Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E04005gna 1ON1371377092e-97
KLTH0F14916gna 1ON1511375002e-65
SAKL0F02684gna 1ON1381384697e-61
Kwal_55.21247na 1ON1341354611e-59
SAKL0F16654gsingletonON1311304359e-56
Kwal_23.2807singletonON1291274262e-54
KLTH0C11880gsingletonON1311304244e-54
KLLA0B14817gsingletonON1311304211e-53
ZYRO0C18436gsingletonON1291274159e-53
TDEL0D00210singletonON1301313653e-45
ZYRO0D09856gna 1ON1561293413e-41
SAKL0F02640gsingletonON1161112853e-33
Kwal_47.16590singletonON1261272761e-31
KLTH0E03168gsingletonON1481282735e-31
TDEL0H020607.238ON1771281451e-11
YER057C (HMF1)7.238ON129991412e-11
Skud_5.1717.238ON1291021394e-11
Smik_5.1877.238ON1291021386e-11
ZYRO0C08074g7.238ON1431281386e-11
Suva_5.1657.238ON1291031351e-10
Kpol_1033.127.238ON1431281352e-10
ADL077C7.238ON1421011334e-10
NDAI0E047507.238ON1281041254e-09
Smik_9.1397.238ON1451221265e-09
KNAG0L014507.238ON1311011238e-09
KAFR0I018307.238ON1431221249e-09
NCAS0E032407.238ON1281001212e-08
NDAI0A025507.238ON1441151203e-08
YIL051C (MMF1)7.238ON1451141203e-08
KAFR0L008607.238ON1281081194e-08
TBLA0D040907.238ON1551011195e-08
KNAG0D016207.238ON142991178e-08
NCAS0A134907.238ON1481151152e-07
TPHA0C011007.238ON1421041143e-07
Kpol_1009.257.238ON1271011115e-07
TBLA0J014207.238ON1261001106e-07
Skud_9.1187.238ON1451141117e-07
TPHA0K009207.238ON128671091e-06
Suva_9.1487.238ON1451141091e-06
CAGL0M12386g7.238ON1421031072e-06
Kwal_23.58047.238ON1411031072e-06
SAKL0F08558g7.238ON1441031072e-06
KLLA0C08349g7.238ON1401001046e-06
KLTH0A04224g7.238ON1411031047e-06
NCAS0C031508.349ON68995820.013
SAKL0H14938g8.349ON691128820.014
Suva_10.2398.349ON68988800.028
Skud_12.2148.349ON68467790.032
TDEL0F047308.349ON69484790.042
YLR143W8.349ON68567780.053
CAGL0M04521g8.349ON68883720.31
Kpol_1036.868.349ON69769710.42
KLTH0G11594g8.349ON68487700.65
Smik_12.2098.349ON68465700.65
Smik_15.3275.483ON62344680.94
Kwal_56.23744singletonOFF9051641.4
Skud_15.3115.483ON62244661.8
TPHA0C006508.349ON71177662.1
KAFR0H021508.349ON70245662.1
NDAI0F011506.293ON56674652.8
KLLA0E17887g3.124ON288982618.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E04005g
         (137 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E04005g Chr5 complement(364475..364888) [414 bp, 137 aa] {O...   277   2e-97
KLTH0F14916g Chr6 (1220286..1220741) [456 bp, 151 aa] {ON} weakl...   197   2e-65
SAKL0F02684g Chr6 complement(228156..228572) [417 bp, 138 aa] {O...   185   7e-61
Kwal_55.21247 s55 (747831..748235) [405 bp, 134 aa] {ON} YER057C...   182   1e-59
SAKL0F16654g Chr6 (1378394..1378789) [396 bp, 131 aa] {ON} weakl...   172   9e-56
Kwal_23.2807 s23 (20785..21174) [390 bp, 129 aa] {ON} YER057C (H...   168   2e-54
KLTH0C11880g Chr3 complement(982966..983361) [396 bp, 131 aa] {O...   167   4e-54
KLLA0B14817g Chr2 (1301705..1302100) [396 bp, 131 aa] {ON} weakl...   166   1e-53
ZYRO0C18436g Chr3 complement(1444072..1444461) [390 bp, 129 aa] ...   164   9e-53
TDEL0D00210 Chr4 (34669..35061) [393 bp, 130 aa] {ON}                 145   3e-45
ZYRO0D09856g Chr4 complement(834023..834493) [471 bp, 156 aa] {O...   135   3e-41
SAKL0F02640g Chr6 complement(227067..227417) [351 bp, 116 aa] {O...   114   3e-33
Kwal_47.16590 s47 complement(15715..16095) [381 bp, 126 aa] {ON}...   110   1e-31
KLTH0E03168g Chr5 complement(285658..286104) [447 bp, 148 aa] {O...   109   5e-31
TDEL0H02060 Chr8 (350315..350848) [534 bp, 177 aa] {ON} Anc_7.23...    60   1e-11
YER057C Chr5 complement(270737..271126) [390 bp, 129 aa] {ON}  H...    59   2e-11
Skud_5.171 Chr5 complement(266894..267283) [390 bp, 129 aa] {ON}...    58   4e-11
Smik_5.187 Chr5 complement(274856..275245) [390 bp, 129 aa] {ON}...    58   6e-11
ZYRO0C08074g Chr3 complement(619866..620297) [432 bp, 143 aa] {O...    58   6e-11
Suva_5.165 Chr5 complement(246850..247239) [390 bp, 129 aa] {ON}...    57   1e-10
Kpol_1033.12 s1033 complement(28172..28603) [432 bp, 143 aa] {ON...    57   2e-10
ADL077C Chr4 complement(549523..549951) [429 bp, 142 aa] {ON} Sy...    56   4e-10
NDAI0E04750 Chr5 complement(1071393..1071779) [387 bp, 128 aa] {...    53   4e-09
Smik_9.139 Chr9 complement(231954..232391) [438 bp, 145 aa] {ON}...    53   5e-09
KNAG0L01450 Chr12 complement(258500..258895) [396 bp, 131 aa] {O...    52   8e-09
KAFR0I01830 Chr9 complement(375688..376119) [432 bp, 143 aa] {ON...    52   9e-09
NCAS0E03240 Chr5 (641701..642087) [387 bp, 128 aa] {ON} Anc_7.238      51   2e-08
NDAI0A02550 Chr1 complement(570003..570437) [435 bp, 144 aa] {ON...    51   3e-08
YIL051C Chr9 complement(257843..258280) [438 bp, 145 aa] {ON}  M...    51   3e-08
KAFR0L00860 Chr12 complement(161978..162364) [387 bp, 128 aa] {O...    50   4e-08
TBLA0D04090 Chr4 (1016159..1016626) [468 bp, 155 aa] {ON} Anc_7....    50   5e-08
KNAG0D01620 Chr4 complement(272653..273081) [429 bp, 142 aa] {ON...    50   8e-08
NCAS0A13490 Chr1 (2655822..2656268) [447 bp, 148 aa] {ON} Anc_7....    49   2e-07
TPHA0C01100 Chr3 (250318..250746) [429 bp, 142 aa] {ON} Anc_7.23...    49   3e-07
Kpol_1009.25 s1009 complement(58847..59230) [384 bp, 127 aa] {ON...    47   5e-07
TBLA0J01420 Chr10 (325885..326265) [381 bp, 126 aa] {ON} Anc_7.2...    47   6e-07
Skud_9.118 Chr9 complement(226723..227160) [438 bp, 145 aa] {ON}...    47   7e-07
TPHA0K00920 Chr11 (190389..190775) [387 bp, 128 aa] {ON} Anc_7.2...    47   1e-06
Suva_9.148 Chr9 complement(246539..246976) [438 bp, 145 aa] {ON}...    47   1e-06
CAGL0M12386g Chr13 (1236543..1236971) [429 bp, 142 aa] {ON} simi...    46   2e-06
Kwal_23.5804 s23 complement(1324907..1325332) [426 bp, 141 aa] {...    46   2e-06
SAKL0F08558g Chr6 complement(654765..655199) [435 bp, 144 aa] {O...    46   2e-06
KLLA0C08349g Chr3 (731629..732051) [423 bp, 140 aa] {ON} similar...    45   6e-06
KLTH0A04224g Chr1 complement(356660..357085) [426 bp, 141 aa] {O...    45   7e-06
NCAS0C03150 Chr3 complement(617756..619825) [2070 bp, 689 aa] {O...    36   0.013
SAKL0H14938g Chr8 complement(1295178..1297253) [2076 bp, 691 aa]...    36   0.014
Suva_10.239 Chr10 (436127..438196) [2070 bp, 689 aa] {ON} YLR143...    35   0.028
Skud_12.214 Chr12 (410879..412933) [2055 bp, 684 aa] {ON} YLR143...    35   0.032
TDEL0F04730 Chr6 (889641..891725) [2085 bp, 694 aa] {ON} Anc_8.3...    35   0.042
YLR143W Chr12 (427329..429386) [2058 bp, 685 aa] {ON} Putative p...    35   0.053
CAGL0M04521g Chr13 (496157..498223) [2067 bp, 688 aa] {ON} simil...    32   0.31 
Kpol_1036.86 s1036 (225185..227278) [2094 bp, 697 aa] {ON} (2251...    32   0.42 
KLTH0G11594g Chr7 complement(975378..977432) [2055 bp, 684 aa] {...    32   0.65 
Smik_12.209 Chr12 (409793..411847) [2055 bp, 684 aa] {ON} YLR143...    32   0.65 
Smik_15.327 Chr15 (562475..564346) [1872 bp, 623 aa] {ON} YOR147...    31   0.94 
Kwal_56.23744 s56 complement(686335..686607) [273 bp, 90 aa] {OF...    29   1.4  
Skud_15.311 Chr15 (555276..557144) [1869 bp, 622 aa] {ON} YOR147...    30   1.8  
TPHA0C00650 Chr3 complement(123052..125187) [2136 bp, 711 aa] {O...    30   2.1  
KAFR0H02150 Chr8 complement(406617..408725) [2109 bp, 702 aa] {O...    30   2.1  
NDAI0F01150 Chr6 complement(277167..278867) [1701 bp, 566 aa] {O...    30   2.8  
KLLA0E17887g Chr5 complement(1587614..1596283) [8670 bp, 2889 aa...    28   8.9  

