)

Query: 71  PRVLFEPRTVAHPNVKWDTGEICLDLL------------KDAWTPIYTLLDVVGAIRDLL 118
           P   F P  + HPNV  D G++C+ +L             + W+P+ ++  V+ +I  LL
Sbjct: 76  PHFKFVP-PIYHPNVYKD-GKLCISILHQSGDSMTSEPDNETWSPVQSVESVLISIISLL 133

Query: 119 ADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
            DP + SP ++D +  Y  +++ Y + VR ++E ++
Sbjct: 134 EDPNISSPANVDASVEYRKNFQEYKRKVRLQVERSK 169

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 48.1 bits (113), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 56/103 (54%), Gaps = 6/103 (5%)

Query: 47  SPFEGFELGLNITIDL---EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTP 103
           SP EG+    +I+  L   E YPI   P+V    + + HPN+  + G +CL++L++ W+P
Sbjct: 68  SPDEGYYNHGSISFSLDFNEVYPIEP-PKVTCL-KKIFHPNIDLN-GNVCLNILREDWSP 124

Query: 104 IYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIV 146
              L  ++  +  L  +P  + PL+ D A+++  D + + + V
Sbjct: 125 ALDLQSIIIGLLFLFLEPNPNDPLNKDAAKLFCQDQKKFAETV 167

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 48.1 bits (113), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 50/105 (47%), Gaps = 4/105 (3%)

Query: 43  GPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWT 102
            P E P+ G     N+  + E YPI     +      + HPN+  + G+ICL++L++ W+
Sbjct: 76  SPREGPYLGGAFKFNLKFN-EMYPIEPPSAICLN--KIFHPNIDLN-GKICLNILREDWS 131

Query: 103 PIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147
           P   L  +V  +  L  D     PL+   A++   D   + ++V+
Sbjct: 132 PALDLTSIVIGLLYLFLDFTSTDPLNQQAAEVLANDRNRFCELVQ 176

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 49/96 (51%), Gaps = 14/96 (14%)

Query: 71  PRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDVVGAIRDLL 118
           P+  F P  + HPNV  D G +C+ +L             + W+P+ ++  V+ +I  LL
Sbjct: 75  PQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDELDAETWSPVQSVESVLISIVSLL 132

Query: 119 ADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
            DP + SP ++D A  Y  + E Y Q ++  +E ++
Sbjct: 133 EDPNISSPANVDAAVDYRKNPEQYKQRIKMEVERSK 168

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 14/96 (14%)

Query: 71  PRVLFEPRTVAHPNVKWDTGEICLDLL------------KDAWTPIYTLLDVVGAIRDLL 118
           P   F P  + HPNV  D G +C+ +L            ++ W+P+ T+  V+ +I  LL
Sbjct: 74  PTFRFTP-AIYHPNVYRD-GRLCISILHQSGNPTSDEPDEETWSPVQTVESVLISIVSLL 131

Query: 119 ADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
            DP + SP ++D A  Y  + + Y Q V+  +E ++
Sbjct: 132 EDPNISSPANVDAAVDYKKNPDQYKQKVKLEVERSK 167

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 14/96 (14%)

Query: 71  PRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDVVGAIRDLL 118
           P+  F P  + HPNV  D G +C+ +L             + W+P+ T+  V+ +I  LL
Sbjct: 75  PQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLL 132

Query: 119 ADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
            DP + SP ++D A  Y  + + Y Q V+  +E ++
Sbjct: 133 EDPNISSPANVDAAVDYRKNPDQYKQRVKMEVERSK 168

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 14/96 (14%)

Query: 71  PRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDVVGAIRDLL 118
           P+  F P  + HPNV  D G +C+ +L             + W+P+ T+  V+ +I  LL
Sbjct: 75  PQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLL 132

Query: 119 ADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
            DP + SP ++D A  +  + E Y Q V+  +E ++
Sbjct: 133 EDPNISSPANVDAAVDFRKNPEQYKQRVKMEVERSK 168

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 50/96 (52%), Gaps = 14/96 (14%)

Query: 71  PRVLFEPRTVAHPNVKWDTGEICLDLL------------KDAWTPIYTLLDVVGAIRDLL 118
           P+  F P  + HPNV  D G++C+ +L             + W+P+ ++  V+ +I  LL
Sbjct: 82  PQFKFIP-PIYHPNVYRD-GKLCISILHQSGDAMTSEPDNETWSPVQSVESVLISIVSLL 139

