Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E03983g3.496ON1911919321e-129
SAKL0F02618g3.496ON2531454005e-48
Kpol_1017.43.496ON1841513824e-46
TPHA0D033003.496ON1961523661e-43
Suva_16.4793.496ON2121363574e-42
YPR151C (SUE1)3.496ON2061523496e-41
Smik_16.4033.496ON2031413471e-40
Skud_16.4453.496ON2151433368e-39
Kwal_55.212483.496ON2221423142e-35
NDAI0B058903.496ON2781363139e-35
KNAG0A079603.496ON1771423051e-34
KLTH0F14938g3.496ON2291463081e-34
ZYRO0D09812g3.496ON1851552902e-32
CAGL0L08426g3.496ON1401432323e-24
TDEL0D056403.496ON1241422096e-21
NCAS0F035703.496ON2301392132e-20
Ecym_12333.496ON87551588e-14
ZYRO0F07480g8.682ON2361381441e-10
TBLA0D029403.496ON71401316e-10
Kpol_1013.98.682ON2611361406e-10
KAFR0G037103.496ON79521291e-09
Kpol_1072.128.682ON2221361247e-08
TDEL0A062708.682ON2421351249e-08
TPHA0D012908.682ON2181451231e-07
NCAS0C013108.682ON2571491212e-07
KNAG0J017608.682ON2581361212e-07
TPHA0G015708.682ON2551551142e-06
AFR315C3.496ON77451072e-06
Suva_16.1518.682ON2531341142e-06
YPL159C (PET20)8.682ON2531431123e-06
NDAI0K013208.682ON2581361114e-06
Skud_16.1238.682ON2551341115e-06
Smik_6.3568.682ON2531461081e-05
KLLA0D06061g8.682ON2491411081e-05
SAKL0H06380g8.682ON2191361071e-05
TBLA0B038008.682ON3241421044e-05
KLTH0D11396g8.682ON22560920.001
Kpol_1066.443.62ON479144910.003
Kwal_26.88288.682ON22329890.003
CAGL0M02101g8.682ON267137870.006
Ecym_23908.682ON227140850.011
TDEL0E007103.62ON476144820.037
KAFR0H023808.682ON22037800.047
ZYRO0C02244g3.62ON460151760.21
YNL295W3.62ON52437730.48
KLLA0A07447g3.62ON48637710.91
TBLA0B027208.798ON50241701.1
Skud_14.423.62ON52438701.1
TPHA0P012603.62ON494163701.3
NCAS0A099403.62ON49427672.6
TBLA0B085103.62ON50127664.2
SAKL0C12342g3.62ON55238654.6
KAFR0G002001.134ON132546655.3
CAGL0M03685g3.62ON493138655.5
TDEL0C053303.396ON63980655.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E03983g
         (191 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...   363   e-129
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...   158   5e-48
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...   151   4e-46
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...   145   1e-43
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...   142   4e-42
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...   139   6e-41
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...   138   1e-40
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...   134   8e-39
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...   125   2e-35
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...   125   9e-35
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...   122   1e-34
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...   123   1e-34
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...   116   2e-32
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    94   3e-24
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    85   6e-21
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    87   2e-20
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    65   8e-14
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    60   1e-10
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    55   6e-10
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    59   6e-10
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    54   1e-09
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    52   7e-08
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    52   9e-08
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    52   1e-07
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    51   2e-07
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    51   2e-07
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    49   2e-06
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    46   2e-06
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    49   2e-06
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    48   3e-06
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    47   4e-06
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    47   5e-06
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    46   1e-05
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    46   1e-05
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    46   1e-05
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    45   4e-05
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    40   0.001
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    40   0.003
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    39   0.003
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    38   0.006
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    37   0.011
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    36   0.037
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    35   0.047
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    34   0.21 
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    33   0.48 
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    32   0.91 
TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.7...    32   1.1  
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    32   1.1  
TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {...    32   1.3  
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    30   2.6  
TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa] ...    30   4.2  
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    30   4.6  
KAFR0G00200 Chr7 (66669..70646) [3978 bp, 1325 aa] {ON} Anc_1.13...    30   5.3  
CAGL0M03685g Chr13 complement(413333..414814) [1482 bp, 493 aa] ...    30   5.5  
TDEL0C05330 Chr3 (948950..950869) [1920 bp, 639 aa] {ON} Anc_3.3...    30   5.7  

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score =  363 bits (932), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 179/191 (93%), Positives = 179/191 (93%)

Query: 1   MPFPKSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEV 60
           MPFPKSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEV
Sbjct: 1   MPFPKSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEV 60

Query: 61  EREKNGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWS 120
           EREKNGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWS
Sbjct: 61  EREKNGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWS 120

Query: 121 SSAMGMEFYPEWNDVPNKVSASLKPYQLDQPQDKKMTLKFPPKQTDELSDEKSVDXXXXX 180
           SSAMGMEFYPEWNDVPNKVSASLKPYQLDQPQDKKMTLKFPPKQTDELSDEKSVD     
Sbjct: 121 SSAMGMEFYPEWNDVPNKVSASLKPYQLDQPQDKKMTLKFPPKQTDELSDEKSVDQYEEV 180