>KLLA0E04005g Chr5 complement(364475..364888) [414 bp, 137 aa] {ON}
           weakly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 137

 Score =  277 bits (709), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 137/137 (100%), Positives = 137/137 (100%)

Query: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60
           MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI
Sbjct: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60

Query: 61  NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKV 120
           NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKV
Sbjct: 61  NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKV 120

Query: 121 ELECIAEIPSKKRWFKL 137
           ELECIAEIPSKKRWFKL
Sbjct: 121 ELECIAEIPSKKRWFKL 137

>KLTH0F14916g Chr6 (1220286..1220741) [456 bp, 151 aa] {ON} weakly
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 151

 Score =  197 bits (500), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 116/137 (84%), Gaps = 1/137 (0%)

Query: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60
           MA+K+TW++VG   G  L+SP F T SG++L+F+SGC+G+DPVT+ELPEDLEQQARN++ 
Sbjct: 16  MAKKVTWQEVGATKGIDLLSPAFVT-SGSKLVFTSGCIGSDPVTDELPEDLEQQARNALQ 74

Query: 61  NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKV 120
           NL+ VLE SGS+ D VLK+LLFV+DG+Y+  VN++++E FPN PARSC+VV+FPN K+KV
Sbjct: 75  NLRNVLEASGSNSDRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKV 134

Query: 121 ELECIAEIPSKKRWFKL 137
           ELECIAE+  K RWFKL
Sbjct: 135 ELECIAEVQPKARWFKL 151

>SAKL0F02684g Chr6 complement(228156..228572) [417 bp, 138 aa] {ON}
           conserved hypothetical protein
          Length = 138

 Score =  185 bits (469), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (76%), Gaps = 1/138 (0%)

Query: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60
           M  K TWKD+G  +   L+SP F T S   L+++SGCVGTDP T ELPEDLEQQ RN++ 
Sbjct: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60

Query: 61  NLKKVLEVSG-SSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLK 119
           NL+ VL  SG SS+D V+K+LLFV+DG YA +VNKV+KE+F NQP RSC+VV FPN K+K
Sbjct: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK 120

Query: 120 VELECIAEIPSKKRWFKL 137
           VELEC+AEI  K RWFKL
Sbjct: 121 VELECVAEIDKKTRWFKL 138

>Kwal_55.21247 s55 (747831..748235) [405 bp, 134 aa] {ON} YER057C
           (HMF1) - heat-regulated protein [contig 130] FULL
          Length = 134

 Score =  182 bits (461), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 86/135 (63%), Positives = 109/135 (80%), Gaps = 2/135 (1%)

Query: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60
           MAR++TWK+VG   G+P+++P + T S + L+F+SGCVGTDPVT ELP DLEQQ RN++ 
Sbjct: 1   MARQVTWKEVGPGKGYPILAPAYVT-SNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALE 59

Query: 61  NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKV 120
           NLK VL  SGSS++ V+K+LLFVSDGSYA  VNKV+ E+FP  PARSCIVV+FPN  LKV
Sbjct: 60  NLKNVLRASGSSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKV 119

Query: 121 ELECIAEI-PSKKRW 134
           ELECIAE  P+K ++
Sbjct: 120 ELECIAEAGPAKPKF 134

>SAKL0F16654g Chr6 (1378394..1378789) [396 bp, 131 aa] {ON} weakly
           similar to uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1
          Length = 131

 Score =  172 bits (435), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 80/130 (61%), Positives = 99/130 (76%)

Query: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60
           MARKI W  VGV  G  L+SPGF       +LF+SG VGTDP + E+PEDL  Q +N++ 
Sbjct: 1   MARKIEWNQVGVTSGHALLSPGFICSKDEDILFTSGNVGTDPKSGEVPEDLRAQTKNALE 60

Query: 61  NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKV 120
           NLK  LE  GSS+D+VLK+LLFV+DGSYA  VN+V+KE+FP  PARSCIVV+FP+ KLK+
Sbjct: 61  NLKTTLEAGGSSLDNVLKVLLFVADGSYAATVNEVYKEYFPGSPARSCIVVSFPDPKLKL 120

Query: 121 ELECIAEIPS 130
           ELECIA +PS
Sbjct: 121 ELECIAAVPS 130

>Kwal_23.2807 s23 (20785..21174) [390 bp, 129 aa] {ON} YER057C
           (HMF1) - heat-regulated protein [contig 246] FULL
          Length = 129

 Score =  168 bits (426), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 95/127 (74%)

Query: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60
           MA+++ W  VG   G+ ++SP +     N L+F+SGCVGTDPVT  LPEDLEQQ  N++ 
Sbjct: 1   MAKQVQWSAVGPGKGYDILSPAYVASKSNDLVFTSGCVGTDPVTGNLPEDLEQQIINALE 60

Query: 61  NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKV 120
           NLK VL  SGSS++ VLK+LLFVSD SYA  VN+V+  +FPN PARSCIVVAFP   LKV
Sbjct: 61  NLKNVLHASGSSLERVLKVLLFVSDASYASTVNEVYSRYFPNAPARSCIVVAFPAPALKV 120

