Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E03961g3.497ON1132113258100.0
Ecym_12323.497ON1204120712761e-155
SAKL0F02596g3.497ON1132115212581e-153
AFR316W3.497ON119189311681e-140
Kwal_47.188863.497ON1105115611621e-140
KLTH0G02442g3.497ON1113115611211e-134
TDEL0D056503.497ON107798710601e-125
NCAS0E007703.497ON1150114810551e-124
KAFR0C020003.497ON1066112410191e-119
ZYRO0D09790g3.497ON1180113710161e-118
Suva_7.4223.497ON1127114010101e-118
YGR134W (CAF130)3.497ON112210409291e-106
Smik_6.2303.497ON112411449281e-106
Skud_7.4453.497ON112311499091e-104
Kpol_480.123.497ON111410408961e-102
NDAI0G009003.497ON127910268911e-100
CAGL0I10428g3.497ON116311318861e-100
TPHA0A056803.497ON10749168612e-97
TBLA0C045103.497ON130712708666e-97
KNAG0B007703.497ON10385676695e-72
Suva_2.4178.484ON852109745.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E03961g
         (1132 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...  2242   0.0  
Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...   496   e-155
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...   489   e-153
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...   454   e-140
Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...   452   e-140
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...   436   e-134
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...   412   e-125
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...   410   e-124
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....   397   e-119
ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...   395   e-118
Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...   393   e-118
YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...   362   e-106
Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...   362   e-106
Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...   354   e-104
Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...   349   e-102
NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...   347   e-100
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   345   e-100
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   336   2e-97
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...   338   6e-97
KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...   262   5e-72
Suva_2.417 Chr2 (740137..742695) [2559 bp, 852 aa] {ON} YDR251W ...    33   5.6  

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] {ON}
            weakly similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4-NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score = 2242 bits (5810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1098/1132 (96%), Positives = 1098/1132 (96%)

Query: 1    MLQEKSSVQRLFLADSDVDESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECL 60
            MLQEKSSVQRLFLADSDVDESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECL
Sbjct: 1    MLQEKSSVQRLFLADSDVDESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECL 60

Query: 61   IRMNDPYWVALFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDP 120
            IRMNDPYWVALFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDP
Sbjct: 61   IRMNDPYWVALFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDP 120

Query: 121  KFTAPLWDTSNILLDYLHNAKPLIESVLKKLDGSQFLQCLMKYNRLYEFNGSYQWFTPPQ 180
            KFTAPLWDTSNILLDYLHNAKPLIESVLKKLDGSQFLQCLMKYNRLYEFNGSYQWFTPPQ
Sbjct: 121  KFTAPLWDTSNILLDYLHNAKPLIESVLKKLDGSQFLQCLMKYNRLYEFNGSYQWFTPPQ 180

Query: 181  STSHAESPTTILERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGHNNPPL 240
            STSHAESPTTILERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGHNNPPL
Sbjct: 181  STSHAESPTTILERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGHNNPPL 240

Query: 241  SKQDDHNPLNLNGKSDRFNLFFKLGLHKEPHPLLAEQFNSLCLFADPMTQPPPNXXXXXX 300
            SKQDDHNPLNLNGKSDRFNLFFKLGLHKEPHPLLAEQFNSLCLFADPMTQPPPN      
Sbjct: 241  SKQDDHNPLNLNGKSDRFNLFFKLGLHKEPHPLLAEQFNSLCLFADPMTQPPPNDSHIIS 300

Query: 301  XXXXXXXXXXXXTAYIVKLIPNYQKVWKIHLSANLETITLAILQMLQIWDYRSLDNLKDI 360
                        TAYIVKLIPNYQKVWKIHLSANLETITLAILQMLQIWDYRSLDNLKDI
Sbjct: 301  LDLLHDLYLGSLTAYIVKLIPNYQKVWKIHLSANLETITLAILQMLQIWDYRSLDNLKDI 360

Query: 361  QARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSDKPPRLNPFLPMMLRA 420
            QARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSDKPPRLNPFLPMMLRA
Sbjct: 361  QARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSDKPPRLNPFLPMMLRA 420

Query: 421  WRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIATILNGHVDEKLHDFK 480
            WRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIATILNGHVDEKLHDFK
Sbjct: 421  WRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIATILNGHVDEKLHDFK 480

Query: 481  HQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVELLTDIQKGDRIDEDVRY 540
            HQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVELLTDIQKGDRIDEDVRY
Sbjct: 481  HQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVELLTDIQKGDRIDEDVRY 540

Query: 541  MFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNRFRMLRGLYKRCLCKFSXXXXXXXX 600
            MFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNRFRMLRGLYKRCLCKFS        
Sbjct: 541  MFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNRFRMLRGLYKRCLCKFSDEDDNDDD 600

Query: 601  XXXXXXXXYNGEKSVVGLDENGQINEAETPQTFSESSNAVAFTSLMTHRDSQNDFVSHLT 660
                    YNGEKSVVGLDENGQINEAETPQTFSESSNAVAFTSLMTHRDSQNDFVSHLT
Sbjct: 601  DDDDDDDDYNGEKSVVGLDENGQINEAETPQTFSESSNAVAFTSLMTHRDSQNDFVSHLT 660

Query: 661  TGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRLPDRNVTFSQACTVLRSI 720
            TGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRLPDRNVTFSQACTVLRSI
Sbjct: 661  TGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRLPDRNVTFSQACTVLRSI 720

Query: 721  ATCVKLEQEQILLKLITATSAEVDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLG 780
            ATCVKLEQEQILLKLITATSAEVDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLG
Sbjct: 721  ATCVKLEQEQILLKLITATSAEVDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLG 780

Query: 781  WKIFDELMMSHGHRRLLIYHLTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLG 840
            WKIFDELMMSHGHRRLLIYHLTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLG
Sbjct: 781  WKIFDELMMSHGHRRLLIYHLTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLG 840

Query: 841  ILSWTPTGEFERVAAIEFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSI 900
            ILSWTPTGEFERVAAIEFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSI
Sbjct: 841  ILSWTPTGEFERVAAIEFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSI 900

Query: 901  KNPSKVYVDDYGEEFFSATSRKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRF 960
            KNPSKVYVDDYGEEFFSATSRKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRF
Sbjct: 901  KNPSKVYVDDYGEEFFSATSRKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRF 960

Query: 961  LMQWSTFSAEACSMYALLKSKALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDID 1020
            LMQWSTFSAEACSMYALLKSKALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDID
Sbjct: 961  LMQWSTFSAEACSMYALLKSKALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDID 1020

Query: 1021 DRWDTETDTSIENGDKTSIMSERFSRMLPVQSLDGQPVDKVFRHLLQKYPLTEGTPIHGR 1080
            DRWDTETDTSIENGDKTSIMSERFSRMLPVQSLDGQPVDKVFRHLLQKYPLTEGTPIHGR
Sbjct: 1021 DRWDTETDTSIENGDKTSIMSERFSRMLPVQSLDGQPVDKVFRHLLQKYPLTEGTPIHGR 1080