Query: 181 XXXXXXXWKLK 191
                  WKLK
Sbjct: 181 VQEYLQQWKLK 191

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score =  158 bits (400), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 78/145 (53%), Positives = 102/145 (70%), Gaps = 1/145 (0%)

Query: 5   KSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREK 64
           K K + ++R LP+VPTT+FL P+ELT DILFSGYRP+  P+++NP F    +   +  E 
Sbjct: 16  KKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGET 75

Query: 65  NGGGKLKSKAAFASEPE-HPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSA 123
           +   + K++A   +E E H  MAGP GTGGI+SGGVNGTWRYNPRIP KLL   LWSSS 
Sbjct: 76  SAKKEYKNEAERENEKEEHNVMAGPRGTGGIVSGGVNGTWRYNPRIPTKLLPYNLWSSST 135

Query: 124 MGMEFYPEWNDVPNKVSASLKPYQL 148
           M ME+YPEW +VP  ++  LKP+ +
Sbjct: 136 MAMEYYPEWLNVPKTIANKLKPFDM 160

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score =  151 bits (382), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 75/151 (49%), Positives = 95/151 (62%), Gaps = 8/151 (5%)

Query: 6   SKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQ--AKVKEL----- 58
           S    ++R LPRVPTT+FL    LT DILFSGYRPI  P+++NPLF+     K +     
Sbjct: 30  SDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQDL 89

Query: 59  -EVEREKNGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSA 117
              E   N    L+      +  E   ++G  GTGGI SGGVNGTWR+NPR+P+KLL  +
Sbjct: 90  VNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNGTWRFNPRVPSKLLPYS 149

Query: 118 LWSSSAMGMEFYPEWNDVPNKVSASLKPYQL 148
            WS+S MGME+YPEW ++P KV   LKPYQL
Sbjct: 150 WWSTSIMGMEYYPEWKNIPRKVVKDLKPYQL 180

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score =  145 bits (366), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 99/152 (65%), Gaps = 13/152 (8%)

Query: 11  MYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVK-------ELEVERE 63
           +++ LPRVPTTR+L   +LT DILFSGYRPI  P+++NPLF+   K         E + +
Sbjct: 50  IFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQEK 109

Query: 64  KNGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSA 123
            N     K+  AF+       + G  GTGGI+SGGVNGTW+YNP +P  LL    WS+S 
Sbjct: 110 NNPVLPQKNHEAFS------VLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSI 163

Query: 124 MGMEFYPEWNDVPNKVSASLKPYQLDQPQDKK 155
           MGME+YPEWN+VP +   +LKP+++++P  KK
Sbjct: 164 MGMEYYPEWNNVPRRFLKTLKPFEVNEPLRKK 195

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score =  142 bits (357), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 99/136 (72%), Gaps = 2/136 (1%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQ-AKVKELEVEREKNGGGKL 70
           +R LP+VPTT++L  +ELT DIL+SGYRP++ P+++NPLF+  K K L++    +     
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPAT 121

Query: 71  KSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYP 130
           ++KA   SE ++ F  G  GTGGI+SGGVNGTW+YNP +PN+LL    WS+S+MGME++P
Sbjct: 122 EAKATEKSEHKNVFF-GERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180

Query: 131 EWNDVPNKVSASLKPY 146
           EW +VP+ +   LKP+
Sbjct: 181 EWKNVPSYMMRKLKPF 196

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score =  139 bits (349), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 100/152 (65%), Gaps = 8/152 (5%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLK 71
           +R LP+VPTT++L  +ELT DIL+SGYRP++ P+++NPLF+ K K   ++       K  
Sbjct: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDK-KRKSLQTLLTMNEKTN 113

Query: 72  SKAAFASEPEHP-FMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYP 130
           ++A    E +H   + G  GTGGI+SGGVNGTW+YNP +PN+LL    WS+S+MGME++P
Sbjct: 114 AEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 173

Query: 131 EWNDVPNKVSASLKPY------QLDQPQDKKM 156
           EW +VP  +   LKP+      +L     KKM
Sbjct: 174 EWKNVPPYMMRKLKPFDKALQMRLTHKSKKKM 205

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score =  138 bits (347), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 66/141 (46%), Positives = 103/141 (73%), Gaps = 4/141 (2%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKE-LEVEREKNGGGKL 70
           +R LP+VPTT++L  +ELT DIL+SGYRP++ P+++NPLF+ K K+ L++    +     
Sbjct: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPIT 112

Query: 71  KSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYP 130
           ++K    S+ ++  + G  GTGGI+SGGVNGTW+YNP +PN+LL    WS+S+MGME++P
Sbjct: 113 EAKTTEKSKHKN-ILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171

Query: 131 EWNDVPNKVSASLKPYQLDQP 151
           EW ++P+ ++  LKP+  D+P
Sbjct: 172 EWRNIPSYMTRKLKPF--DKP 190

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score =  134 bits (336), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 67/143 (46%), Positives = 99/143 (69%), Gaps = 4/143 (2%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKE-LEVEREKNGGGKL 70
           +R LP+VPTT++L  +ELT DIL+SGYRP++ P+++NPLF+ K ++ L++    +     
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLAPDEAPAA 121

Query: 71  KSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYP 130
           ++KA    +     + G  GTGGI SGGVNGTW+YNP +PN+LL    WS+S+MGME++P
Sbjct: 122 EAKAT-EKDMHKNVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180