Query: 121 ELECIAE 127
           ELECIAE
Sbjct: 121 ELECIAE 127

>KLTH0C11880g Chr3 complement(982966..983361) [396 bp, 131 aa] {ON}
           conserved hypothetical protein
          Length = 131

 Score =  167 bits (424), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 101/130 (77%)

Query: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60
           M RK+ W++VGV +G   +SPG  +     LLF+SGCVG DP+T E PED+E QARN+M 
Sbjct: 1   MVRKLKWEEVGVSNGPSFLSPGCVSSKNCDLLFTSGCVGNDPITGEYPEDVESQARNAME 60

Query: 61  NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKV 120
           N+K+VLE + S+ D VLK LLF+SD SYA  VNKV++EFFP +P+RSCIVV+FP+ KLK 
Sbjct: 61  NMKRVLESASSNFDYVLKALLFISDPSYASAVNKVYQEFFPGRPSRSCIVVSFPDPKLKF 120

Query: 121 ELECIAEIPS 130
           E+EC+AE+P+
Sbjct: 121 EMECVAEVPA 130

>KLLA0B14817g Chr2 (1301705..1302100) [396 bp, 131 aa] {ON} weakly
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 131

 Score =  166 bits (421), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 74/130 (56%), Positives = 101/130 (77%)

Query: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60
           M R++ WK+VGV+ G   ++P + T    +L+++SGCVG+D +T E+PEDLE+Q RN++ 
Sbjct: 1   MVRRVEWKEVGVESGPTFLAPAYVTSKDTELVYTSGCVGSDLLTGEIPEDLEKQVRNALD 60

Query: 61  NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKV 120
           NL +VL+ S SS D VLKILLFV+DGSYA  VN V+KE+FP +PARSCIVV+FP+  LKV
Sbjct: 61  NLGRVLKASNSSFDDVLKILLFVADGSYASTVNAVYKEYFPERPARSCIVVSFPDPTLKV 120

Query: 121 ELECIAEIPS 130
           ELEC+A + S
Sbjct: 121 ELECVAAVSS 130

>ZYRO0C18436g Chr3 complement(1444072..1444461) [390 bp, 129 aa]
           {ON} similar to uniprot|P40037 Saccharomyces cerevisiae
           YER057C
          Length = 129

 Score =  164 bits (415), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 76/127 (59%), Positives = 99/127 (77%)

Query: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60
           M  +ITW  VG   G  L+SP + T    +L+F+SGCVGTDP T  L E+L+QQ RN++ 
Sbjct: 1   MPTQITWNQVGPLGGSSLLSPAYVTADAKKLVFTSGCVGTDPKTGTLAEELDQQVRNALE 60

Query: 61  NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKV 120
           NLK VL+ SGSS+D+VLK+LLFV+DGS+A  VNK+++E+FP  PARSCIVV+FP+ KLKV
Sbjct: 61  NLKNVLKASGSSIDNVLKVLLFVADGSFAAPVNKIYQEYFPGAPARSCIVVSFPDPKLKV 120

Query: 121 ELECIAE 127
           ELECIA+
Sbjct: 121 ELECIAQ 127

>TDEL0D00210 Chr4 (34669..35061) [393 bp, 130 aa] {ON} 
          Length = 130

 Score =  145 bits (365), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 95/131 (72%), Gaps = 2/131 (1%)

Query: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60
           MA +I W+DV       L+SPG+ T   +QLLF+SGCVGTD  + +L E +E Q + ++ 
Sbjct: 1   MATQIQWEDVN-GPSHSLLSPGYVTAKNSQLLFTSGCVGTDK-SGKLAEGVEAQTKLALE 58

Query: 61  NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKV 120
           NLK VLE  GSS+ +VLK+LLFV DGSYA  VN V++E+FP +P RSC+VVAFP+  +KV
Sbjct: 59  NLKVVLEAGGSSLSNVLKVLLFVGDGSYASAVNSVYQEYFPGRPGRSCVVVAFPDPAIKV 118

Query: 121 ELECIAEIPSK 131
           ELEC+A +P K
Sbjct: 119 ELECVAVVPEK 129

>ZYRO0D09856g Chr4 complement(834023..834493) [471 bp, 156 aa] {ON}
           some similarities with uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1
          Length = 156

 Score =  135 bits (341), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 63/129 (48%), Positives = 94/129 (72%), Gaps = 3/129 (2%)

Query: 4   KITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLK 63
           ++ W  +G  +  PL+SP F   S + L+F+SGC+GTD   ++LPE   +Q +N+  NL 
Sbjct: 28  RVDWNQLGTSN--PLLSPAFVVSSAHHLVFTSGCLGTDD-QDQLPECPAEQTKNAFENLS 84

Query: 64  KVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKVELE 123
           KVLE SGSS+ SV+K+LLFV D +   +VN++++++FP +PARSCIVVAFPN K++VELE
Sbjct: 85  KVLEASGSSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVELE 144

Query: 124 CIAEIPSKK 132
           C+A   S++
Sbjct: 145 CVAVTKSRE 153

>SAKL0F02640g Chr6 complement(227067..227417) [351 bp, 116 aa] {ON}
           some similarities with uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to mitochondria
          Length = 116

 Score =  114 bits (285), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 78/111 (70%), Gaps = 1/111 (0%)

Query: 18  LISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSG-SSVDSV 76
           + S  F + S   L+++SGCVGTDP T ELPEDLEQQ RN++ NL+ VL  SG SS+D V
Sbjct: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60

Query: 77  LKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKVELECIAE 127
           +K+LLFV+DG Y  + NKV+K++F N+  +S  VV F N  +K+E   +A+
Sbjct: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAK 111

>Kwal_47.16590 s47 complement(15715..16095) [381 bp, 126 aa] {ON}
           YER057C (HMF1) - heat-regulated protein [contig 376]
           FULL
          Length = 126

 Score =  110 bits (276), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 83/127 (65%), Gaps = 4/127 (3%)

Query: 2   ARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMIN 61
           A KITW+ +  K+  P +SPG+ +   N  +F+SG +G +  T E+P ++E Q   ++ N
Sbjct: 3   AEKITWEAIKGKE-HPTLSPGYVS---NGHVFTSGIIGANYGTGEVPHEIEDQVHLAIKN 58

Query: 62  LKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKVE 121
           L+ VL   GSS+  V K+ +F+S   Y+ +VN+++  +FP++PARSC+VVAF +  +K E
Sbjct: 59  LETVLVAGGSSLSKVFKVTMFISHADYSKVVNEIYGHYFPHKPARSCVVVAFMDAAIKYE 118

Query: 122 LECIAEI 128
           LE IA +
Sbjct: 119 LEAIATL 125

>KLTH0E03168g Chr5 complement(285658..286104) [447 bp, 148 aa] {ON}
           conserved hypothetical protein
          Length = 148

 Score =  109 bits (273), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 86/128 (67%), Gaps = 4/128 (3%)

Query: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60
           +A+KITW+ +  K+  P +SP F +   N  +F+SG +G+   T E+ + +E Q   ++ 
Sbjct: 24  VAKKITWESIEGKE-HPTLSPAFVS---NGHVFTSGIIGSKYGTGEVSQQIEDQVHLAIQ 79

Query: 61  NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKV 120
           NL+ VL V+GSS++ V K+ +F+S   Y+ +VN+++ ++FP +PARSC+VVAF +  +K 
Sbjct: 80  NLENVLAVAGSSLEQVFKVTMFISHAEYSKVVNEIYGQYFPQKPARSCVVVAFMDAAIKY 139