Query: 1081 ITLEYHDHILPLDIRTHQSLHREFLAVFDIDYLDILEARQQEAEEECDEMSI 1132
            ITLEYHDHILPLDIRTHQSLHREFLAVFDIDYLDILEARQQEAEEECDEMSI
Sbjct: 1081 ITLEYHDHILPLDIRTHQSLHREFLAVFDIDYLDILEARQQEAEEECDEMSI 1132

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score =  496 bits (1276), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 368/1207 (30%), Positives = 583/1207 (48%), Gaps = 135/1207 (11%)

Query: 10   RLFLADSDVDESVLLEKLVIALFTTVPGQAVVTQLIN-DAKRTNDVDGVECL-IRMNDPY 67
            RL + D   D +++ EK+V+ LF T  G +++  L +    R    +  + L +R N  Y
Sbjct: 36   RLNVGDEHFD-ALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSY 94

Query: 68   WVALFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFTAPLW 127
            W + +  W + + ILS FL + LRNE   +D   Y+  + K+ ++FLL   +P     + 
Sbjct: 95   WKSCYKDWGSRRDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLP--EPLRPYLID 152

Query: 128  DTSNILLDYLHNAKPLIESVLKKLDGSQFLQCLMKYNRLYEFNGSYQWFTPPQSTSHAES 187
            D  N+LLDY+  ++P+ E +L +       + + +YNR YEFNG Y W+    + S  + 
Sbjct: 153  DEYNLLLDYMIQSRPMWEMLLTQGIPKFLPELVDEYNRSYEFNGYYVWYGNV-TCSQVQV 211

Query: 188  PTTILERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGHNNPPLS------ 241
             ++  E  + F  TL +        L +L       +   SY K +  +           
Sbjct: 212  QSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYTKQTLLDLSNDDDDHYDQ 271

Query: 242  ---KQDDHNP--------------LNLNGKSDRFNLFFK-----------LGLHKEPHPL 273
                ++DH P              LN +G  +  N+F             LGL     PL
Sbjct: 272  DVDSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAEGPL 331

Query: 274  LAEQFNSLCLFADPMTQPPPNXXXXXXXXXXXXXXXXXXTAYIVKLIPNYQKVWKIHLSA 333
            L  QF +L    DP+TQPPP                   +  I  ++ +  + W+ H+  
Sbjct: 332  LKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGRDWRFHVCY 391

Query: 334  NLETITLAILQMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAG 393
            N++ I LA ++ L   D   L+ + +  +     +   +  W P  L+  ++E+LYM+  
Sbjct: 392  NMQKIVLATMKRLNCHDGDVLNTVNN--SDESVHWNVNLDKWTPRGLNTQDLELLYMVDM 449

Query: 394  LSFYSMHKMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAV 453
            LS Y+M++++S  P ++NPFLP+ L  W+ L++ L+ GL+IDRFEE +  + TP+IV A 
Sbjct: 450  LSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPIIVRAA 509

Query: 454  IRGASALRSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLP 513
            IRG +ALRS++AT++N H   K HDFKH+P   FMSPHGRKLC+GALY     + AA+L 
Sbjct: 510  IRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHAAAMLS 569

Query: 514  SGMDYDEIVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQ 573
             G+D +++ +LL+D+Q GDR D+DV+YMFDYEY DYN  D  +L D          E++Q
Sbjct: 570  LGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEEDLERLEEIQQ 629

Query: 574  KNRFRMLRGLYKRCLCKFSXXXXXXXXXXXXXXXXYNGEKSVVGLDENGQINEAETPQ-T 632
            + R + +RG YKRC C F                    +  ++  +E G+   +   +  
Sbjct: 630  RERIKDMRGYYKRCHCVFD-------------------DDELLSDEEEGETASSNIDRPK 670

Query: 633  FSESSNAVAFTSLMTHRDSQND----FVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFL 688
            +S +S  +  + L T  +  N       S     +D NG DWRDIPRGLN YY + Y F+
Sbjct: 671  YSHNSLNLPSSMLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFV 730

Query: 689  SKLDKVSLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILL------KLITATSAE 742
            +KL    ++ L++    + +  + A  +LRSIATC+KLEQE+ ++      +    +S+ 
Sbjct: 731  NKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTDKGSSSN 790

Query: 743  VDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLT 802
             +   +   T + I   + ++    K   +   N+ L W++ DE++M  G+RR+LI+ +T
Sbjct: 791  SNSDRVNELTSDFIYEKWCEESLFTKMMYY---NNDLVWRMMDEMLMCSGYRRVLIWFIT 847

Query: 803  HRSYTFSSIHYVYELLFGLRGNPARSYDLES---TKNKQLGILSWTPTGEFERVAAIEFS 859
            H   + S IHY++EL+ G+RGN    YD E+    KN+ L IL     G       I FS
Sbjct: 848  HLEISHSLIHYIFELVMGMRGNV--DYDEEAEDDIKNRNLDILDSLSLGSSSVTIKIPFS 905

Query: 860  RQGVIELSAIEKKMLLQEFFVGVS---SGLLGEYNDAGFEAFSIKNPSKVYVDD--YG-- 912
            RQG I LS IE  MLL EFF+  +   S  +   N    E   +        DD  YG  
Sbjct: 906  RQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSD--EELPLSQSENEGSDDLEYGLC 963

Query: 913  EEFFSAT-SRKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEA 971
            E+    T      + G +K+VCF+++ ++  K+F+F   E Y++EL+  LM W     EA
Sbjct: 964  EDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSE-YIFELQTLLMNWIGIIPEA 1022

Query: 972  CSMYALLKSKAL--------GKVLDLGTEGLDDRP----------------NTDPDDQL- 1006
             +++  LKS  L         K    GTE +  +                 N D +D L 
Sbjct: 1023 RNLFFKLKSSILEASSQNDSSKSDKQGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLE 1082

Query: 1007 ----------LPVDFDKLKLSDIDDRWDTETDTSIENGDKTSIMSERFSRMLPVQSLDGQ 1056
                       P+D + LKL ++           I+N +  S  ++    +LP+   +  
Sbjct: 1083 NCLSDADFPPTPIDINNLKLENV-------GSPEIDNNNNLSKYNKMLIELLPLHVDNEN 1135

Query: 1057 PVDKVFRHLLQKYPLTEGTPIHGRITLEYHDH-ILPLDIRTHQSLHREFLAVFDIDYLDI 1115
                  R  + K+ LT  T + GR  + Y DH I+ L +   +   REFLA F IDY  +
Sbjct: 1136 TAVTALRSFITKHSLTNKTAVFGRRVI-YQDHAIMGLYMADKEMRQREFLAEFGIDYNSV 1194