Query: 119 ADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
            DP + SP ++D A  Y  +Y  Y + V  ++E +R
Sbjct: 140 EDPNVSSPANVDAAVEYRKNYNEYKKKVLQQVERSR 175

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 52/104 (50%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P+  F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP + SP ++D A  Y  + + Y Q V   +E ++
Sbjct: 125 LISIVSLLEDPNISSPANVDAAVDYRKNPDQYRQRVLMEVERSK 168

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 9/100 (9%)

Query: 58  ITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAI 114
           ITI+  + YP S  PRV F P    HPN+ + +G +CL +L +   W P  T+  ++  +
Sbjct: 60  ITIEYPDDYP-SKPPRVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWKPAITMKQILLGV 116

Query: 115 RDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           +DLL  P  +SP      + Y  + + Y + V   LE+AR
Sbjct: 117 QDLLTSPNPNSPAQEPAWRAYAKNLQEYEKKV---LEQAR 153

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 9/100 (9%)

Query: 58  ITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAI 114
           ITI+  + YP S  P+V F P    HPN+ + +G +CL +L +   W P  T+  ++  +
Sbjct: 60  ITIEYPDDYP-SKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWKPAITMKQILLGV 116

Query: 115 RDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           +DLL  P  DSP      + Y  + + Y + V   LE+AR
Sbjct: 117 QDLLTSPNPDSPAQEPAWRAYAKNVQEYEKKV---LEQAR 153

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 6/106 (5%)

Query: 48  PFEGFELGLNITIDLE---KYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPI 104
           P EGF  G + T  LE    YPI   P  +     + HPN+  D G++CL++L++ W+P 
Sbjct: 73  PDEGFYKGGHFTFKLEFNDAYPIE--PPTVICTSKLYHPNIDID-GKVCLNILREDWSPA 129

Query: 105 YTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRL 150
             +  ++  +  LL +P    PL+ D A +   D   +  +V   +
Sbjct: 130 LDVQSIIIGLLFLLLEPNAKDPLNKDAAMMLSTDTARFASLVNRSM 175

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 53/104 (50%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P+  F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP + SP ++D A  Y  + + Y Q ++  ++ ++
Sbjct: 125 LISIVSLLEDPNISSPANVDAAVDYRKNPDQYKQRIKSEVDRSK 168

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 51/104 (49%), Gaps = 15/104 (14%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK------------DAWTPIYTLLDV 110
           E +P S  P   F P  + HPNV  D G +C+ +L             + W+P+ T+  V
Sbjct: 68  EDFPFSP-PTFRFTP-AIYHPNVYRD-GRLCISILHTSGDPTSEEPDSETWSPVQTVESV 124

Query: 111 VGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           + +I  LL DP + SP ++D A  Y  + + Y Q V   +E ++
Sbjct: 125 LISIVSLLEDPNISSPANVDAAVDYRKNADQYRQRVLLEVERSK 168

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 53/105 (50%), Gaps = 4/105 (3%)

Query: 55  GLNITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGA 113
            +N  +D  E YPI   P+V+   + + HPN+    G +CL++L++ W+P   L  ++  
Sbjct: 79  SINFNLDFNEVYPIEP-PKVVCL-KKIFHPNIDL-KGNVCLNILREDWSPALDLQSIITG 135

Query: 114 IRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEARLARV 158
           +  L  +P  + PL+ D A++     + + + VR  +    +  V
Sbjct: 136 LLFLFLEPNPNDPLNKDAAKLLCEGEKEFAEAVRLTMSGGSIEHV 180

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 8/96 (8%)

Query: 47  SPFEGF----ELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWT 102
           SP EGF      G +++   + YPI   P ++    T+ HPN+ ++ G ICL++L++ WT
Sbjct: 149 SPDEGFYKHGHFGFSVSFK-DSYPID--PPIVKCLTTIYHPNIDYN-GNICLNVLREDWT 204

Query: 103 PIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDAD 138
           P+  L  +V  +  L  +P    PL+   A     D
Sbjct: 205 PVLDLQTIVIGLLFLFLEPNPKDPLNKHAAHTMVKD 240

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 8/105 (7%)