Query: 121 ELECIAEI 128
           ELE +A +
Sbjct: 140 ELEAVATL 147

>TDEL0H02060 Chr8 (350315..350848) [534 bp, 177 aa] {ON} Anc_7.238
           YIL051C
          Length = 177

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 67/128 (52%), Gaps = 2/128 (1%)

Query: 1   MARKI-TWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSM 59
           +ARK+ T   V  K+  P  +        N L+F SG +   P    +   +  +A    
Sbjct: 40  IARKMATLTPVATKNAPPAAASYSQAMKANNLIFVSGQIPYTPENKPVEGSIADKAEQVF 99

Query: 60  INLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFF-PNQPARSCIVVAFPNNKL 118
            N++ +LE S SS + V+K+ +F++D +     NKV+ ++F  ++PARSC+ VA     +
Sbjct: 100 KNVRNILEASDSSFERVIKVNVFLADINNFAEFNKVYAKYFSTHKPARSCVAVAALPLNV 159

Query: 119 KVELECIA 126
            +E+E IA
Sbjct: 160 DLEMEVIA 167

>YER057C Chr5 complement(270737..271126) [390 bp, 129 aa] {ON}
           HMF1Member of the p14.5 protein family with similarity
           to Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible;
           high-dosage growth inhibitor; forms a homotrimer in
           vitro
          Length = 129

 Score = 58.9 bits (141), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 58/99 (58%), Gaps = 1/99 (1%)

Query: 29  NQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSY 88
           N L+F SG +   P    +   +  +A   + N+K VLE S SS+D V+K+ +F++D ++
Sbjct: 27  NNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASNSSLDRVVKVNIFLADINH 86

Query: 89  AGIVNKVFKEFF-PNQPARSCIVVAFPNNKLKVELECIA 126
               N V+ ++F  ++PARSC+ VA     + +E+E IA
Sbjct: 87  FAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIA 125

>Skud_5.171 Chr5 complement(266894..267283) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 58.2 bits (139), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (61%), Gaps = 7/102 (6%)

Query: 29  NQLLFSSGCVGTDPVT--NELPE-DLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSD 85
           N L+F SG +   PVT  N+L E  + ++A   + N+K VLE S SS+D V+K+ +F++D
Sbjct: 27  NNLIFLSGQI---PVTQDNKLVEGSIAEKAEQVLQNVKNVLESSNSSLDRVVKVNIFLAD 83

Query: 86  GSYAGIVNKVFKEFF-PNQPARSCIVVAFPNNKLKVELECIA 126
             +    N V+ ++F  ++PARSC+ VA     + +E+E IA
Sbjct: 84  IKHFAEFNSVYAKYFHTHKPARSCVAVAALPLGVDMEMEAIA 125

>Smik_5.187 Chr5 complement(274856..275245) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 57.8 bits (138), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (61%), Gaps = 7/102 (6%)

Query: 29  NQLLFSSGCVGTDPVT--NELPE-DLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSD 85
           N L+F SG +   PVT  N+L E  +  +A   + N+K VLE S SS+D V+K+ +F++D
Sbjct: 27  NNLIFLSGQI---PVTSDNKLVEGSIADKAEQVIQNIKNVLESSNSSLDRVVKVNIFLAD 83

Query: 86  GSYAGIVNKVFKEFF-PNQPARSCIVVAFPNNKLKVELECIA 126
            ++    N V+ ++F  ++PARSC+ VA     + +E+E IA
Sbjct: 84  INHFAEFNTVYAKYFSTHKPARSCVAVAALPLGVDMEMEAIA 125

>ZYRO0C08074g Chr3 complement(619866..620297) [432 bp, 143 aa] {ON}
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and similar to
           YER057C uniprot|P40037 Saccharomyces cerevisiae YER057C
           HMF1 Member of the p14.5 protein family with similarity
           to Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible; high-
           dosage growth inhibitor; forms a homotrimer in vitro
          Length = 143

 Score = 57.8 bits (138), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 63/128 (49%), Gaps = 2/128 (1%)

Query: 1   MARKI-TWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSM 59
           +AR + T   V  K   P  +        + LLF SG +   P    +   +  +     
Sbjct: 12  IARTMATLTPVATKSAPPAAASYSQAMKASNLLFVSGQIPYTPDNKPVEGSISDKTEQVF 71

Query: 60  INLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFF-PNQPARSCIVVAFPNNKL 118
            N+K +L+   SS++ V+K+ +F++D  Y    NKV+ ++F  +QPARSC+ VA      
Sbjct: 72  SNVKSILQAGNSSLERVVKVNVFLADIKYFEEFNKVYAKYFNEHQPARSCVAVAALPKNC 131

Query: 119 KVELECIA 126
            +E+E IA
Sbjct: 132 DLEMEVIA 139

>Suva_5.165 Chr5 complement(246850..247239) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 56.6 bits (135), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 61/103 (59%), Gaps = 7/103 (6%)

Query: 28  GNQLLFSSGCVGTDPVT--NELPE-DLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVS 84
            N L+F SG +   P+T  N+L E  +  +A   + N+K VL  S SS+D ++K+ +F++
Sbjct: 26  ANNLIFLSGQI---PMTSDNKLVEGSIADKAEQVIQNIKDVLAASNSSLDRIIKVNIFLA 82

Query: 85  DGSYAGIVNKVFKEFF-PNQPARSCIVVAFPNNKLKVELECIA 126
           D  Y    N V+ ++F  ++PARSC+ VA     + +E+E IA
Sbjct: 83  DIKYFAEFNSVYAKYFTTHKPARSCVAVAALPLNVDMEVEIIA 125

>Kpol_1033.12 s1033 complement(28172..28603) [432 bp, 143 aa] {ON}
           complement(28172..28603) [432 nt, 144 aa]
          Length = 143

 Score = 56.6 bits (135), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 63/128 (49%), Gaps = 2/128 (1%)

Query: 1   MARKIT-WKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSM 59
           +AR++T    V  K   P  +        N L+F SG +   P    +   +  +A    
Sbjct: 11  LARRLTTLTPVSTKSAPPAAASYSQAMKANNLIFVSGQIPYTPENKPVEGSISDKAEQVF 70

Query: 60  INLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFP-NQPARSCIVVAFPNNKL 118
            N+  +LE S SS+D V+K+ +F+ D       N V+ ++F  ++PARSC+ VA     +
Sbjct: 71  SNVTNILEASNSSLDRVIKVNVFLKDIKNFQEFNSVYAKYFNVHKPARSCVAVAALPLNV 130

Query: 119 KVELECIA 126
            +E+E IA
Sbjct: 131 DLEMEVIA 138

>ADL077C Chr4 complement(549523..549951) [429 bp, 142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL051C
           (MMF1) and YER057C (HMF1)
          Length = 142

 Score = 55.8 bits (133), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 57/101 (56%), Gaps = 3/101 (2%)

Query: 28  GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGS 87
            N ++F SG +   P    +   +  +    + N++ VLE S S +D V K+ +F++D +
Sbjct: 39  ANGMVFVSGQIPYTPDNKPVEGSVADKTEQVIANVRNVLEASNSGLDRVAKVNVFLADMA 98

Query: 88  YAGIVNKVFKEFF-PNQPARSCIVV-AFPNNKLKVELECIA 126
           Y    N V+ ++F  ++PARSC+ V A P N + +E+E IA
Sbjct: 99  YFAEFNSVYAKYFGEHKPARSCVAVRALPLN-VDLEMEVIA 138

>NDAI0E04750 Chr5 complement(1071393..1071779) [387 bp, 128 aa] {ON}
           Anc_7.238
          Length = 128

 Score = 52.8 bits (125), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 58/104 (55%), Gaps = 9/104 (8%)