Query: 1116 LEARQQE 1122
            +    +E
Sbjct: 1195 VNNEDEE 1201

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  489 bits (1258), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 360/1152 (31%), Positives = 571/1152 (49%), Gaps = 111/1152 (9%)

Query: 20   ESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVE----CLIRMNDPYWVALFGTW 75
            ++V+ E L+++LF T+PG +++    + +    D+   +      +R  D Y   L   W
Sbjct: 46   DAVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGY-KKLVKRW 104

Query: 76   ATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFTAPLWDTSNILLD 135
            +T   +L  F   +L+N+   ++  +++   +K+++ FLL  Q+      L    N+LLD
Sbjct: 105  STSTLVLLRFTDLLLQNKNVPLEYTKHNTAEYKLSLIFLLDKQNEFLI--LDPDYNLLLD 162

Query: 136  YLHNAKPLIESVLKKLDGSQFLQCLMKYNRLYEFNGSYQWFTPPQSTSHAESPTTILERN 195
            YL +AKP+IES+L           + +YN+L EFNG + W+T     +H      I  + 
Sbjct: 163  YLLHAKPMIESILLGNIPGLLKALVYQYNKLPEFNGCHTWYT---FRTHYHGTQEIFHKF 219

Query: 196  STFLSTLGNFGNDMVRALS--------QLKTGDIRLNSLESYGKNSGHN--NPPLSKQDD 245
               L+       +++  L            +G I+  + + Y  ++  +  N     Q  
Sbjct: 220  FIALTDKFTASKEIMPELEGWFVEGPVSRDSGCIKPITGDDYTSSAAIDDFNEDYWTQQK 279

Query: 246  HNP--------LNLNGKSDRFNLFFK-----------LGLHKEPHPLLAEQFNSLCLFAD 286
             N         LN +G  +  N+F             LGL+ +P PLL   F + C  AD
Sbjct: 280  TNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDALYKVLGLNDDPTPLLKSCFLTFCCLAD 339

Query: 287  PMTQPPPNXXXXXXXXXXXXX----XXXXXTAYIVKLIPNYQKVWKIHLSANLETITLAI 342
            P+TQPPPN                      TA +V+  P  +  W +H+  NL+ I  A 
Sbjct: 340  PVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQ--PLNKDTWTLHICFNLQKIINAT 397

Query: 343  LQMLQIWDYRSLDNLKDIQARSPDA--YPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMH 400
            L  L   D+  L+ + +    S D+  + K +  W+P  L+  ++E++YM+  L+ Y+++
Sbjct: 398  LSRLNCDDFTRLNEINN----SDDSVDWRKNLYKWLPQGLNTQDLELIYMVDILATYTIY 453

Query: 401  KMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASAL 460
            K++S++P ++NPFL  M+  W+ L+  ++LGL+IDR EE Q  + TPV+V A IRGASAL
Sbjct: 454  KLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVRATIRGASAL 513

Query: 461  RSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDE 520
            RS++ATI+NGH   K HDFKH+P   FMSPHGRKLCNGALY     + A +L  G++ + 
Sbjct: 514  RSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAATMLALGIELET 573

Query: 521  IVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNRFRML 580
            + +LL+D+Q GDR DEDV+YMFDYE+ DYN+ DT  + D +L       ++E + R + +
Sbjct: 574  LTDLLSDLQPGDRFDEDVKYMFDYEFDDYNEVDTELMADDEL------EDIESRERIKEV 627

Query: 581  RGLYKRCLCKFSXXXXXXXXXXXXXXXXYNGEKSVVGLDENGQINEAETPQTFSESSNAV 640
            RG YKRC C F                    +      D +      +     S +S  +
Sbjct: 628  RGYYKRCHCVFDDDSLVPENEDGGGEEGDQEDTKKHLQDSHEDQLPPQQNVVMSTTSKPL 687

Query: 641  AFTSLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELL 700
            A  S    RD         T  +D NG DWRDIPRGLN YY D Y F++KL    +  L+
Sbjct: 688  AVRS----RD---------TVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLM 734

Query: 701  RRLPDRNVTFSQACTVLRSIATCVKLEQEQILLKLITA------TSAEVDLKVLPFSTDE 754
            +    + +  + A  +LRSIATCVKLEQE+ +++          +S    +K     T +
Sbjct: 735  KEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALGNQDGDKSSNATTIKTENELTSD 794

Query: 755  VITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTHRSYTFSSIHYV 814
             I   + +D    K       N  L W++ DE++M  G+RR+LI+ +TH     S IHY+
Sbjct: 795  FIYEKWCEDSLFEKMMYH---NSDLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVIHYI 851

Query: 815  YELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAIEFSRQGVIELSAIEKKML 874
            +EL+ GLRGN   +Y+ +  K+K L  L     G       + FSRQG I LS+IE  ML
Sbjct: 852  FELVMGLRGNI--TYEDDEEKSKNLDALDGLAQGSSTSELTLPFSRQGPIILSSIEVNML 909

Query: 875  LQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEEFFSATSRKAEMSGKVKMVCF 934
            LQEFF   +     +      E+F  +N       +  +EF    S    + G +K+VCF
Sbjct: 910  LQEFFTNAAIFFSSKLR----ESFDSENEELDENFEDEDEF----SVPPHVIGLMKLVCF 961

Query: 935  ILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSKALGKVLDLGTEGL 994
            +++ ++  K+F+F   E Y++EL+  LM W     EA  ++  LKS+ +    D   +G 
Sbjct: 962  MVDTLMQKKKFDFTDSE-YIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQEQG- 1019

Query: 995  DDRPNTDPDDQLLPVDFDKLKLSDIDDRWDTETDTSIENGDKTSIMSERFSRMLPVQSLD 1054
                         PV     K S+ D   D +   ++E  D  S  +++   ++P  + +
Sbjct: 1020 ------------TPV-----KESEKD---DIDAPDTLEMNDTMSEHNKKLMMLIPPGTTN 1059

Query: 1055 GQPVDKVFRHLLQKYPLTEGTPIHGRITLEYHDHILPLDIRTHQSLHREFLAVFDIDYLD 1114
             +      R  + KY LT  T + GR  +   D I+ + +   + ++REFLA F IDY D
Sbjct: 1060 ERNALTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGIDYND 1119

Query: 1115 ILEARQQEAEEE 1126
            I+E   +E +++
Sbjct: 1120 IVEGVYEEDDDD 1131

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score =  454 bits (1168), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 296/893 (33%), Positives = 453/893 (50%), Gaps = 72/893 (8%)