Query: 131 EWNDVPNKVSASLKPY--QLDQP 151
           EW +VP+ +   LKP+   L QP
Sbjct: 181 EWKNVPSYMMRKLKPFDKSLQQP 203

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score =  125 bits (314), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 100/142 (70%), Gaps = 3/142 (2%)

Query: 5   KSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREK 64
           K +++ ++R LP+VPTT++L P ELT DIL+SGYRP++ P+++NPLF+    + +  RE+
Sbjct: 16  KRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREE 75

Query: 65  NGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAM 124
            G     +    A E     MAGP GTGGI SGGVNGTWRYNPRIP+KLL  +LWSS++M
Sbjct: 76  PGSD---TALTAAKESSKNAMAGPQGTGGIGSGGVNGTWRYNPRIPSKLLPFSLWSSTSM 132

Query: 125 GMEFYPEWNDVPNKVSASLKPY 146
            ME++PEW  VP  V   L+P+
Sbjct: 133 AMEYHPEWLAVPRTVVNKLRPF 154

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score =  125 bits (313), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 58/136 (42%), Positives = 87/136 (63%)

Query: 11  MYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKL 70
           ++R +P+VP T++L  +EL+ D+L+SGYRPI+ P+++NPLF+  +K+             
Sbjct: 128 IFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNSSSSFPFSTTSS 187

Query: 71  KSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYP 130
            S      + E       +  GGI++GG+NGTWRY+PRIPN LL + +WS S MGME+YP
Sbjct: 188 SSSEKKKPQQEQMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYYP 247

Query: 131 EWNDVPNKVSASLKPY 146
           EW  VP  +  +LKP+
Sbjct: 248 EWKGVPFNIVKNLKPF 263

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score =  122 bits (305), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 88/142 (61%), Gaps = 9/142 (6%)

Query: 11  MYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEV---EREKNGG 67
           M+R+LP+VP T++L  +EL  DIL+SGYRP++ P+R+NPLF+   K + +   E +  G 
Sbjct: 31  MFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEGT 90

Query: 68  -GKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGM 126
            G  +      +E     + G N  GGI + G NGTW+Y P+IP K+L    WS+S++ M
Sbjct: 91  EGTHRDSQTVNTE-----LFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAM 145

Query: 127 EFYPEWNDVPNKVSASLKPYQL 148
           E YPEW+ VP  V   LKP+ L
Sbjct: 146 EVYPEWSSVPKHVVKGLKPFDL 167

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score =  123 bits (308), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 102/146 (69%), Gaps = 9/146 (6%)

Query: 5   KSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQA---KVKELEVE 61
           K K+++++R LP+VPTT++L P ELT DIL+SGYRP++ P+++NPLF+    K + L  E
Sbjct: 16  KRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWKTQRLRGE 75

Query: 62  REKNGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSS 121
           R    G +  S    +SE     MAGP GTGGI SGGVNGTWRYNPRIP+KLL   LWS 
Sbjct: 76  R----GARKSSTVPQSSEMN--AMAGPLGTGGIGSGGVNGTWRYNPRIPSKLLPYNLWSC 129

Query: 122 SAMGMEFYPEWNDVPNKVSASLKPYQ 147
           ++M ME++PEW  VP  V   L+P++
Sbjct: 130 TSMAMEYHPEWLAVPRTVVNKLRPFE 155

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score =  116 bits (290), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/155 (43%), Positives = 101/155 (65%), Gaps = 8/155 (5%)

Query: 5   KSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVERE- 63
           K  ++ ++R +PRVPTT+FL  +ELT DILFSGYRP++ P+++NPLF+ + +  E+  E 
Sbjct: 18  KCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGELTDEL 77

Query: 64  --KNGGGKLKSKA---AFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSAL 118
             ++  G  + +       S  E+  +AGP G GGI SGG +GTWR   ++P+KLL  + 
Sbjct: 78  QSRHNSGLRQGRTQEEEKESGEEYSVIAGPRGCGGIASGGASGTWRNGAKMPSKLLPYSW 137

Query: 119 WSSSAMGMEFYPEWNDVPNKVSASLKPYQLDQPQD 153
           WS+++MGMEF+PEW  VP  V   LKP+  D+  D
Sbjct: 138 WSTTSMGMEFFPEWEGVPRHVVRKLKPF--DRGHD 170

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 94.0 bits (232), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 81/143 (56%), Gaps = 13/143 (9%)

Query: 7   KATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLF-QAKVKELEVEREKN 65
           +  +++R+LP+VP TR+L  + L+ D+L++GYRPI+ P+R+NPL   + V+E     E  
Sbjct: 3   RVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGE-- 60

Query: 66  GGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMG 125
              +L+ K     EP +  + GP G GGI + GV        R+ +        S S MG
Sbjct: 61  SSNELQKK---DEEPVNELLYGPEGRGGISTMGVR-------RMADPSKVKLGLSYSIMG 110

Query: 126 MEFYPEWNDVPNKVSASLKPYQL 148
           ME+YPEW  VP  V   +KPY++
Sbjct: 111 MEYYPEWEKVPRDVVKRIKPYEV 133

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score = 85.1 bits (209), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 72/142 (50%), Gaps = 46/142 (32%)