Query: 28  GNQLLFSSGCV----GTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFV 83
            N L+F SG +       PV   + +  EQ  +N    +KKVLE S SS++ ++K+ +F+
Sbjct: 25  ANNLIFLSGQIPLTSDNKPVEGSIADKAEQVIQN----VKKVLEASNSSLERIIKVNIFL 80

Query: 84  SDGSYAGIVNKVFKEFFP-NQPARSCIVVAFPNNKLKVELECIA 126
           +D +     N V+ ++F  ++PARSC+ VA       +E+E IA
Sbjct: 81  ADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVIA 124

>Smik_9.139 Chr9 complement(231954..232391) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 53.1 bits (126), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 60/122 (49%), Gaps = 1/122 (0%)

Query: 6   TWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKV 65
           T   V  K   P  +        N  ++ SG +   P    +   +  +A     N+K +
Sbjct: 20  TLTPVSTKSAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVQGSISDKAEQVFQNVKNI 79

Query: 66  LEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFF-PNQPARSCIVVAFPNNKLKVELEC 124
           L  S SS+D+++K+ +F++D    G  N V+ ++F  ++PARSC+ VA     + +E+E 
Sbjct: 80  LAESNSSLDNIVKVNVFLADMKNFGEFNSVYAKYFHTHKPARSCVGVASLPLNVDLEMEV 139

Query: 125 IA 126
           IA
Sbjct: 140 IA 141

>KNAG0L01450 Chr12 complement(258500..258895) [396 bp, 131 aa] {ON}
           Anc_7.238 YIL051C
          Length = 131

 Score = 52.0 bits (123), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 28  GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGS 87
            N L+F SG V        L   + ++A   + N+K +L  S S++D V+K  +F++D +
Sbjct: 27  ANNLVFVSGQVPLTADNKMLEGSIAEKAEQVITNIKTILAASNSALDRVVKCNIFLADIN 86

Query: 88  YAGIVNKVF-KEFFPNQPARSCI-VVAFPNNKLKVELECIA 126
                N V+ K F  ++PARSC+ V A P N   +E+E IA
Sbjct: 87  NFAEFNTVYAKHFHDHKPARSCVAVAALPLNA-DLEMEVIA 126

>KAFR0I01830 Chr9 complement(375688..376119) [432 bp, 143 aa] {ON}
           Anc_7.238 YIL051C
          Length = 143

 Score = 52.4 bits (124), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 60/122 (49%), Gaps = 1/122 (0%)

Query: 6   TWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKV 65
           T   V  K   P  +        N  ++ SG +   P    +   L  +A     N+K +
Sbjct: 18  TLTPVATKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVEGTLSDKANQVFQNVKNI 77

Query: 66  LEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFP-NQPARSCIVVAFPNNKLKVELEC 124
           LE S SS++ ++K+ +F++D  +    N V+ ++F  ++PARSC+ VA     + +E+E 
Sbjct: 78  LEASNSSMNKIVKVNVFLADMKFFQEFNSVYAKYFNVHKPARSCVAVASLPLNVDLEVEV 137

Query: 125 IA 126
           +A
Sbjct: 138 VA 139

>NCAS0E03240 Chr5 (641701..642087) [387 bp, 128 aa] {ON} Anc_7.238
          Length = 128

 Score = 51.2 bits (121), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 28  GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGS 87
            N L+F SG +        +   +  +A   + N+K VLE S SS++ ++K+ +F++D +
Sbjct: 25  ANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEASNSSLEKIVKVNIFLADIN 84

Query: 88  YAGIVNKVFKEFFP-NQPARSCIVVAFPNNKLKVELECIA 126
                N V+ ++F  ++PARSC+ VA       +E+E IA
Sbjct: 85  SFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVIA 124

>NDAI0A02550 Chr1 complement(570003..570437) [435 bp, 144 aa] {ON}
           Anc_7.238
          Length = 144

 Score = 50.8 bits (120), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 62/115 (53%), Gaps = 7/115 (6%)

Query: 18  LISPGFATES----GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSV 73
           L  P  A+ S     N  ++ SG +   P    +   +  +A     N++ +LE S SS+
Sbjct: 28  LAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGSISDKAEQVFQNVRNILEASNSSL 87

Query: 74  DSVLKILLFVSDGSYAGIVNKVFKEFF-PNQPARSCIVV-AFPNNKLKVELECIA 126
           D ++K+ +F++D +     N V+ ++F  ++PARSC+ V A P N + +E+E IA
Sbjct: 88  DKIVKVNVFLADINNFKEFNGVYAKYFNTHKPARSCVAVKALPLN-VDLEVEVIA 141

>YIL051C Chr9 complement(257843..258280) [438 bp, 145 aa] {ON}
           MMF1Mitochondrial protein required for transamination of
           isoleucine but not of valine or leucine; may regulate
           specificity of branched-chain transaminases Bat1p and
           Bat2p; interacts genetically with mitochondrial
           ribosomal protein genes
          Length = 145

 Score = 50.8 bits (120), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 59/114 (51%), Gaps = 5/114 (4%)

Query: 18  LISPGFATES----GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSV 73
           L  P  A+ S     N  ++ SG +   P    +   + ++A     N+K +L  S SS+
Sbjct: 28  LAPPAAASYSQAMKANNFVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESNSSL 87

Query: 74  DSVLKILLFVSDGSYAGIVNKVF-KEFFPNQPARSCIVVAFPNNKLKVELECIA 126
           D+++K+ +F++D       N V+ K F  ++PARSC+ VA     + +E+E IA
Sbjct: 88  DNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIA 141

>KAFR0L00860 Chr12 complement(161978..162364) [387 bp, 128 aa] {ON}
           Anc_7.238 YIL051C
          Length = 128

 Score = 50.4 bits (119), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 61/108 (56%), Gaps = 2/108 (1%)

Query: 20  SPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKI 79
           S   A + GN +++ SG +   P    +   +  +    + N+K VL+ S SS+++++K+
Sbjct: 18  SYSHAAKVGN-MIYLSGQIPLTPDGKPVEGSIADKTTQVLENIKTVLKASNSSLENIVKV 76

Query: 80  LLFVSDGSYAGIVNKVFKEFF-PNQPARSCIVVAFPNNKLKVELECIA 126
            +F++D  Y   +N V+ ++F  ++PARSC+ VA       +E+E +A
Sbjct: 77  NIFLADIKYFSELNVVYAKYFKAHKPARSCVAVAALPLNADLEIEVVA 124

>TBLA0D04090 Chr4 (1016159..1016626) [468 bp, 155 aa] {ON} Anc_7.238
           YIL051C
          Length = 155

 Score = 50.4 bits (119), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 56/101 (55%), Gaps = 1/101 (0%)

Query: 29  NQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSY 88
           N+LL+ SG +   P    +   +  +A     N++ +L+   SS++ V+K+ +F+ D   
Sbjct: 51  NELLYVSGQIPFTPDNKPVEGSISDKAEQVFQNVENILKSGNSSLNEVVKVNVFLKDIDN 110

Query: 89  AGIVNKVFKEFFP-NQPARSCIVVAFPNNKLKVELECIAEI 128
               NKV+ ++F  ++PARSC+ VA     + +E+E IA +
Sbjct: 111 FAEFNKVYAKYFTVHKPARSCVAVAALPLNVDLEMEVIAAV 151

>KNAG0D01620 Chr4 complement(272653..273081) [429 bp, 142 aa] {ON}
           Anc_7.238 YIL051C
          Length = 142

 Score = 49.7 bits (117), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 56/99 (56%), Gaps = 1/99 (1%)