Query: 260  LFFKLGLHKEPHPLLAEQFNSLCLFADPMTQPPPNXXXXXXXXXXXXXXXXXXTAYIVKL 319
            L+  LGL     PLL  QF +LC   DP+TQPPP                   ++ +   
Sbjct: 317  LYRILGLPNRECPLLRAQFMTLCALVDPITQPPPTEKHIISIDLIYQMFLGSISSLLESS 376

Query: 320  IPNYQKVWKIHLSANLETITLAILQMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYD 379
            +    + W+ H+  NL+ I LA ++ L   D   L+++ +  +     +   +  W P  
Sbjct: 377  LRG--QDWRFHVCHNLQKIILATMKRLNCHDSEVLNSINN--SDETVHWNVNIGKWTPRG 432

Query: 380  LSPPEMEILYMIAGLSFYSMHKMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEE 439
            L+  ++E+LYM+  L  Y++++++SD P ++NPFLP+    W+ L++ L+LGL+IDRFEE
Sbjct: 433  LNTQDLELLYMVDMLGIYTIYQLYSDLPVQMNPFLPLSFHLWKNLTNVLLLGLEIDRFEE 492

Query: 440  MQMLYGTPVIVSAVIRGASALRSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGA 499
             +  + TP+IV A IRG++ALRS++AT++N H   K HDFKH+P   FMSPHGRKLC GA
Sbjct: 493  DRETFSTPIIVRATIRGSAALRSVVATMINSHFSIKEHDFKHEPINLFMSPHGRKLCQGA 552

Query: 500  LYTYEMYYFAALLPSGMDYDEIVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTD 559
            LY     + AA+L  G++ +++ +LL+D+Q GDR D+DV+YMFDYEY DYN  D  +L D
Sbjct: 553  LYADVRSHAAAMLALGIELNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYD 612

Query: 560  GKLMFTSTKNELEQKNRFRMLRGLYKRCLCKFSXXXXXXXXXXXXXXXXYNGEKSVVGLD 619
                      E++Q+ R + +RG YKRC C F                           D
Sbjct: 613  ENEEDLERLEEIQQRERIKDMRGYYKRCHCVFDDDELLS--------------------D 652

Query: 620  ENGQINEAETPQTFSESSNAVAF---TSLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRG 676
            E G      T    +E+  +      T + T    +    S     +D NG DWRDIPRG
Sbjct: 653  EEGTDTGEHTDNHITETVQSAPLNLVTGVSTSGPQKVAVRSRDYVEFDFNGKDWRDIPRG 712

Query: 677  LNLYYMDDYQFLSKLDKVSLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILLKLI 736
            +N YY++DY F++KL    L  L++    + +  +Q+  +LRS+ATC+KLEQE+ ++   
Sbjct: 713  MNFYYVEDYVFVNKLHADVLHYLMKEATSKKLESNQSSFILRSVATCIKLEQEKTMVH-- 770

Query: 737  TATSAEVDLKVLPFSTDEVITAIFND-------DGGIIKPFPFSGCNDSLGWKIFDELMM 789
             A     D   L  S  E    + +D       +  + +   +   N+ L W++ DE++M
Sbjct: 771  DAIFKSKDKSPLSASGSEGSNGLTSDFIYEKWCEDALFEKMMYY--NNDLVWRMMDEMLM 828

Query: 790  SHGHRRLLIYHLTHRSYTFSSIHYVYELLFGLRGNPA-RSYDLESTKNKQLGILSWTPTG 848
              G+RR+LI+ +TH   + S IHY++EL+ G+RGN A +  + E   N+ L +L     G
Sbjct: 829  CSGYRRVLIWFITHLELSHSVIHYIFELVMGMRGNVAYKDLEEEYIINRNLDLLDSFSLG 888

Query: 849  EFERVAAIEFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYND-AGFEAFSIKNP---- 903
                 A+I FSRQG I LS IE  MLLQEFF+  +        D A +E   ++ P    
Sbjct: 889  SSCIPASIPFSRQGPIVLSTIEVNMLLQEFFINAAIYFSNYLRDTASYEHLDVEQPEEQT 948

Query: 904  ---SKVYVDDYGEEFFSATSRKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRF 960
                    D+  +E  +A+S    + G +K++CF+++ ++  K+ +F   E Y++EL+  
Sbjct: 949  EIEEGEAEDEIADERLTASSH---VLGLMKLLCFMVDMLIEKKKLDFTDSE-YLFELQTL 1004

Query: 961  LMQWSTFSAEACSMYALLKSKAL------GKVL-----DLGTEGLDDRPNTDPDDQLLPV 1009
            LM W     EA +++  LKS  L      G  L     +L +   DD    D  +   P+
Sbjct: 1005 LMNWIGLVPEARTLFFKLKSTLLNSSALNGSALSHLEGELASNDNDDSEPVDTAEDAGPM 1064

Query: 1010 D----FDKLKLSDID---DRWDTETDTSIENG---DKTSIMSERFSRMLPVQSLDGQPVD 1059
            D     D L L DI    +   T    S  NG      S  ++   ++LP  S D     
Sbjct: 1065 DKSNGLDGLPLCDIGALTNGQPTSAANSAPNGMSESNISYCNQMLIKLLPPHSADENAAV 1124

Query: 1060 KVFRHLLQKYPLTEGTPIHGRITLEYHDHILPLDIRTHQSLHREFLAVFDIDY 1112
               R  + K+PLT  T I GR  +   + I+ L +   +   REFLA F IDY
Sbjct: 1125 TALRSFIAKHPLTTKTAIFGRRVIYQDNAIMGLYMADKELQQREFLAEFGIDY 1177

 Score = 68.9 bits (167), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 81/159 (50%), Gaps = 4/159 (2%)

Query: 20  ESVLLEKLVIALFTTVPGQAVVTQLIN-DAKRTNDVDGVECL-IRMNDPYWVALFGTWAT 77
           E +++EK+V+ LF T  G +++  L +    R    +  + L +R N   W   +  W +
Sbjct: 45  ELMIVEKVVVTLFMTRGGNSILHLLYDLSCGRIKLSEYRQSLKVRSNVHQWKTCYKEWGS 104

Query: 78  DKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFTAPLWDTSNILLDYL 137
            +  LS FL + LRNE   +D   Y     K+ ++FLL      +   L +  N+LLDY+
Sbjct: 105 RRDTLSRFLDFCLRNEDCALDYTEYGRVMRKLPLQFLLPAGLHAYV--LDEGYNLLLDYI 162

Query: 138 HNAKPLIESVLKKLDGSQFLQCLMKYNRLYEFNGSYQWF 176
            N++ + E +L +       + +  YNR++EFNG Y W+
Sbjct: 163 INSRLMWEELLIQGIPRLLPELIEDYNRVFEFNGYYTWY 201

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR134W
            (CAF130) - CCR4 Associated Factor 130 kDa [contig 189]
            FULL
          Length = 1105

 Score =  452 bits (1162), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 346/1156 (29%), Positives = 552/1156 (47%), Gaps = 167/1156 (14%)