Query: 50  EGF-ELG---LNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIY 105
           EGF  LG      TI+ E YPI   P+V+   + + HPN+   TGEICL++L++ W+P  
Sbjct: 83  EGFYNLGHFRFQFTIN-ENYPIEP-PKVVCLTK-IYHPNINR-TGEICLNILREDWSPAL 138

Query: 106 TLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRL 150
            L  V+  +  L  +P    PL+   A     D   +  IV+  +
Sbjct: 139 DLQSVIIGLLFLFIEPNPKDPLNKQAADTLLHDPAVFKHIVQKSM 183

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 61/139 (43%), Gaps = 21/139 (15%)

Query: 12  QKRLQTPEF---SWISFLAPVDDDDLSEWVCRFQ--------------GPSESPFEGFEL 54
           Q +  TP+    S I     +++ DLSE +C +                P    + G   
Sbjct: 18  QGQETTPQVIKPSLIRLKKDLENIDLSEQICEYTTYLDENPMRVNLAIKPDIGYYAGGTY 77

Query: 55  GLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAI 114
             N+ I  + YP+   P V+     + HPN+  D G +CL+LL++ WTP   +  ++  I
Sbjct: 78  YFNVFIK-DTYPME--PPVVKCMHRIYHPNIDID-GNVCLNLLREDWTPALDIQSIIIGI 133

Query: 115 RDLLADPGLDSPLDLDIAQ 133
             L  +P    PL+ D A+
Sbjct: 134 LFLFHEPNGRDPLNKDAAK 152

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 6/107 (5%)

Query: 47  SPFEGFELGLNITIDL---EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTP 103
           SP EGF    + T ++   EKYPI   P  +     + HPN+    G+ICL++L++ W+P
Sbjct: 69  SPDEGFYRKGHFTFEMTFTEKYPIE--PPQVRCMNQIFHPNIDLQ-GKICLNILREDWSP 125

Query: 104 IYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRL 150
              L  V+  I  L  +     PL+   A + D +   + ++V+  +
Sbjct: 126 ALDLQSVIIGILFLFLEVSGRDPLNKQAASLLDENPNKFSRLVQQTM 172

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 6/92 (6%)

Query: 58  ITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAI 114
           ITI+  + YP S  P+V F P    HPN+ + +G +CL +L +   W P  TL  +V  +
Sbjct: 60  ITIEYPDDYP-SKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGV 116

Query: 115 RDLLADPGLDSPLDLDIAQIYDADYEAYVQIV 146
           +DLL  P  DSP      + +  + + Y + V
Sbjct: 117 QDLLNSPNPDSPAQEPAWRAFSKNIKEYEKKV 148

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 33  DLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEI 92
           DL +W     G   + + G    + +    E YP S  P+V F P    HPNV + +G I
Sbjct: 37  DLQKWEAGIPGKDATNWAGGVYPITVEYPNE-YP-SKPPKVKF-PAGFYHPNV-YPSGTI 92

Query: 93  CLDLLKDA--WTPIYTLLDVVGAIRDLLADPGLDSP 126
           CL +L +   W P  TL  +V  ++DLL  P  +SP
Sbjct: 93  CLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 33  DLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEI 92
           DL +W     G   + + G    +++    E YP S  P+V F P    HPNV + +G I
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPISVEYPNE-YP-SKPPKVKF-PAGFYHPNV-YPSGTI 92

Query: 93  CLDLLKDA--WTPIYTLLDVVGAIRDLLADPGLDSP 126
           CL +L +   W P  TL  +V  ++DLL  P  +SP
Sbjct: 93  CLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAIRDLLAD 120
           ++YP S  P+V F P    HPN+ + +G +CL +L +   W P  TL  +V  ++DLL  
Sbjct: 66  DEYP-SKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLLDS 122

Query: 121 PGLDSPLDLDIAQIYDADYEAYVQIV 146
           P  +SP      + +  + E Y + V
Sbjct: 123 PNPNSPAQEPAWRAFSKNKEEYQKKV 148

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 33  DLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEI 92
           DL +W     G   + + G    + +    E YP S  P+V F P    HPNV + +G I
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPITVEYPNE-YP-SKPPKVKF-PAGFYHPNV-YPSGTI 92

Query: 93  CLDLLKDA--WTPIYTLLDVVGAIRDLLADPGLDSP 126
           CL +L +   W P  TL  +V  ++DLL  P  +SP
Sbjct: 93  CLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 50/103 (48%), Gaps = 15/103 (14%)