Query: 29  NQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSY 88
           N+++F SG +        +   + ++A     N+K +L+ S SS+D ++K+ +F+ D + 
Sbjct: 40  NKMVFVSGQIPYTHDNKPVEGSISKKADQVFQNIKNILDASNSSLDKIIKVNVFLKDINN 99

Query: 89  AGIVNKVFKEFFP-NQPARSCIVVAFPNNKLKVELECIA 126
               N V+ ++F  ++PARSC+ VA     + VE+E IA
Sbjct: 100 FKEFNGVYAKYFNVHKPARSCVAVAALPLDVDVEVEVIA 138

>NCAS0A13490 Chr1 (2655822..2656268) [447 bp, 148 aa] {ON} Anc_7.238
          Length = 148

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 62/115 (53%), Gaps = 7/115 (6%)

Query: 18  LISPGFATES----GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSV 73
           L  P  A+ S     N  ++ SG +   P    +   +  +A     N+K +L+ SGSS+
Sbjct: 28  LAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIKNILKESGSSM 87

Query: 74  DSVLKILLFVSDGSYAGIVNKVFKEFFP-NQPARSCIVVA-FPNNKLKVELECIA 126
           D ++K+ +F++D +     N V+ ++F  ++PARSC+ V   P N + +E+E IA
Sbjct: 88  DKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAVKDLPLN-VDLEVEVIA 141

>TPHA0C01100 Chr3 (250318..250746) [429 bp, 142 aa] {ON} Anc_7.238
           YIL051C
          Length = 142

 Score = 48.5 bits (114), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 57/104 (54%), Gaps = 9/104 (8%)

Query: 28  GNQLLFSSGCVGTD----PVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFV 83
            N L+F SG +       PV   + +  EQ  +N    +K +L+ S SS D V+K+ +F+
Sbjct: 39  ANNLVFVSGQIPYTKDNVPVKGSISDKTEQVFQN----VKNILDASNSSFDKVIKVNVFL 94

Query: 84  SDGSYAGIVNKVFKEFF-PNQPARSCIVVAFPNNKLKVELECIA 126
           +D +     N+V+ ++F  ++PARSC+ VA       +E+E IA
Sbjct: 95  ADINNFKEFNEVYAKYFNTHKPARSCVAVAALPLGCDLEMEVIA 138

>Kpol_1009.25 s1009 complement(58847..59230) [384 bp, 127 aa] {ON}
           complement(58847..59230) [384 nt, 128 aa]
          Length = 127

 Score = 47.4 bits (111), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 59/101 (58%), Gaps = 3/101 (2%)

Query: 28  GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGS 87
            N +++ SG +        +   +  QA   + N+K +LE + SS++ ++K+ +F++D +
Sbjct: 25  ANGMIYVSGQIPYTKENKPIGGTVSDQAEQMIQNVKNILESANSSLNKIVKVNVFLTDMN 84

Query: 88  YAGIVNKVFKEFFP-NQPARSCI-VVAFPNNKLKVELECIA 126
           +    N V+ ++F  ++PARSC+ V A P + + +E+E +A
Sbjct: 85  HFQEFNVVYAKYFSEHKPARSCVAVAALPLDNI-MEMEVVA 124

>TBLA0J01420 Chr10 (325885..326265) [381 bp, 126 aa] {ON} Anc_7.238
           YIL051C
          Length = 126

 Score = 47.0 bits (110), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 53/100 (53%), Gaps = 1/100 (1%)

Query: 28  GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGS 87
           GN  ++ SG +   P    +   +  +A     N+  +LE +GSS++ ++K+ +F+++  
Sbjct: 25  GNGFIYVSGQIALLPDGTRVEGSISDKAHQIFKNISAILETAGSSLNKIIKVNIFLANIK 84

Query: 88  YAGIVNKVFKEFF-PNQPARSCIVVAFPNNKLKVELECIA 126
                N  + ++F  ++PARSC+ VA       VE+E +A
Sbjct: 85  DFEEFNATYIKYFNTHKPARSCVAVAALPLGADVEVEVVA 124

>Skud_9.118 Chr9 complement(226723..227160) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 47.4 bits (111), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 58/114 (50%), Gaps = 5/114 (4%)

Query: 18  LISPGFATES----GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSV 73
           L  P  A+ S     N  ++ SG +        +   +  +A     N+K +L  S SS+
Sbjct: 28  LAPPAAASYSQAMKANSFVYVSGQIPYTAANKPVQGSISDKAEQVFQNVKNILAESNSSL 87

Query: 74  DSVLKILLFVSDGSYAGIVNKVFKEFF-PNQPARSCIVVAFPNNKLKVELECIA 126
           D+++K+ +F++D       N V+ ++F  ++PARSC+ VA     + +E+E IA
Sbjct: 88  DNIVKVNVFLADMKNFAEFNSVYAKYFHTHKPARSCVGVASLPLNVDLEMEVIA 141

>TPHA0K00920 Chr11 (190389..190775) [387 bp, 128 aa] {ON} Anc_7.238
           YIL051C
          Length = 128

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 61  NLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFF-PNQPARSCIVVAFPNNKLK 119
           N++KVL  + S +D V+K  +F+ D       N V+ ++F  ++PARSC+ VA       
Sbjct: 58  NVQKVLAAANSDLDHVVKCNVFLKDIKDFAEFNTVYAKYFNSHKPARSCVAVAALPLNAD 117

Query: 120 VELECIA 126
           VE+ECIA
Sbjct: 118 VEMECIA 124

>Suva_9.148 Chr9 complement(246539..246976) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 57/114 (50%), Gaps = 5/114 (4%)

Query: 18  LISPGFATES----GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSV 73
           L  P  A+ S     N  ++ SG +        +   +  +A     N+K +L  S SS+
Sbjct: 28  LAPPAAASYSQAIKANNFVYVSGQIPYTAENKPVQGSISDKAEQVFQNVKNILAESNSSL 87

Query: 74  DSVLKILLFVSDGSYAGIVNKVF-KEFFPNQPARSCIVVAFPNNKLKVELECIA 126
           +SV+K+ +F++D       N V+ K F  ++PARSC+ VA     + +E+E IA
Sbjct: 88  NSVVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIA 141

>CAGL0M12386g Chr13 (1236543..1236971) [429 bp, 142 aa] {ON} similar
           to uniprot|P40037 Saccharomyces cerevisiae YER057c HIG1
           Heat-shock induceable Inhibiter of cell Growth
          Length = 142

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 58/103 (56%), Gaps = 9/103 (8%)

Query: 29  NQLLFSSGCV----GTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVS 84
           N L++ SG +       PV   + +  EQ  +N    ++ +L+ S S ++ ++K+ +F++
Sbjct: 40  NNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQN----VQNILKDSNSDLNRIVKVNIFLA 95

Query: 85  DGSYAGIVNKVFKEFFP-NQPARSCIVVAFPNNKLKVELECIA 126
           D +     NKV+ ++F  ++PARSC+ VA     + +E+E IA
Sbjct: 96  DMNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEMEVIA 138

>Kwal_23.5804 s23 complement(1324907..1325332) [426 bp, 141 aa] {ON}
           YIL051C (MMF1) - Maintenance of Mitochondrial DNA 1
           [contig 11] FULL
          Length = 141

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 29  NQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSD--- 85
           N+++F SG +        +   +  +A   + N++ +LE + S +D ++K+ +F++D   
Sbjct: 39  NKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKD 98

Query: 86  -GSYAGIVNKVFKEFFPNQPARSCIVV-AFPNNKLKVELECIA 126
              + G+  K F E   ++PARSC+ V A P + + +E+E +A
Sbjct: 99  FAEFNGVYGKYFNE---HKPARSCVAVKALPLD-VDLEMEVVA 137