Query: 25   EKLVIALFTTVPGQAVVTQLIN-DAKRTNDVDGVECLIR-----------MNDPYWVALF 72
            EKLVI LFTT PG +++         R N       L+R           + D  +  L 
Sbjct: 48   EKLVIGLFTTKPGLSILKLYYELSCGRIN-------LLRYKKWQQSKFQSLPDAVYKKLV 100

Query: 73   GTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFTAPLWDTSNI 132
              W      +S  + ++LRN++  +D   +    +K++M FLL +QD +    + D  N+
Sbjct: 101  KKWTGSSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLL-DQDTELLI-IDDEYNL 158

Query: 133  LLDYLHNAKPLIESVLKKLD-GSQFLQCLMKYNRLYEFNGSYQWFTPPQSTSHAESPTTI 191
            LLD+L   +  +E +L + D  S   +  + ++RL++ +G Y W+T       AE+    
Sbjct: 159  LLDFLLQTRASVEELLSQADLPSLIAKSALSHHRLFQLSGRYVWYTFSDE-RFAEAQDIC 217

Query: 192  LERNSTFLSTLGN-----------FGNDMVRALSQLKTGDIRLNSLESYGKNSGHNNPPL 240
             +  S     L             F +     L+ L  GD   +       NS  ++ P 
Sbjct: 218  YKYLSVLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQ 277

Query: 241  SKQDDHNPL--------------NLNGKSDRFN--LFFKLGLHKE-PHPLLAEQFNSLCL 283
             K   H  +              N+ G++ R +  L+  L L ++   P L  QF +LC 
Sbjct: 278  KKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCA 337

Query: 284  FADPMTQPPPNXXXXXXXXXXXXXXXXXXTAYIVKLIPNYQKVWKIHLSANLETITLAIL 343
              DP+TQP PN                   + I +L  N    W+ H+  NL+ I  + L
Sbjct: 338  LVDPVTQPTPNDSHIISIDLLSDMFIGLLHSEIKQLPFN----WRFHICFNLQKILQSTL 393

Query: 344  QMLQIWDYRSLDNLKDIQARSPDA--YPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHK 401
              L   D++ L+++ +    S D+  + + +  W+P  L+  ++E++YMI  L+ Y +HK
Sbjct: 394  PRLNCHDFQQLNSVNN----SDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHK 449

Query: 402  MHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALR 461
            ++ D+P ++NPFL  M+  W+ L+  ++LGL+IDRFEE Q  + TPV+V A IRG+SALR
Sbjct: 450  LYRDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALR 509

Query: 462  SIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEI 521
            S++AT+LNGHV+ K HDF+H+P   FMSPHGRKLC+GALYT    + AA+L  G++ +++
Sbjct: 510  SVVATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDV 569

Query: 522  VELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNRFRMLR 581
              LL+D+Q GDR DEDV+YMFDYEY +YN+  T  + + +L    +      + R + +R
Sbjct: 570  TNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVGTEDMDEEELEDVES------RERIKEMR 623

Query: 582  GLYKRCLCKFSXXXXXXXXXXXXXXXXYNGEKSVVGLDENGQINEAETPQTFSESSNAVA 641
              YKRC C+F                             + +I++   P T  + SN   
Sbjct: 624  AYYKRCHCQFDDDELLPEEEEESGIPI-----------SHTRISKELPPDTNVKLSNTAK 672

Query: 642  FTSLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLR 701
              +L   +D         T  +D NG DWRDIPRGLN Y+ ++Y F   + + +   L+ 
Sbjct: 673  PVALRNKKD---------TIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMN 723

Query: 702  RLPDRNVTFSQACTVLRSIATCVKLEQEQILLKLITATSAEVDLKVLPFSTDEVITAIFN 761
               +R ++  +A  +LR ++TCV  EQE  +L+  +A +A+ D + L  S    + A   
Sbjct: 724  SAAERQLSKEEAVHLLRLVSTCVAKEQEHTVLR--SAFAAD-DSQAL--SCQSTLVA--- 775

Query: 762  DDGGIIKPFPFSG-CNDS-----------LGWKIFDELMMSHGHRRLLIYHLTHRSYTFS 809
             DG +   + +   C DS           L W+I DE++M  G+RR+LI+ +TH   T S
Sbjct: 776  -DGDLTTDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSS 834

Query: 810  SIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAIEFSRQGVIELSAI 869
             I Y+Y L+ G RG        E   N++      TP G+      + FSRQG I LS I
Sbjct: 835  MIEYIYSLVMGNRG--------EKLANEE------TPFGK------LPFSRQGDIVLSEI 874

Query: 870  EKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEEFFSATSRKAEMSGKV 929
            E KMLLQEFF           N A F +  ++      + D  EE          + G +
Sbjct: 875  EIKMLLQEFFT----------NAAIFFSKQLRES----LGDEEEEETENLGISPYIVGLM 920

Query: 930  KMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSKALGKVLDL 989
            ++VCF+++ ++ ++ F+F    DY++EL+  LM W     EA  ++  L+S+        
Sbjct: 921  RLVCFMVKSLIQEEMFDF-KDPDYIFELETLLMSWICILPEARDLFFALRSRV------- 972

Query: 990  GTEGLDDRPNTDPDDQLLPVDFDKLKLSDI-----DDRWDTETDTS--IENGDKTSIMSE 1042
                  D+ +  P  +    D D +  + +     D R   E D S   E  +  SI ++
Sbjct: 973  ------DQQSRKPAKR----DPDAMATASVVNLSPDFRTTDENDGSSDSEETNSVSIYNK 1022

Query: 1043 RFSRMLPVQSLDGQPVDKVFRHLLQKYPLTEGTPIHGRITLEYHDHILPLDIRTHQSLHR 1102
            +   +LP             R  + K+ LT GT + GR  + + D I+ + +      +R
Sbjct: 1023 KLISLLPPVVGTENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDKDIDNR 1082

Query: 1103 EFLAVFDIDYLDILEA 1118
             FLA F IDY D ++ 
Sbjct: 1083 NFLAEFGIDYNDFVDG 1098

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score =  436 bits (1121), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 339/1156 (29%), Positives = 548/1156 (47%), Gaps = 145/1156 (12%)

Query: 14   ADSDVDESVLLEKLVIALFTTVPGQAVVTQLIN-DAKRTNDVDGVECLI----RMNDPYW 68
            A +D+D     EKLV+ LFTT PG + +         R N +   +       R++D  +
Sbjct: 43   AFTDIDAQ---EKLVLGLFTTRPGLSTLRLYYELSCGRVNLLRYKKWQQSKPQRVSDAAY 99

Query: 69   VALFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFTAPLWD 128
              +   W +    + L +   LRN+   +D   +   + K+++ FLL   DP+    + D
Sbjct: 100  KRMVKRWTSSTEHVGLLMDHFLRNDNWALDYASFYSPAHKLSVAFLL---DPETEVLVID 156