Query: 5   KSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREK 64
           KS    ++R LPRVPTTRFL  Q L++DILFSGYRP++ P+R+NPLF             
Sbjct: 24  KSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF------------- 70

Query: 65  NGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAM 124
             G   K++A  + E   P                    RY+           LWS++ M
Sbjct: 71  --GRGTKTEAPASLESNLP--------------------RYD-----------LWSTTTM 97

Query: 125 GMEFYPEWNDVPNKVSASLKPY 146
           G+E +PEW++VP +V   L+P+
Sbjct: 98  GLERFPEWSNVPREVVRKLRPF 119

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 86.7 bits (213), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 75/139 (53%), Gaps = 36/139 (25%)

Query: 8   ATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGG 67
           +  ++R+LP+VP TR+L  ++L+ +ILF+GY+PI+ P+R+NPLF+ K+K+ + +RE NG 
Sbjct: 114 SNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRE-NGN 172

Query: 68  GKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGME 127
                K A  S   H +                                 +WS+S +G++
Sbjct: 173 ----EKRALGSSVSHKY-------------------------------KGIWSTSILGLQ 197

Query: 128 FYPEWNDVPNKVSASLKPY 146
            YPEWN+VP     +LKP+
Sbjct: 198 DYPEWNNVPWNNIKNLKPF 216

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
          Ashbya gossypii AFR315C
          Length = 87

 Score = 65.5 bits (158), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 40/55 (72%)

Query: 5  KSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELE 59
          K K  ++ R LPRVPTT++L+ +EL  DI FSGYRP+V P++ NPLF++    LE
Sbjct: 3  KGKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKNILE 57

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 64/138 (46%), Gaps = 46/138 (33%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVERE---KNGGG 68
           Y  LPRVP+T +L P+++++ IL+SGYRP+      NP       EL+  ++    N G 
Sbjct: 85  YSWLPRVPSTNYLRPRDMSSKILYSGYRPLFL----NP------DELKTSQDGGNANNGA 134

Query: 69  KLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEF 128
           +L     FA + E                               L + +LW+SSA G E 
Sbjct: 135 RL---YEFAMKLEE------------------------------LGEQSLWTSSATGQEI 161

Query: 129 YPEWNDVPNKVSASLKPY 146
           YPEW+ VP +V   LKP+
Sbjct: 162 YPEWDYVPMEVQRKLKPF 179

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score = 55.1 bits (131), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 30/40 (75%)

Query: 13 RQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQ 52
          R LPRVPTT +L    L  DI FSGYRP++ P+++NPLF+
Sbjct: 17 RDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFR 56

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 58.5 bits (140), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 55/136 (40%), Gaps = 41/136 (30%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLK 71
           Y  LP+VP+T  L  +E+    L+SGYRPI                            + 
Sbjct: 109 YSWLPKVPSTENLNHREIRTSALYSGYRPIY---------------------------IN 141

Query: 72  SKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYPE 131
           SK +           G N   G +  GVN T+     I  KL   + W SSA GME Y E
Sbjct: 142 SKGS-----------GKNKLSGTMKNGVNSTFY---EIAMKLENPSPWMSSATGMELYSE 187

Query: 132 WNDVPNKVSASLKPYQ 147
           W+ VP  V   LKP+ 
Sbjct: 188 WDHVPLDVLKDLKPFH 203

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score = 54.3 bits (129), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 37/52 (71%)

Query: 11 MYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVER 62
          + + LPRVPTT++L   +L  DIL++GYRP++ P+++NPL   +  EL  E+
Sbjct: 7  LCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELANEQ 58

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 52.4 bits (124), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 56/136 (41%), Gaps = 41/136 (30%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLK 71
           Y  LP+VP+ + L  Q++T DI +SG+RP+             +   E+E +        
Sbjct: 94  YSWLPKVPSNKRLTHQDITTDIFYSGFRPL------------SIDPTELENKDEDSSTWY 141

Query: 72  SKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYPE 131
             +     P  P  +G N                           ++W+SSA GME Y E
Sbjct: 142 EVSLTLDSPVPP--SGHN---------------------------SIWTSSATGMERYRE 172

Query: 132 WNDVPNKVSASLKPYQ 147
           W+ VP +V  SL P+Q
Sbjct: 173 WHSVPEEVINSLTPFQ 188

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 52.4 bits (124), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 60/135 (44%), Gaps = 42/135 (31%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLK 71
           Y  LPRVP+T  L P++++  +L+SGYRP+                              
Sbjct: 93  YSWLPRVPSTGNLKPRDMSMKVLYSGYRPL------------------------------ 122

Query: 72  SKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYPE 131
               F +  E    +  +GTGG L       + +  ++  +L   + W +SA G+E+Y E
Sbjct: 123 ----FINPDEIKTSSEGSGTGGTL-------YEFAMKLE-ELGDQSPWVTSATGLEYYRE 170

Query: 132 WNDVPNKVSASLKPY 146
           W+ +P ++   LKP+
Sbjct: 171 WDSIPGELQKKLKPF 185

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 59/145 (40%), Gaps = 38/145 (26%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLK 71
           Y  LP+VP T  +  +E+T + L+SGYRP+    +   L                 G + 
Sbjct: 92  YSWLPKVPQTSSITHREITTNSLYSGYRPLFIDNKKGTLL----------------GDVN 135