>SAKL0F08558g Chr6 complement(654765..655199) [435 bp, 144 aa] {ON}
           highly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and similar
           to YER057C uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1 Member of the p14.5 protein family with
           similarity to Mmf1p, functionally complements Mmf1p
           function when targeted to mitochondria; heat shock
           inducible; high- dosage growth inhibitor; forms a
           homotrimer in vitro
          Length = 144

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 62/103 (60%), Gaps = 9/103 (8%)

Query: 29  NQLLFSSGCVGTDPVTNE---LPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSD 85
           N ++F SG +   P T+E   +   +  +A   + N+K +LE + SS++ ++K+ +F++D
Sbjct: 42  NNMVFVSGQI---PYTHENKPVEGSIADKAEQVIQNVKNILEEANSSLNKIVKVNVFLAD 98

Query: 86  GSYAGIVNKVFKEFF-PNQPARSCIVV-AFPNNKLKVELECIA 126
            +     N V+ ++F  ++PARSC+ V + P N + +E+E IA
Sbjct: 99  INDFAEFNGVYAKYFNEHKPARSCVAVKSLPLN-VDLEMEVIA 140

>KLLA0C08349g Chr3 (731629..732051) [423 bp, 140 aa] {ON} similar to
           uniprot|P40185 Saccharomyces cerevisiae YIL051C MMF1
           Mitochondrial protein involved in maintenance of the
           mitochondrial genome and similar to YER057C
           uniprot|P40037 Saccharomyces cerevisiae YER057C HMF1
           Member of the p14.5 protein family with similarity to
           Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible; high-
           dosage growth inhibitor; forms a homotrimer in vitro
          Length = 140

 Score = 44.7 bits (104), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 55/100 (55%), Gaps = 3/100 (3%)

Query: 29  NQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSY 88
           N L+F SG +        +   +  +A   + N+K +L  + S +D ++K+ +F++D + 
Sbjct: 38  NNLIFVSGQIPYTAENKPVEGSIADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINS 97

Query: 89  AGIVNKVFKEFFP-NQPARSCIVV-AFPNNKLKVELECIA 126
               N V+ ++F  ++PARSC+   A P N + +E+E IA
Sbjct: 98  FAEFNSVYAKYFNVHKPARSCVAAKALPLN-VDLEMEVIA 136

>KLTH0A04224g Chr1 complement(356660..357085) [426 bp, 141 aa] {ON}
           highly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and similar
           to YER057C uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1 Member of the p14.5 protein family with
           similarity to Mmf1p, functionally complements Mmf1p
           function when targeted to mitochondria; heat shock
           inducible; high- dosage growth inhibitor; forms a
           homotrimer in vitro
          Length = 141

 Score = 44.7 bits (104), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 56/103 (54%), Gaps = 9/103 (8%)

Query: 29  NQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSD--- 85
           N ++F SG +        +   +  +A   + N+K +LE + S+++ ++K+ +F++D   
Sbjct: 39  NNMVFVSGQIPYTAENKRVEGTMTDKAEQVIQNVKNILEEANSALNKIVKVNIFLADIND 98

Query: 86  -GSYAGIVNKVFKEFFPNQPARSCIVVA-FPNNKLKVELECIA 126
              + G+  K F E   ++PARSC+ V   P N + +E+E +A
Sbjct: 99  FAEFNGVYGKYFNE---HKPARSCVAVKDLPLN-VDLEMEVVA 137

>NCAS0C03150 Chr3 complement(617756..619825) [2070 bp, 689 aa] {ON}
           Anc_8.349 YLR143W
          Length = 689

 Score = 36.2 bits (82), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 12/95 (12%)

Query: 28  GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGS 87
           GN L  S+ C    P  +EL  ++EQQA+     L K+++ +      +L   L +++ S
Sbjct: 321 GNLLYISNLC----PKDSEL--NVEQQAKQVFQQLDKIMKENSLFPSQILFSSLILANMS 374

Query: 88  YAGIVNKVFKEFF------PNQPARSCIVVAFPNN 116
               VN+V+ +FF      P  P+R+C+     NN
Sbjct: 375 NFATVNQVYNDFFRINKWGPLPPSRACVGSVLSNN 409

>SAKL0H14938g Chr8 complement(1295178..1297253) [2076 bp, 691 aa]
           {ON} similar to uniprot|Q07261 Saccharomyces cerevisiae
           YLR143W Hypothetical ORF
          Length = 691

 Score = 36.2 bits (82), Expect = 0.014,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 51/128 (39%), Gaps = 18/128 (14%)

Query: 17  PLISPGFAT-----ESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGS 71
           P IS   +T     E GN L  S+       +    P    +QA +    L  +L   G 
Sbjct: 299 PFISGTHSTTASINEVGNILYISN-------LKPSFPGSTVEQASDVFKQLDTILNERGL 351

Query: 72  SVDSVLKILLFVSDGSYAGIVNKVFKEFF------PNQPARSCIVVAFPNNKLKVELECI 125
               VL   L +SD S   +VN V+ +FF      P  P+RSC+        + ++L  +
Sbjct: 352 YPSQVLSCALILSDISAFALVNDVYNKFFNIWKIGPLPPSRSCVGSKLLGKDVALQLSVV 411

Query: 126 AEIPSKKR 133
            +  +  R
Sbjct: 412 VDTTALVR 419

>Suva_10.239 Chr10 (436127..438196) [2070 bp, 689 aa] {ON} YLR143W
           (REAL)
          Length = 689

 Score = 35.4 bits (80), Expect = 0.028,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 6/88 (6%)

Query: 51  LEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFF------PNQP 104
           +E+Q+++    L  +L  +      +L   L V D S  G +NK++ EF       P  P
Sbjct: 335 VEEQSKDIFTELADILRSNRIPRSHILSSSLLVKDMSNFGKINKIYNEFLNVTKYGPLPP 394

Query: 105 ARSCIVVAFPNNKLKVELECIAEIPSKK 132
           +R+C+   +      V+L  + +   +K
Sbjct: 395 SRACVGSGYLPEGCHVQLSVVIDTEVRK 422

>Skud_12.214 Chr12 (410879..412933) [2055 bp, 684 aa] {ON} YLR143W
           (REAL)
          Length = 684

 Score = 35.0 bits (79), Expect = 0.032,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 49  EDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFF------PN 102
           + +E+Q ++    L  +L  +G+S + +L   L V D    G +N ++ EF       P 
Sbjct: 333 KSVEEQCQDIFAELAAILRSNGTSRNHILSSSLIVRDMCDFGKINNIYNEFLDLTKYGPL 392

Query: 103 QPARSCI 109
            P+R+C+
Sbjct: 393 PPSRACV 399

>TDEL0F04730 Chr6 (889641..891725) [2085 bp, 694 aa] {ON} Anc_8.349
           YLR143W
          Length = 694

 Score = 35.0 bits (79), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 11/84 (13%)

Query: 32  LFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSYAGI 91
           L+ S    T P ++     LE Q R  +  L  ++E  G S    +   L +S  S   +
Sbjct: 323 LYVSNLRATTPSSS-----LENQTRQVLDALNVIIEKWGISPSQAINCTLVLSSMSNFAV 377

Query: 92  VNKVFKEFF------PNQPARSCI 109
           VN+++ E+F      P  P+R+CI
Sbjct: 378 VNEIYSEYFDISKYGPLPPSRACI 401

>YLR143W Chr12 (427329..429386) [2058 bp, 685 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-tagged protein localizes to the cytoplasm; YLR143W
           is not an essential gene
          Length = 685