Query: 129  TS-NILLDYLHNAKPLIESVLKKLDGSQFL-QCLMKYNRLYEFNGSYQWFTPPQSTSHAE 186
               N+LLD+    + L+E +L ++D    L +C   + RL++  G Y W+T   S    +
Sbjct: 157  DEYNLLLDFALQCRALVEQLLNQIDLPSLLAKCAYGHGRLFQLCGRYVWYT--FSAEQFD 214

Query: 187  SPTTILERNSTFLSTLGNFGNDMVRAL------------SQLKTGDIRLNSLESYGKNSG 234
                I  +  + L+       D++  +            S    GD           NS 
Sbjct: 215  EAQDICYKYLSVLTDKLTAQQDLIPQIQPLFEIISSSKASHWVYGDGLFTENPESDSNSD 274

Query: 235  HNNPP---LSKQDDHNPLNLNG-----KSDRFN--------LFFKLGLHKE-PHPLLAEQ 277
             ++ P   LS Q+     +L        S+ FN        L+  L L K+   PLL+ Q
Sbjct: 275  SDHWPQKRLSAQERVYSFDLKDDGTLEASNVFNRTRRRHQALYQVLNLQKQNTAPLLSSQ 334

Query: 278  FNSLCLFADPMTQPPPNXXXXXXXXXXXXXXXXXXTAYIVKLIPNYQKVWKIHLSANLET 337
            F +LC   DP+TQP PN                   + I +L  +    W+ H+  NL+ 
Sbjct: 335  FFTLCALVDPVTQPTPNDSHIVSIDLLSDMFLGLLYSEINELHID----WRFHVCFNLQK 390

Query: 338  ITLAILQMLQIWDYRSLDNLKDIQARSPDA--YPKYMTSWIPYDLSPPEMEILYMIAGLS 395
            I  A L  L   D++ L+++ +    S D+  + + +  W+P  L+  ++E++YMI  L+
Sbjct: 391  IVQATLPRLNCHDFQRLNSVNN----SDDSIDWRRNLHKWLPQGLNTQDLELIYMIDILA 446

Query: 396  FYSMHKMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIR 455
             Y +HK++ D P ++NPFL  M+  W+ L+  ++LGL+IDRFEE Q  + TPV+V A IR
Sbjct: 447  IYIIHKLYRDLPAQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIR 506

Query: 456  GASALRSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSG 515
            G+SALRS++ATILNGHV+ K HDF+H+P   FMSPHGRKLC+GALYT    + AA+L  G
Sbjct: 507  GSSALRSVVATILNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALG 566

Query: 516  MDYDEIVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKN 575
            ++ +++  LL+D+Q GDR DEDV+YMFDYEY +YN+ DT +L + +L    +      + 
Sbjct: 567  IELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVDTEELDEDELEDVES------RE 620

Query: 576  RFRMLRGLYKRCLCKFSXXXXXXXXXXXXXXXXYNGEKSVVGLDENG-------QINEAE 628
            R + +R  YKRC C+F                  + ++ +   +E+G       ++    
Sbjct: 621  RIKEMRAYYKRCHCQF------------------DDDELLPEDEEDGRPDASPYRVTRDA 662

Query: 629  TPQTFSESSNAVAFTSLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFL 688
             P    + SN     +L + +DS           +D NG DWR IPRGLN Y+ ++Y+F 
Sbjct: 663  PPDNNVKLSNTSKPMALRSQKDS---------VEFDFNGRDWRGIPRGLNFYFNENYEFE 713

Query: 689  SKLDKVSLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILLK---LITATSAEVDL 745
              L       L+    ++ +   +   +LR IATCV  EQE  +L+   L+  T    + 
Sbjct: 714  KHLSSGQAHSLMCNAAEKKLPLEEGTQLLRVIATCVAKEQELTVLRSALLLGETPESENH 773

Query: 746  KVLPFSTDEVITAIFND--DGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTH 803
              L    D     ++    +  + +   F   N++L W++ DE++M  G+RR+LI+ +TH
Sbjct: 774  STLVADGDLTTDFVYEKWCENSMFEKILFH--NETLVWRMMDEMLMCSGYRRVLIWFITH 831

Query: 804  RSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAIEFSRQGV 863
               + S I Y+Y L+ G RG  A S                   G++   A + FSRQG 
Sbjct: 832  LEVSNSMIEYIYTLVLGNRGEKAAS------------------DGDY---AKVPFSRQGA 870

Query: 864  IELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNP-SKVYVDDYGEEFFSATSRK 922
            I LS IE KMLLQEFF           N A F +  ++        D+   +    +   
Sbjct: 871  IVLSDIEIKMLLQEFFT----------NAAIFFSKQLRESLGDGEDDEDQGDDEKGSGIS 920

Query: 923  AEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSKA 982
              + G +K+VC++++ ++  + F+F    DY++EL+  LM W     EA  ++  L+S  
Sbjct: 921  PHVVGLMKLVCYMVKSLMQKEMFDF-KDPDYIFELQTLLMSWICILPEARDLFFALRSLV 979

Query: 983  LGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWDTETDTSIENGDKTSIMSE 1042
              +  ++  E        +PD Q  P      +L        T  +   E     SI ++
Sbjct: 980  DEQSQNIKLESESIASACEPDSQSEP------QLPQ-----GTHAELEPEATHAVSIYNK 1028

Query: 1043 RFSRMLPVQSLDGQPVDKVFRHLLQKYPLTEGTPIHGRITLEYHDHILPLDIRTHQSLHR 1102
            +   +LP  +          R  + K+ LT  T + GR  +   D I+P+ +   +  +R
Sbjct: 1029 KLMSLLPPAAGTENSAITALRSFISKHSLTTKTALFGRRVISQDDTIMPMYMSDREMDNR 1088

Query: 1103 EFLAVFDIDYLDILEA 1118
            +FLA F IDY D ++ 
Sbjct: 1089 QFLAEFGIDYNDFVDG 1104

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON}
           Anc_3.497 YGR134W
          Length = 1077

 Score =  412 bits (1060), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 306/987 (31%), Positives = 473/987 (47%), Gaps = 104/987 (10%)

Query: 21  SVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECLIRMNDPYWVALFGTWATDKH 80
           S++ E L+IALFTT  G +++      AKR     G   L              W  D+ 
Sbjct: 48  SLICETLIIALFTTRAGISLLPLFSESAKRKRV--GPRVL-------------EWHNDEE 92

Query: 81  ILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFTAPLWDTSNILLDYLHNA 140
           ++  F  ++L N +  I+   +    +K+ + FL+ ++    +  L    N+LLDY+H  
Sbjct: 93  LMLRFFSYILENRSSRIEPRLFEKARWKLPLFFLIESKFLAASMVLDQNYNLLLDYVHTI 152