Query: 72  SKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYPE 131
           S A  A+   + F                          N+L + + W  SA G+E Y E
Sbjct: 136 STAQDANSSIYEF----------------------AMKLNELSEPSPWMMSATGLESYSE 173

Query: 132 WNDVPNKVSASLKPYQLDQPQDKKM 156
           W+ VP+KV   LKPY L   ++  +
Sbjct: 174 WDYVPSKVIKKLKPYDLSIKENDTL 198

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 61/149 (40%), Gaps = 33/149 (22%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLK 71
           Y  LP+V     L   E++ DIL+SGYRP+    +D          LE    K       
Sbjct: 87  YSTLPKVEPITNLRHNEISTDILYSGYRPLFLNFKD----------LENSSRK------- 129

Query: 72  SKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALW-SSSAMGMEFYP 130
             A F +               +    ++G+   N            W S+SA GME + 
Sbjct: 130 --AEFGNSNNSTLYEIAMKLDDLSPEAISGSTSSN-----------FWHSTSATGMEVFD 176

Query: 131 EWNDVPNKVSASLKPYQLDQPQDKKMTLK 159
           EW++VPN +  +LKP+Q   P  K +T K
Sbjct: 177 EWDNVPNSILKNLKPFQ--APVKKNLTHK 203

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 61/136 (44%), Gaps = 35/136 (25%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLK 71
           Y  LP VP+T+ +   ++  ++L+SGYRP+                L+    + G    K
Sbjct: 93  YHPLPSVPSTQHIEANDMCTELLYSGYRPLF---------------LDSTALERGLLAAK 137

Query: 72  SKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQ-SALWSSSAMGMEFYP 130
            +A+F         A P G+                 I  KL   + +W++SA G+E Y 
Sbjct: 138 EQASFTQS------ASPTGSTFY-------------EIAMKLEDPACIWANSATGLEKYT 178

Query: 131 EWNDVPNKVSASLKPY 146
           EW+++P  V+ SLKP+
Sbjct: 179 EWDNIPYSVANSLKPF 194

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 58/155 (37%), Gaps = 44/155 (28%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLK 71
           Y  LP+ PTT  L   E   D+ +SGYRP+                ++V +         
Sbjct: 103 YSSLPKAPTTHHLHSSEFNTDLFYSGYRPL---------------SIDVNQ--------- 138

Query: 72  SKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYPE 131
                ASE E+P           LS  +         +   L  S  W  SA G E Y E
Sbjct: 139 ----LASEQENPCTCYEIS----LSMDI---------VKKNLKVSTPWLFSATGSELYKE 181

Query: 132 WNDVPNKVSASLKPYQLDQPQDKKMTLKFPPKQTD 166
           W+++P  V  +LK +    P   K T+ F    TD
Sbjct: 182 WDNIPKSVLDNLKCF---HPPQIKQTVDFSENITD 213

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (66%)

Query: 10 QMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAK 54
          Q +R LPRVP+T+ L   ++  DILFS +RP+  P+  NPL + +
Sbjct: 5  QFFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRR 49

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 60/134 (44%), Gaps = 46/134 (34%)

Query: 15  LPRVPTTRFLAPQELTADILFSGYRPI-VSPLRDNPLFQAKVKELEVEREKNGGGKLKSK 73
           LPRVP+T  L   ++T ++L+SGYRPI ++P  ++P    K+KE       + G  L   
Sbjct: 103 LPRVPSTSHLKHSDMTTNVLYSGYRPIFINP--NDP----KLKE-------DTGSTLYEF 149

Query: 74  AAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYPEWN 133
           A    +   P                                 + W SSA G+EF+ EW 
Sbjct: 150 AMKLDDLNEPL--------------------------------SPWISSATGLEFFSEWE 177

Query: 134 DVPNKVSASLKPYQ 147
           ++P+++  +LKP+ 
Sbjct: 178 NIPSELLKNLKPFH 191

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 65/143 (45%), Gaps = 48/143 (33%)

Query: 15  LPRVPTTRFLAPQELTADILFSGYRPI-VSPLRDNPLFQAKVKELEVEREKNGGGKLKSK 73
           LPRVP+T  L   ++T ++L+SGYRP+ ++P  ++P    K+KE       + G  L   
Sbjct: 103 LPRVPSTSHLKQSDMTTNVLYSGYRPLFINP--NDP----KLKE-------DTGSTLYEF 149

Query: 74  AAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYPEWN 133
           A    +   P                                 + W SSA G+EF+ EW 
Sbjct: 150 AMKLEDLNEPL--------------------------------SPWISSATGLEFFSEWE 177

Query: 134 DVPNKVSASLKPYQLDQPQDKKM 156
           ++P+++  +LKP+    P++K M
Sbjct: 178 NIPSELLKNLKPFH--PPKEKSM 198

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 57/136 (41%), Gaps = 41/136 (30%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLK 71
           + +LP++     L  Q+++  +L+SGYRP+  P   N  FQ        + +KN G  L 
Sbjct: 91  FSRLPKITPPSNLRHQDISMKLLYSGYRPLFIP---NGSFQ--------QGQKNNGSTLY 139