Query: 64  KYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA------------WTPIYTLLDVV 111
            +P S  P  LF P  + HPNV +  G +C+ +L +             W+P+ T+  V+
Sbjct: 70  NFPFSP-PTFLFCP-PIYHPNV-FSNGSLCISILHECGDDTNEEPDSETWSPVQTVETVL 126

Query: 112 GAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
            +I  LL DP + SP ++D A  Y    + Y + V   +E ++
Sbjct: 127 ISIISLLDDPNVSSPANVDAAVEYKNARQEYNKRVILEVEASK 169

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 43/91 (47%), Gaps = 4/91 (4%)

Query: 58  ITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAIR 115
           ITI+      S  P+V   P    HPNV + +G ICL +L +   W P  TL  +   I+
Sbjct: 60  ITIEYPNEYPSKPPKVKL-PANFYHPNV-YPSGTICLSILNEDQDWRPAITLKQICLGIQ 117

Query: 116 DLLADPGLDSPLDLDIAQIYDADYEAYVQIV 146
           DLL  P  +SP      + +  + E Y + V
Sbjct: 118 DLLDSPNPNSPAQEPAWRSFSKNKEEYEKKV 148

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 47/96 (48%), Gaps = 6/96 (6%)

Query: 33  DLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEI 92
           DL +W     G   + + G    + +    E YP S  P+V F P    HPNV + +G I
Sbjct: 37  DLQKWEAGIPGREGTNWAGGVYPITVEYPNE-YP-SKPPKVKF-PAGFYHPNV-YPSGTI 92

Query: 93  CLDLLKDA--WTPIYTLLDVVGAIRDLLADPGLDSP 126
           CL +L +   W P  TL  +V  ++DLL  P  +SP
Sbjct: 93  CLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 48/92 (52%), Gaps = 6/92 (6%)

Query: 58  ITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAI 114
           ITI+  ++YP S  P+V F P    HPN+ + +G +CL +L +   W P  TL  +V  +
Sbjct: 60  ITIEYPDEYP-SKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGV 116

Query: 115 RDLLADPGLDSPLDLDIAQIYDADYEAYVQIV 146
           +DLL  P  +SP      + +  +   Y + V
Sbjct: 117 QDLLDTPNPNSPAQEPAWRAFSKNKSEYEKRV 148

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 9/94 (9%)

Query: 58  ITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAI 114
           IT++  ++YP S  P+V F P    HPN+ + +G +CL +L +   W P  TL  +V  +
Sbjct: 60  ITVEYPDEYP-SKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVLGV 116

Query: 115 RDLLADPGLDSPLDLDIAQIYD---ADYEAYVQI 145
           +DLL  P  +SP      + +    A+YE  V I
Sbjct: 117 QDLLDSPNPNSPAQEPAWRAFSKNKAEYEKKVLI 150

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 52/100 (52%), Gaps = 9/100 (9%)

Query: 58  ITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAI 114
           ITI+  + YP S  P+V F P    HPN+ + +G +CL +L +   W P  TL  +   +
Sbjct: 60  ITIEYPDDYP-SKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIALGV 116

Query: 115 RDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           +DLL  P  +SP      + +  + + Y + V   +E+A+
Sbjct: 117 QDLLDSPNPNSPAQEPAWRAFSKNVKEYERKV---IEQAK 153

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 52/100 (52%), Gaps = 9/100 (9%)

Query: 58  ITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAI 114
           ITI+  + YP S  P+V F P    HPN+ + +G +CL +L +   W P  TL  +   +
Sbjct: 25  ITIEYPDDYP-SKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIALGV 81

Query: 115 RDLLADPGLDSPLDLDIAQIYDADYEAYVQIVRYRLEEAR 154
           +DLL  P  +SP      + +  + + Y + V   +E+A+
Sbjct: 82  QDLLDSPNPNSPAQEPAWRAFSKNVKEYERKV---IEQAK 118

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 65  YPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAIRDLLADPG 122
           YP S  P+V F P    HPNV + +G ICL +L +   W P  TL  ++  ++DLL  P 
Sbjct: 68  YP-SKPPKVKF-PAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQLLLGVQDLLDSPN 124

Query: 123 LDSPLDLDIAQIYDADYEAYVQIV 146
            +SP      + +  + + Y + V
Sbjct: 125 PNSPAQEPAWRAFSKNIKEYERKV 148

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 36/71 (50%), Gaps = 4/71 (5%)

Query: 58  ITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAIR 115
           ITI+      S  P+V   P    HPNV + +G ICL +L +   W P  TL  +   I+
Sbjct: 60  ITIEYPNEYPSKPPKVKL-PAGFYHPNV-YPSGTICLSILNEEQDWRPAITLKQICLGIQ 117

Query: 116 DLLADPGLDSP 126
           DLL  P  +SP
Sbjct: 118 DLLDSPNPNSP 128

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAIRDLLAD 120
           ++YP S  P+V F P    HPN+ + +G +CL +L +   W P  TL  +V  ++DLL  
Sbjct: 66  DEYP-SKPPKVRF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVIGVQDLLDT 122

Query: 121 PGLDSP 126
           P  +SP
Sbjct: 123 PNPNSP 128

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 41/72 (56%), Gaps = 6/72 (8%)

Query: 58  ITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAI 114
           ITI+  ++YP S  P+V F P    HPN+ + +G +CL +L +   W P  TL  +   +
Sbjct: 60  ITIEYPDEYP-SKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIALGV 116

Query: 115 RDLLADPGLDSP 126
           +DLL  P  +SP
Sbjct: 117 QDLLDSPNPNSP 128

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 40.4 bits (93), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 6/69 (8%)

Query: 80  VAHPNVKWDT-GEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYD-- 136
           + HPN+  DT G +CL++L++ W+P+  L  VV  +  L  +P    PL+   AQ     
Sbjct: 101 IYHPNI--DTQGNVCLNILREDWSPVLDLQSVVIGLLFLFLEPNDKDPLNRMAAQELSKS 158

Query: 137 -ADYEAYVQ 144
            AD++ +VQ
Sbjct: 159 PADFKRHVQ 167

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 40.0 bits (92), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 9/94 (9%)

Query: 58  ITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAI 114
           +TI+  ++YP S  P+V   P    HPNV + +G ICL +L +   W P  TL  +   I
Sbjct: 60  LTIEYPDEYP-SKPPKVKL-PANFYHPNV-YPSGTICLSILNEDQDWRPAITLKQICLGI 116

Query: 115 RDLLADPGLDSPLDLDIAQIYD---ADYEAYVQI 145
           +DLL  P  +SP      + +    A+YE  V I
Sbjct: 117 QDLLDSPNPNSPAQEPAWRAFSRNKAEYEKKVVI 150

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 46/92 (50%), Gaps = 6/92 (6%)

Query: 58  ITIDL-EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA--WTPIYTLLDVVGAI 114
           +TI+  ++YP S  P+V   P    HPNV + +G ICL +L +   W P  TL  +   I
Sbjct: 60  LTIEYPDEYP-SKPPKVKL-PAGFYHPNV-YPSGTICLSILNEDQDWRPAITLKQICLGI 116

Query: 115 RDLLADPGLDSPLDLDIAQIYDADYEAYVQIV 146
           +DLL  P  +SP      + +  +   Y + +
Sbjct: 117 QDLLDSPNPNSPAQEPAWRAFSKNKAEYEKKI 148

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 47  SPFEGFELGLNITIDL---EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTP 103
           SP EG   G +    +   + YPI   P  +    T+ HPN+ + +G ICL++L++ W+P
Sbjct: 82  SPEEGVYRGGHFRFSVVFRDTYPIE--PPTVKCLNTIYHPNIDY-SGNICLNVLREDWSP 138

Query: 104 IYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDAD---YEAYVQ 144
           +  L  VV  +  L  +P    PL+   A     D   +E  VQ
Sbjct: 139 VMDLQTVVLGLLFLFLEPNGSDPLNRQAADTMLRDPYRFETNVQ 182

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 36.2 bits (82), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 3/80 (3%)

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPG 122
           + YPI   P+V    + + HPN+    G +CL++L++ W+P+  +  ++  +  L  +P 
Sbjct: 86  DTYPIEP-PKVTLLSK-IFHPNIDLQ-GNVCLNILREDWSPVLDVQSILIGLLMLFLEPN 142

Query: 123 LDSPLDLDIAQIYDADYEAY 142
              PL+   A +  A+   +
Sbjct: 143 ATDPLNKVAADVLAANPHQF 162

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 43/97 (44%), Gaps = 9/97 (9%)