 Score = 34.7 bits (78), Expect = 0.053,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 49  EDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFF------PN 102
           E +E+Q+ +    L  +L  +    + +L   L + D S  G +NK++ EF       P 
Sbjct: 333 ETVEKQSEDIFTELADILHSNQIPRNHILSASLLIRDMSNFGKINKIYNEFLDLSKYGPL 392

Query: 103 QPARSCI 109
            P+R+C+
Sbjct: 393 PPSRACV 399

>CAGL0M04521g Chr13 (496157..498223) [2067 bp, 688 aa] {ON} similar
           to uniprot|Q12429 Saccharomyces cerevisiae YLR143w
          Length = 688

 Score = 32.3 bits (72), Expect = 0.31,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 42/83 (50%), Gaps = 6/83 (7%)

Query: 51  LEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFF------PNQP 104
           +++Q ++ +  L  +L+ +  +  +VL   L ++D S    VN+ + +FF      P  P
Sbjct: 337 VQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPP 396

Query: 105 ARSCIVVAFPNNKLKVELECIAE 127
           AR+CI     N+   ++L  + +
Sbjct: 397 ARACIESNIINDGSALQLSVVVK 419

>Kpol_1036.86 s1036 (225185..227278) [2094 bp, 697 aa] {ON}
           (225185..227278) [2094 nt, 698 aa]
          Length = 697

 Score = 32.0 bits (71), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 6/69 (8%)

Query: 47  LPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFF------ 100
           + ED+E+Q  N    L  +L     S   VL   L++ + S    VNK++  +F      
Sbjct: 334 IEEDIERQVENVFNQLDSILGEKTYSRAQVLNSSLYLFNMSDFSKVNKIYNNYFDIQKFG 393

Query: 101 PNQPARSCI 109
           P  P+R+C+
Sbjct: 394 PLPPSRACV 402

>KLTH0G11594g Chr7 complement(975378..977432) [2055 bp, 684 aa] {ON}
           similar to uniprot|Q07261 Saccharomyces cerevisiae
           YLR143W Hypothetical ORF
          Length = 684

 Score = 31.6 bits (70), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 43/87 (49%), Gaps = 6/87 (6%)

Query: 51  LEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFF------PNQP 104
           ++++A+N +  L  +L     S   ++   L +SD S    VN+++  FF      P  P
Sbjct: 335 VKEKAQNILDELGTLLADQKVSPSQIMASSLLLSDMSDFHQVNEIYSAFFQVKHVGPLPP 394

Query: 105 ARSCIVVAFPNNKLKVELECIAEIPSK 131
           AR+C+  +    K  ++L  + ++ S+
Sbjct: 395 ARACVGSSLIGEKNSLQLSVVIDLASQ 421

>Smik_12.209 Chr12 (409793..411847) [2055 bp, 684 aa] {ON} YLR143W
           (REAL)
          Length = 684

 Score = 31.6 bits (70), Expect = 0.65,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 51  LEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFF------PNQP 104
           +E+Q  +    L  +L  +    + +L   L + D S  G +NK++ EF       P  P
Sbjct: 335 VEEQGDDIFSELADILRSNQIPRNHILSSSLLIKDMSNFGRINKIYNEFLDLTKYGPLPP 394

Query: 105 ARSCI 109
           +R+C+
Sbjct: 395 SRACV 399

>Smik_15.327 Chr15 (562475..564346) [1872 bp, 623 aa] {ON} YOR147W
           (REAL)
          Length = 623

 Score = 30.8 bits (68), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 72  SVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPN 115
           S+D +  I+ F+   SY G+ N + KEF  N+  ++ I+ + PN
Sbjct: 475 SLDELKPIITFI--NSYEGMANPILKEFTENERLKNSIIWSSPN 516

>Kwal_56.23744 s56 complement(686335..686607) [273 bp, 90 aa]
          {OFF} [contig 173] FULL
          Length = 90

 Score = 29.3 bits (64), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 33 FSSGCVGTDPVTN--ELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILL 81
          F+S C   + +T   E    + QQ R++++ L+K+++V    +D +LKILL
Sbjct: 31 FNSYCFALEVITRLIEFGGSVHQQ-RDALLPLQKLVDVVVHKMDDILKILL 80

>Skud_15.311 Chr15 (555276..557144) [1869 bp, 622 aa] {ON} YOR147W
           (REAL)
          Length = 622

 Score = 30.0 bits (66), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 72  SVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPN 115
           S+D +  I+ F+   SY G+VN + K+F  N+  ++ I+   PN
Sbjct: 474 SLDELKPIITFI--NSYEGMVNPILKDFTENERLKNSIIWNSPN 515

>TPHA0C00650 Chr3 complement(123052..125187) [2136 bp, 711 aa] {ON}
           Anc_8.349 YLR143W
          Length = 711

 Score = 30.0 bits (66), Expect = 2.1,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 43  VTNELPE----DLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKE 98
           ++N LP      +E Q ++   +L K+L  +      +L   L++S+      VNKV+ +
Sbjct: 327 ISNILPTTQDTSIEVQIKSLFQHLDKILIENNIKPSQILSSTLYLSNIRDFANVNKVYND 386

Query: 99  FF------PNQPARSCI 109
           FF      P  P+R+C+
Sbjct: 387 FFDIEKNGPLPPSRACV 403

>KAFR0H02150 Chr8 complement(406617..408725) [2109 bp, 702 aa] {ON}
           Anc_8.349 YLR143W
          Length = 702

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 6/45 (13%)

Query: 90  GIVNKVFKEFF------PNQPARSCIVVAFPNNKLKVELECIAEI 128
           G VNK++ EFF      P  P+RSC+      + ++++L  + +I
Sbjct: 372 GTVNKIYNEFFNISKWGPLPPSRSCVGSNLLGDNVQLQLSVVIDI 416

>NDAI0F01150 Chr6 complement(277167..278867) [1701 bp, 566 aa] {ON}
           Anc_6.293
          Length = 566

 Score = 29.6 bits (65), Expect = 2.8,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 49  EDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSC 108
           ED E + +  +INLKK L    +    +LK  +F +      I+NK     F NQ   S 
Sbjct: 270 EDEELKTKIQLINLKKFLIDLSTWQYDLLKFEIFETAFGIHSIINK-----FTNQEQNSF 324

Query: 109 IVVAFPNNKLKVEL 122
           ++    NN  +++L
Sbjct: 325 LMTPVTNNTKQIQL 338

>KLLA0E17887g Chr5 complement(1587614..1596283) [8670 bp, 2889 aa]
            {ON} similar to uniprot|P18963 Saccharomyces cerevisiae
            YBR140c IRA1 or uniprot|P19158 Saccharomyces cerevisiae
            YOL081w IRA2
          Length = 2889

 Score = 28.1 bits (61), Expect = 8.9,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 10/82 (12%)

Query: 42   PVTNELPEDLEQQARNSMINLKKVLE-VSGSSVDSVLKILLFVSDGSYAGIVNKVFKEFF 100
            P + E+ + L  +AR S ++L KV++ ++  SV+S+   +L           NK+F EF 
Sbjct: 1668 PDSEEIVDSLTPKARKSSMSLAKVIQNIANGSVNSIKWKILESESEFLKNCSNKIF-EFL 1726

Query: 101  PNQPARSCIVVAFPNNKLKVEL 122
                     VV+  N K+K+ L
Sbjct: 1727 S--------VVSDKNRKVKINL 1740

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,333,716
Number of extensions: 613645
Number of successful extensions: 1695
Number of sequences better than 10.0: 68
Number of HSP's gapped: 1665
Number of HSP's successfully gapped: 68
Length of query: 137
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 39
Effective length of database: 42,244,131
Effective search space: 1647521109
Effective search space used: 1647521109
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)