Query: 141 KPLIESVLKKL--DGSQFLQCLMKYNRLYEFNGSYQW--FTPPQSTSHAESPTTILERNS 196
            P+I+  + +    G+ F   ++ YNR+YE   S +W  F   +S     +    L  NS
Sbjct: 153 TPMIKRWVHRAFTQGTFFKDTVVCYNRVYELKDSSEWYSFGTKKSNEERRAIQQFLRENS 212

Query: 197 TFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGHNNPPLSKQDDHNPLNL----- 251
                L  + ++MVR  ++    D    +   + + S H N      +    L +     
Sbjct: 213 E--QVLDTY-HEMVRPSNERAIND----TASYHHRISQHENVYSFDINQDGSLEIPNIMS 265

Query: 252 --NGKSDRFNLFFKLGLHKEPHPLLAEQFNSLCLFADPMTQPPPNXXXXXXXXXXXXXXX 309
             + + D      +L L   P  LL  QF  +    DP+TQPPPN               
Sbjct: 266 HASVRHDILQNLMRLPLCDSP--LLQWQFKLMAGLVDPLTQPPPNDKHIISLDLLYQMLL 323

Query: 310 XXXTAYIVKLIPNYQKVWKIHLSANLETITLAILQMLQIWDYRSLDNLKDIQARSPD-AY 368
                 I   + +    WK HL  N++ I  A L+ L + D+   D L  I     D ++
Sbjct: 324 GLMEPAISNTLGSDGCDWKFHLCFNMQKIIQASLKRLNLQDF---DTLNSINNSDEDVSW 380

Query: 369 PKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSDKPPRLNPFLPMMLRAWRGLSSAL 428
              + SW+P+ L+   +E++YMI  L+ Y+++K++ D P +LNPFL  M+  W+ L+  +
Sbjct: 381 RDNLHSWLPHGLNTQNLELIYMIDILAVYTIYKLYEDLPVQLNPFLSPMISLWKNLTCVI 440

Query: 429 VLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIATILNGHVDEKLHDFKHQPFGGFM 488
           +LGL+IDRFEE    + TPV+V A IRGA+ALR+++ATILNGHVD   HDF H+P   FM
Sbjct: 441 LLGLEIDRFEEEHETFETPVLVRATIRGAAALRAVVATILNGHVDTYKHDFMHEPLNTFM 500

Query: 489 SPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVELLTDIQKGDRIDEDVRYMFDYEYFD 548
           SPHGRKLC GALY     + AALL  G + +++  LL D+Q GDR DEDVRYMF+YE  +
Sbjct: 501 SPHGRKLCQGALYADLRSHAAALLALGTELEDVTNLLADLQAGDRFDEDVRYMFEYECDN 560

Query: 549 YNDADTSKLTDGKLMFTSTKNELEQKNRFRMLRGLYKRCLCKFSXXXXXXXXXXXXXXXX 608
           YN+ D+    DGKL     K              L +RC C F                 
Sbjct: 561 YNEGDSESEKDGKLAVEQPK-------------ILQRRCNCIFDDDEMAEDEDFDGENDE 607

Query: 609 YNGEKSVVGLDENGQINEAETPQTFSESSNAVAFTSLMTHRDSQNDFVSHLTTGYDKNGD 668
               K ++ L +N Q     T  + S S    A  S                  +D +G 
Sbjct: 608 AFFSKHLI-LQQNAQ-----TSLSMSSSGKPRAVRSGGAFE-------------FDYSGK 648

Query: 669 DWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQ 728
           DWRDIPRG N YY  D++F+      SL  L ++     +   ++ T+LRS+A+CVK EQ
Sbjct: 649 DWRDIPRGSNFYYSPDFEFIESPSLSSLLALTKKASSEKLVEKESLTLLRSVASCVKNEQ 708

Query: 729 EQILLKLITATSAEVDLKVLPFSTDEV----ITAIFNDDGGIIKPFPFSGCNDSLGWKIF 784
           ++I L  +     +        + D++    I  ++ ++    K   F   N +L WK+ 
Sbjct: 709 DEITLGNLIDPHQDSQADEESRNADKIEPDDIYEMWCENSTFEKIVYF---NHTLAWKLM 765

Query: 785 DELMMSHGHRRLLIYHLTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSW 844
           DE+++  G+RR+LI+ +TH     S IHY++EL+ GLRGN        S +N +   L+ 
Sbjct: 766 DEMLLCIGYRRVLIWFITHMELNHSLIHYIFELVMGLRGN--------SDENDRDVDLAG 817

Query: 845 TPTGEFERVA---AIEFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIK 901
            P  + ++V    ++ FSRQG ++LS IE KMLLQEFF           N A F +   +
Sbjct: 818 PPLQDVDKVKGELSVGFSRQGALQLSTIETKMLLQEFFT----------NAAIFISKKSE 867

Query: 902 NPSKVYVDDYGEEFFSATSRKAEMS----GKVKMVCFILEEVLNDKEFEFVPHEDYVYEL 957
             + +  ++   E          +S    G +K++CF++   +N ++F+F   E  V+EL
Sbjct: 868 ESTDIANEEQNNENRDLNGNSENVSLYAMGLMKLICFMVRTFINKEKFDFSESE-CVFEL 926

Query: 958 KRFLMQWSTFSAEACSMYALLKSKALG 984
           +  LM W     EA +++  LKS   G
Sbjct: 927 QALLMNWIGIIPEAKTLFFELKSLIAG 953

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
            Anc_3.497
          Length = 1150

 Score =  410 bits (1055), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 310/1148 (27%), Positives = 538/1148 (46%), Gaps = 137/1148 (11%)

Query: 19   DESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDV--DGVECLIRMNDPYWVA---LFG 73
            + S+L+E ++I   +T  G+ + + L ND  + +    +  +  +   D    A   L  
Sbjct: 68   EHSLLVECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRK 127

Query: 74   TWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLL---TNQDPKFTAPLWDTS 130
             W+++K     F  ++L N   +I++++Y++  +K+ + FL    TN  P F   L +  
Sbjct: 128  KWSSNKLYFLKFTKFLLVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFI--LDNKY 185

Query: 131  NILLDYLHNAKPLIESVLK-KLDGSQFLQCLMKYNRLYEFNGSYQWFT--PPQSTSHAES 187
            N+L DY++   PL++ V+K  L+    L     Y    +    Y W+   PP    H  +
Sbjct: 186  NLLQDYIYACGPLLKCVMKDTLENGICLDLPGIYKLDIDLQFPYPWYDLLPPMHEGHLNA 245