Query: 26  LAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNV 85
           LA  ++D++ EW     GP+E+P++G +    +T   + YP       +  P     PN 
Sbjct: 26  LARPNEDNILEWHYIITGPAETPYKGGQYHGTLTFPSD-YPYKPPAIRMVTPNGRFKPNT 84

Query: 86  KWDTGEICL---DLLKDAWTPIYTLLDVVGAIRDLLA 119
           +     +CL   D   D W P +++  ++  +   + 
Sbjct: 85  R-----LCLSMSDYHPDTWNPGWSVSTILNGLLSFMT 116

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 32.0 bits (71), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 43/97 (44%), Gaps = 9/97 (9%)

Query: 26  LAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNV 85
           LA  ++D++ EW     GP+++P++G +    +T   + YP       +  P     PN 
Sbjct: 26  LARPNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSD-YPYKPPAIRMITPNGRFKPNT 84

Query: 86  KWDTGEICL---DLLKDAWTPIYTLLDVVGAIRDLLA 119
           +     +CL   D   D W P +++  ++  +   + 
Sbjct: 85  R-----LCLSMSDYHPDTWNPGWSVSTILNGLLSFMT 116

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 31.6 bits (70), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 43/98 (43%), Gaps = 9/98 (9%)

Query: 26  LAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNV 85
           LA  ++D++ EW     GP+++P++G +    +T   + YP       +  P     PN 
Sbjct: 26  LARPNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSD-YPYKPPAIRMVTPNGRFKPNT 84

Query: 86  KWDTGEICL---DLLKDAWTPIYTLLDVVGAIRDLLAD 120
           +     +CL   D   D W P +++  ++  +   +  
Sbjct: 85  R-----LCLSMSDYHPDTWNPGWSVSTILNGLLSFMTS 117

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 55/123 (44%), Gaps = 21/123 (17%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDL 62
           R+ KEY  + +   TP +     +A  +D+++ EW     GP ++P+EG +    +    
Sbjct: 9   RLSKEYKMIME--NTPPY----IIAVPNDENILEWHYVITGPPDTPYEGGQYHGTLHFPP 62

Query: 63  EKYPISGGPRVLFEPRT--VAHPNVKWDTG-EICL---DLLKDAWTPIYTLLDVVGAIRD 116
           E YP        F+P    ++ PN ++     +CL   D   D W P +++  ++  +  
Sbjct: 63  E-YP--------FKPPAIRISTPNGRFKQHTRLCLSMSDYHPDTWNPSWSVATILNGLLS 113

Query: 117 LLA 119
            + 
Sbjct: 114 FMT 116

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/120 (20%), Positives = 49/120 (40%), Gaps = 15/120 (12%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDL 62
           R+ KEY  +      P F     +A   +D++ EW     GP  +P+E  +    +T   
Sbjct: 9   RLTKEYKNIVN--NPPPF----IIAAPHEDNILEWHYVITGPPSTPYENGQYHGTLTFPS 62

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICL---DLLKDAWTPIYTLLDVVGAIRDLLA 119
           + YP +     +  P      N +     +CL   D   +AW P ++++ ++  +   + 
Sbjct: 63  D-YPFNPPAIRMITPNGRFKENTR-----LCLSMSDYHPEAWNPAWSVVTILNGLLSFMT 116

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/97 (20%), Positives = 42/97 (43%), Gaps = 9/97 (9%)

Query: 26  LAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNV 85
           LA  ++D++ EW     GP+++P++  +    +T   + YP       +  P     PN 
Sbjct: 26  LARPNEDNILEWHYIITGPADTPYKAGQYHGTLTFPSD-YPYKPPAIRMITPNGRFKPNT 84

Query: 86  KWDTGEICL---DLLKDAWTPIYTLLDVVGAIRDLLA 119
           +     +CL   D   D W P +++  ++  +   + 
Sbjct: 85  R-----LCLSMSDYHPDTWNPGWSVSTILNGLLSFMT 116

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 15/120 (12%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDL 62
           R+ KEY  L +   +P F     LA  ++D++ EW     GP ++P++G +    +T   
Sbjct: 9   RLTKEYKLLVE--SSPPF----ILARPNEDNILEWHYIITGPPDTPYDGGQYHGTLTFPN 62