Query: 72  SKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYPE 131
             A    E    F    N T                          +W +SA G+E + E
Sbjct: 140 EFAMKLDE----FKKDKNST--------------------------IWDTSATGVETFTE 169

Query: 132 WNDVPNKVSASLKPYQ 147
           W++VP  V  +LKP+Q
Sbjct: 170 WDNVPESVIRNLKPFQ 185

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 60/134 (44%), Gaps = 46/134 (34%)

Query: 15  LPRVPTTRFLAPQELTADILFSGYRPI-VSPLRDNPLFQAKVKELEVEREKNGGGKLKSK 73
           LPRVP+T  L   ++T ++L+SGYRP+ ++P  ++P    K+KE       + G  L   
Sbjct: 103 LPRVPSTSHLKHTDMTTNVLYSGYRPLFINP--NDP----KLKE-------DTGSTLYEF 149

Query: 74  AAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYPEWN 133
           A    +   P                                 + W SSA G+EF+ EW 
Sbjct: 150 AMKLEDLNEPL--------------------------------SPWISSATGLEFFSEWE 177

Query: 134 DVPNKVSASLKPYQ 147
           ++P+++  +LKP+ 
Sbjct: 178 NIPSELLKNLKPFH 191

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 64/146 (43%), Gaps = 46/146 (31%)

Query: 3   FPKSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPI-VSPLRDNPLFQAKVKELEVE 61
           F   K    +  LP+VP+T  L   ++T ++L+SGYRP+ ++P  ++P    K+KE    
Sbjct: 91  FNSKKKRSDFSWLPKVPSTSHLKQSDMTTNVLYSGYRPLFINP--NDP----KLKE---- 140

Query: 62  REKNGGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSS 121
              + G  L   A    +   P                                 + W S
Sbjct: 141 ---DTGSTLYEFAMKLEDLNEPL--------------------------------SPWIS 165

Query: 122 SAMGMEFYPEWNDVPNKVSASLKPYQ 147
           SA G+EF+ EW+++P+++  +LKP+ 
Sbjct: 166 SATGLEFFSEWDNIPSELLRNLKPFH 191

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 60/141 (42%), Gaps = 50/141 (35%)

Query: 7   KATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNG 66
           K ++ Y  LPRVPTT  +  +E  +D+L+SGYRPIV  + D    + K+ +  ++ EK  
Sbjct: 104 KLSRDYSWLPRVPTTEHILREEFNSDMLYSGYRPIV--VGDKNAKENKLMQFAMKLEK-- 159

Query: 67  GGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGM 126
                      SEP  P+++   G                                    
Sbjct: 160 ----------LSEP-VPWVSSATGQ----------------------------------- 173

Query: 127 EFYPEWNDVPNKVSASLKPYQ 147
           EF+ EW++VP+++   LKP+ 
Sbjct: 174 EFFSEWDNVPSEIIKDLKPFH 194

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 50/136 (36%), Gaps = 48/136 (35%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLK 71
           Y  LP+ P+T  L  +E++ D+ +SGYR    P+  NP                      
Sbjct: 80  YSWLPKAPSTEHLKLREISTDVFYSGYR----PIFLNP---------------------- 113

Query: 72  SKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYPE 131
                         A P  +   L             IP        W SSA G EFY E
Sbjct: 114 --------------ASPKESESTLYEFAMKLEALGDPIP--------WVSSATGTEFYGE 151

Query: 132 WNDVPNKVSASLKPYQ 147
           W++VP +V   LKP+Q
Sbjct: 152 WDNVPTEVIKKLKPFQ 167

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 59/142 (41%), Gaps = 48/142 (33%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLK 71
           Y  LP+VPT + L  +++  ++L+SGYRP+         F+A                  
Sbjct: 164 YSWLPKVPTLKNLKQRDVMTNVLYSGYRPLSID------FKA------------------ 199

Query: 72  SKAAFASEPEHPF--MAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSAL----WSSSAMG 125
                 ++P + +   + PNG+  +    +              LQS      W SSA G
Sbjct: 200 -----LNDPTNIYDPYSSPNGSSTLYEFAMQ-------------LQSLSEIFPWMSSAAG 241

Query: 126 MEFYPEWNDVPNKVSASLKPYQ 147
           +E Y EW+ +P +V   LKP Q
Sbjct: 242 LEVYSEWDSIPIEVLKKLKPLQ 263

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 119 WSSSAMGMEFYPEWNDVPNKVSASLKPYQ--LDQPQDK-KMTLKFPPKQTDELSDEKSVD 175
           W SSA G EFY EW+++P  V   L+P+Q   D P  K K  LK   K+  +   +K ++
Sbjct: 141 WISSATGTEFYGEWDNIPADVIKKLRPFQPPTDDPAAKDKEALKLLQKEIVQKEKDKLIN 200

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 62/144 (43%), Gaps = 24/144 (16%)

Query: 15  LPRVPTTRFLAPQELTADILFSGYRPIV---SPLRDN------PLFQAKVKELEVEREKN 65
           LPRVP+T  +  +E+  D LF+GYRP+     P+ D         F A   +L++   ++
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPLFLGNCPIDDAEKGSELDRFLASFSDLKLLNNED 133