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICL---DLLKDAWTPIYTLLDVVGAIRDLLA 119
           + YP       +  P      N +     +CL   D   D W P +++  ++  +   + 
Sbjct: 63  D-YPYKPPAIRMITPNGRFKENTR-----LCLSMSDYHPDTWNPGWSVSTILNGLLSFMT 116

>Skud_11.18 Chr11 complement(39396..46814) [7419 bp, 2472 aa] {ON}
            YKL203C (REAL)
          Length = 2472

 Score = 29.3 bits (64), Expect = 5.6,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 2    SRIVKEYMGLQKRLQTPEFS--WISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNIT 59
            S +V  Y  L K L    FS  W+  L     +DL E +C+    SE+P E +++ LN+ 
Sbjct: 1262 SSLVSVYYPLAKELFNASFSSCWVE-LQSSYQEDLVEALCKALSSSENPPEIYQMLLNLV 1320

Query: 60   IDLE 63
              +E
Sbjct: 1321 EFME 1324

>Suva_11.20 Chr11 complement(39570..46991) [7422 bp, 2473 aa] {ON}
            YKL203C (REAL)
          Length = 2473

 Score = 28.9 bits (63), Expect = 7.9,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 2    SRIVKEYMGLQKRLQTPEFS--WISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNIT 59
            S +V  Y  L + L    FS  W+    P  +D L + +C+    SE+P E +++ LN+ 
Sbjct: 1264 SSLVGVYYPLARELFNASFSSCWVELQIPYQED-LVQALCKALSSSENPPEIYQMLLNLV 1322

Query: 60   IDLE 63
              +E
Sbjct: 1323 EFME 1326

>YGR100W Chr7 (690245..693097) [2853 bp, 950 aa] {ON}
           MDR1Cytoplasmic GTPase-activating protein for Ypt/Rab
           transport GTPases Ypt6p, Ypt31p and Sec4p; involved in
           recycling of internalized proteins and regulation of
           Golgi secretory function
          Length = 950

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 22/44 (50%)

Query: 31  DDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVL 74
           +DD++E + +  G   +     EL   +TID EKY +    R L
Sbjct: 692 EDDIAENIIKESGGEIATMNQIELPTGVTIDEEKYKVEQAERYL 735

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 28.1 bits (61), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 50/120 (41%), Gaps = 15/120 (12%)

Query: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDL 62
           R+ KEY  + +    P F     +A  ++D++ EW     GP ++P+EG +    +    
Sbjct: 9   RLTKEYKSMVE--NPPPF----IIAQPNEDNILEWHYVITGPPDTPYEGGQYHGTLVFPS 62

Query: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICL---DLLKDAWTPIYTLLDVVGAIRDLLA 119
           + YP       +  P        K DT  +CL   D   D W P +++  ++  +   + 
Sbjct: 63  D-YPFKPPAIRMVTPSG----RFKEDT-RLCLSMSDYHPDTWNPSWSVSTILTGLLSFMT 116

>KLLA0E03851g Chr5 (352621..354423) [1803 bp, 600 aa] {ON} some
           similarities with uniprot|Q12374 Saccharomyces
           cerevisiae YPR155C NCA2 Protein involved in regulation
           of mitochondrial expression of subunits 6 (Atp6p) and 8
           (Atp8p) of the Fo-F1 ATP synthase functions with Nca3p
          Length = 600

 Score = 28.5 bits (62), Expect = 9.5,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 43/79 (54%), Gaps = 2/79 (2%)

Query: 74  LFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYTLLD-VVGAIRDLLADPGLDSPLDLDIA 132
           ++ P T     V++D+GE+ +    +  + + +L+  +V  +RD  + PG +  +D    
Sbjct: 352 IWTPITQIWDTVRFDSGELYVTTKDNLTSELNSLIRMIVEFLRD-RSPPGTNVDVDSLTK 410

Query: 133 QIYDADYEAYVQIVRYRLE 151
           QI D D + +++I  +++E
Sbjct: 411 QIMDGDLQDFMKIYEHQIE 429

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.142    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,005,618
Number of extensions: 776147
Number of successful extensions: 1613
Number of sequences better than 10.0: 235
Number of HSP's gapped: 1441
Number of HSP's successfully gapped: 235
Length of query: 158
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 58
Effective length of database: 42,014,799
Effective search space: 2436858342
Effective search space used: 2436858342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)