Query: 66  GGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMG 125
              K         + ++      N   G      + +    P +P        W +S  G
Sbjct: 134 SDSKEVKIEDILEDIQNDIRNATNEDIG------DNSRTRKPVVP--------WDASISG 179

Query: 126 MEFYPE-WNDVPNKVSASLKPYQL 148
           + +    + ++PN+V + LKP++L
Sbjct: 180 LIYNDRPFKNIPNEVVSKLKPFKL 203

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (65%)

Query: 119 WSSSAMGMEFYPEWNDVPNKVSASLKPYQ 147
           W SSA G EFY EW+ VP  V   L+P+Q
Sbjct: 141 WISSATGTEFYGEWDGVPADVIKQLRPFQ 169

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 48/137 (35%), Gaps = 50/137 (36%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLK 71
           Y  LPRV        + ++ ++L+SGYRP+                              
Sbjct: 113 YSTLPRVEQISDTKLKNMSTEVLYSGYRPLF----------------------------- 143

Query: 72  SKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSAL--WSSSAMGMEFY 129
               F  EP++                  G   Y   +  +  Q A+  W SSA G E Y
Sbjct: 144 ----FDVEPKNS---------------QEGKTLYEFAMKLEEFQEAMSPWVSSATGSEMY 184

Query: 130 PEWNDVPNKVSASLKPY 146
            EW++VP  V   LKP+
Sbjct: 185 AEWDNVPGDVIKDLKPF 201

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 48/140 (34%), Gaps = 48/140 (34%)

Query: 7   KATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNG 66
           K  + Y   P  P T  L   ++  D+L+SGYRP+     D    Q+K+ EL +  E   
Sbjct: 81  KQKRDYSWFPVAPKTEHLKEGDIAVDLLYSGYRPLSLRRADPKEAQSKIYELAMRLE--- 137

Query: 67  GGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGM 126
                     A E   P                                   W  +A G 
Sbjct: 138 ----------AVEDPLP-----------------------------------WVKNATGR 152

Query: 127 EFYPEWNDVPNKVSASLKPY 146
             Y EW++VP  V  +L+PY
Sbjct: 153 VLYDEWDNVPQSVIRNLRPY 172

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 60/144 (41%), Gaps = 27/144 (18%)

Query: 15  LPRVPTTRFLAPQELTADILFSGYRPIV---SPL----RDNPL--FQAKVKELEVEREKN 65
           LPRVP+T ++   E+  + LF+GYRP+    S L    R N L  F      L+V  E  
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLFLGNSSLRPETRTNALDNFFTSFANLKVTSE-- 132

Query: 66  GGGKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMG 125
                 SK +   E +         +  +      G  R  P IP        W +S  G
Sbjct: 133 ------SKNSAEEEVQDVIEELKRDSAQLNLKNSKGKNR-KPIIP--------WDASISG 177

Query: 126 MEFYPE-WNDVPNKVSASLKPYQL 148
           M +    + DVP  V + LKP+++
Sbjct: 178 MVYNDHSFKDVPKSVVSKLKPFKM 201

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 12  YRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDN 48
           Y  LPRVP+T  +  ++L  ++LFS YRP+   L+ +
Sbjct: 88  YSALPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSD 124

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {ON}
           similar to gnl|GLV|KLLA0A07447g Kluyveromyces lactis
           KLLA0A07447g and weakly similar to YNL295W
           uniprot|P48564 Saccharomyces cerevisiae YNL295W
           Hypothetical ORF
          Length = 460

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 63/151 (41%), Gaps = 41/151 (27%)

Query: 15  LPRVPTTRFLAPQELTADILFSGYRPIV---SPLRDNPLFQAKVKELEVEREKNGGGKLK 71
           +PRVP T +++  E+  + LF+GYRP+    SP+ D                KNG   L 
Sbjct: 58  VPRVPPTDYISAPEIQTEGLFAGYRPLFLGNSPIND----------------KNGSTPLD 101

Query: 72  S-KAAFASEPEHPFMAGPNGTG----------GILSGGVNGTWRYN--PRIPNKLLQSAL 118
           +   +FA+                        GI SG ++ +   N  P IP        
Sbjct: 102 NFFTSFANLKVVEESEVVGEVNVQEVIEDLRRGIPSGQMSNSKGKNRKPIIP-------- 153

Query: 119 WSSSAMGMEFYPE-WNDVPNKVSASLKPYQL 148
           W +S  GM +  + +  VPN V + LKP+++
Sbjct: 154 WDASISGMVYNDDPFKHVPNNVVSKLKPFKM 184

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 32.7 bits (73), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 25/37 (67%)

Query: 5   KSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPI 41
           K   + ++  +PRV +T +++ +E+  + LF+GYRP+
Sbjct: 101 KISGSNLHLLVPRVASTDYISNKEVHTEGLFAGYRPL 137

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 32.0 bits (71), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 3/37 (8%)

Query: 15  LPRVPTTRFLAPQELTADILFSGYRPIV---SPLRDN 48
           +P+VP+T +L  ++L  + LF+GY+P+    SPL  N
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLFLGNSPLESN 126

>TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.798
           YOR320C
          Length = 502

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 7   KATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRD 47
           K   +Y  LP +P T +L  + L  DI+ SG  P+ SP+ D
Sbjct: 268 KGQMIYNHLPSLPDTLYLNAKNLGQDIISSG--PLYSPIFD 306

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 25/38 (65%)

Query: 4   PKSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPI 41
           PK   + ++  +P+V +T ++  +E+  + LF+GYRP+
Sbjct: 100 PKMFGSNLHLLVPKVASTEYIPIKEVHTEGLFAGYRPL 137

>TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {ON}
           Anc_3.62 YNL295W
          Length = 494

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 63/163 (38%), Gaps = 46/163 (28%)

Query: 15  LPRVPTTRFLAPQELTADILFSGYRPIV---SPLRDNPLFQA-----------KVKELEV 60
           +P+V +T  L+  E+  + LF+GYRP+    S L  N                KV   E 
Sbjct: 89  VPKVASTDNLSSAEIQTEGLFAGYRPLFLGNSSLETNSKLDVLDNFFTSFANLKVSAPES 148

Query: 61  EREKNGGGKLKS-----KAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQ 115
           E +    G++K      +    SE E   +   N                 P IP     
Sbjct: 149 ETDSYNSGQIKDVIDDLQNGLESEQEQSSLTRENR---------------KPIIP----- 188

Query: 116 SALWSSSAMGMEFYPE-WNDVPNKVSASLKPY---QLDQPQDK 154
              W +S  GM +  + + D+P  V + L P+   +L++ QDK
Sbjct: 189 ---WDASIGGMVYSDKAFKDLPKSVVSKLSPFKLVKLERSQDK 228

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
          {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 20/27 (74%)

Query: 15 LPRVPTTRFLAPQELTADILFSGYRPI 41
          +P+VPTT ++   E+  + LF+GY+P+
Sbjct: 70 VPKVPTTDYIPSLEMQTEGLFAGYKPL 96

>TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa]
           {ON} Anc_3.62 YNL295W
          Length = 501

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 15  LPRVPTTRFLAPQELTADILFSGYRPI 41
           +PRV +T  +   E+  D LF+GYRP+
Sbjct: 90  VPRVASTEDIPSHEVQVDGLFAGYRPL 116

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 24/38 (63%), Gaps = 3/38 (7%)

Query: 4   PKSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPI 41
           PK+K + +   +P VP T ++   E+  + LF+GY+P+
Sbjct: 153 PKAKKSLL---VPHVPNTDYIPHSEIQTEGLFAGYKPL 187

>KAFR0G00200 Chr7 (66669..70646) [3978 bp, 1325 aa] {ON} Anc_1.134
           YCR038C
          Length = 1325

 Score = 29.6 bits (65), Expect = 5.3,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 7/46 (15%)

Query: 29  LTADILFSGYRPIVSPLRDNPLFQAKVKE-------LEVEREKNGG 67
            + D  F+ YRP+ S L DNPL     K+       L+ ER  NG 
Sbjct: 707 FSRDSTFAKYRPLESELNDNPLTSVNYKDEILREIILDNERNLNGA 752

>CAGL0M03685g Chr13 complement(413333..414814) [1482 bp, 493 aa]
           {ON} weakly similar to uniprot|P48564 Saccharomyces
           cerevisiae YNL295w
          Length = 493

 Score = 29.6 bits (65), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 58/138 (42%), Gaps = 21/138 (15%)

Query: 15  LPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREKNGGGKLKSK- 73
           +P V +T  L  QE+  + LF+G +         PLF  K+  ++        G L SK 
Sbjct: 94  VPSVSSTDHLTDQEIHLEGLFAGSK---------PLFLGKLASMKSMPSFFDNGVLLSKN 144

Query: 74  --AAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYPE 131
                AS+       G       L    +  W  +     K++    W +S  G+E+  +
Sbjct: 145 FRVINASDD-----GGEKSLDEFLESVKDNDWNIDNSEQKKVIP---WQASISGIEYEDK 196

Query: 132 -WNDVPNKVSASLKPYQL 148
            ++++P  V + L+PY+L
Sbjct: 197 SFSNIPKHVLSKLRPYKL 214

>TDEL0C05330 Chr3 (948950..950869) [1920 bp, 639 aa] {ON} Anc_3.396
           YBR131W
          Length = 639

 Score = 29.6 bits (65), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 31/80 (38%), Gaps = 7/80 (8%)

Query: 74  AAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGMEFYPEWN 133
           A   S+   P     NG   +  GG N +    P + N       W    MG  F     
Sbjct: 479 AKTESDDVSPLRLVINGVDQLFGGGANSSEDAGPPVSNN------WGIDIMGGLFGIN-R 531

Query: 134 DVPNKVSASLKPYQLDQPQD 153
           D  N  SAS++ Y+LD+  D
Sbjct: 532 DKINTTSASMREYRLDKKYD 551

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,827,158
Number of extensions: 897684
Number of successful extensions: 1822
Number of sequences better than 10.0: 60
Number of HSP's gapped: 1805
Number of HSP's successfully gapped: 78
Length of query: 191
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 88
Effective length of database: 41,670,801
Effective search space: 3667030488
Effective search space used: 3667030488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 62 (28.5 bits)