Query: 188  PTTILERNSTFLSTLGNFGNDMVRALSQLKTG-DIRLNS-----LESYGKNSGHNNPPLS 241
                   N+  L+   +   +   A +  +T     LN+     L++   ++   +  L+
Sbjct: 246  TKQNNNSNNIPLTMQPSIKTNNNGANNNNQTVYSFDLNTDKTFELDNVVSHTAKRHRVLN 305

Query: 242  KQDDHNPLNLNGKSDRFNLFFKLGLHKEPHPLLAEQFNSLCLFADPMTQPPPNXXXXXXX 301
            +  ++N L                   +  PLL  QF  +    DP++QPPPN       
Sbjct: 306  QLINNNDL-------------------KTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISL 346

Query: 302  XXXXXXXXXXXTAYIVKLIPNYQKV--------WKIHLSANLETITLAILQMLQIWDYRS 353
                       + +I  + PN ++         WK H+  N+  +    + +L+  ++  
Sbjct: 347  HLLY-------SMFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILKCDNFNK 399

Query: 354  LDNL--------KDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSD 405
            L+++        +  +    DA+   +  WIP+ ++  ++E++YMI  ++ Y++++++SD
Sbjct: 400  LNDIINSNNDNDEGTENDDDDAWKLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSD 459

Query: 406  KPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIA 465
             P ++NPFL  ++  W+ LS+ ++LGL IDR EE +  + TP++V A IRGA++LR+++A
Sbjct: 460  LPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVA 519

Query: 466  TILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVELL 525
            TILN HVD   HDFKH+P   FMSPHGRKLC GALY     + AA+L  G + +++ +LL
Sbjct: 520  TILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADIRSHAAAILALGAELEDVTDLL 579

Query: 526  TDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNRFRMLRGLYK 585
            TD+Q GDR DED+RYMFDYEY DYND                K+++E++    ++    +
Sbjct: 580  TDLQAGDRFDEDIRYMFDYEYDDYNDF---------------KDDVEEQEEMEIMGSFPR 624

Query: 586  RCLCKFSXXXXXXXXXXXXXXXXYNGEKSVVGLDENGQINEAETPQTFSESSNAVAFTSL 645
            RC C F                  + +       +  +    +TP      +N     ++
Sbjct: 625  RCNCIFEDDNIINDDTDNINENDEDDDDEQEEYVDAIEGVTKDTPH-----NNLNPHDAI 679

Query: 646  MTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRLPD 705
             T     N   S  +  +D  G DWRDIPRG NLYY   Y F+      ++  L  +  +
Sbjct: 680  RTRNSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATN 739

Query: 706  RNVTFSQACTVLRSIATCVKLEQEQILLKLI-----------TATSAEVDLKVLPFSTDE 754
              +T   +  ++ ++A+C+KLEQ++++ K +                + D K+   +T +
Sbjct: 740  EKLTTEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPHAAENEDDADFKI---ATPD 796

Query: 755  VITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTHRSYTFSSIHYV 814
             I  +++++    +       N  + W++ DE++M +G+RR+LI+ +TH     S I Y+
Sbjct: 797  DIYDMWSEESKFERMLYL---NQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYI 853

Query: 815  YELLFGLRGNP-ARSYDLESTKNKQLGILSWTPTGEFERVAAIE---FSRQGVIELSAIE 870
            +EL+ GLRG+P +   D   +KN  L  + +      E V ++    FSRQG + LS IE
Sbjct: 854  FELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIE 913

Query: 871  KKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEEFFSATSRKAEMSGKVK 930
             KMLLQEFF   +     + N+ G    +  N +   +D+       A +     +G VK
Sbjct: 914  NKMLLQEFFTNAAIYFSSKSNNEG----TTNNDNGEGIDE------EAVNFSVYSTGLVK 963

Query: 931  MVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSKALGKVLDLG 990
            ++CF+++ ++ + +F+F   E   +EL+  LM W     EA  ++  LKS         G
Sbjct: 964  LICFMVQSLMENNKFDFAKSE-CTFELQTLLMNWIGIIPEAEDLFFTLKSGVSSSSTKTG 1022

Query: 991  TEGLDDRPNTDPDDQLLPVDFDKLKLSDIDD-------RWDTETDTSIENGDKTSIMSER 1043
             E  DD  NT  D+         L  SD  D       R+DT+     E     SI ++R
Sbjct: 1023 RES-DDHDNTHADN---------LSFSDDGDTGHPGISRFDTDDSPPNE-----SIFNKR 1067

Query: 1044 FSRMLP--VQSLDGQPVDKVFRHLLQKYPLTEGTPIHGRITLEYHDHILPLDIRTHQSLH 1101
               +LP  +   D        RH +++Y   E  P++GR  +   + +LPL         
Sbjct: 1068 LVSLLPKRINDKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISF 1127

Query: 1102 REFLAVFD 1109
             E+L   D
Sbjct: 1128 HEYLTELD 1135

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score =  397 bits (1019), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 316/1124 (28%), Positives = 532/1124 (47%), Gaps = 169/1124 (15%)

Query: 21   SVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECLIRMNDPYWVALFG------- 73
            SVLLE LVI+LFTT  G ++++ L       N+ D    L +  + +  +  G       
Sbjct: 51   SVLLEGLVISLFTTKSGHSILSVL-------NNPDANSELFQRYNSWLESSSGDLNYKYL 103

Query: 74   ---TWATDK-HILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFTAPL-WD 128
                W +++ + LS F  ++L+NE     L  Y    +K+ ++ L+ ++    +  L  D
Sbjct: 104  KHELWQSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRLINSESNIISLILNSD 163

Query: 129  TSNILLDYLHNAKPLIESVLKKL-DGSQFLQCLMKYNRLYEFNGSYQWFTPPQSTSHAES 187
              N+LLD++   +P +  ++  + +G++F + + KYNR+YE NG + W+T   +     S
Sbjct: 164  NYNLLLDFIMFFQPYMNDLISYIVEGNKFFEIIAKYNRIYELNGFHTWYTLTIA-----S 218

Query: 188  PTTILERNSTFLSTLGNFGNDMVR---ALSQLKTGDIRLNSLESYGKNSGHNNPPLSKQD 244
             T+I  R          + ND++     ++   T + R  + +   +    +    +K D
Sbjct: 219  NTSIAVR----------YLNDVLSIDPMITDQFTSNYRDKAFQESEETLLMSQQQTAKDD 268

Query: 245  DHNPLNLNGKSDRFNL-----------FFKLGLHKEPHPLLAEQFNSLCLFADPMTQPPP 293
                 +LN   D  NL           +  L L++   P L +QF  +C   DP+TQP P
Sbjct: 269  IIFSFDLNETGDLPNLIKHSEMRHQIIYDILNLNQIDSPFLKKQFLLICGLVDPLTQPQP 328

Query: 294  NXXXXXXXXXXXXXXXXXXTAYIV-KLIPNYQKVWKIHLSANLETITLAILQMLQIWDYR 352
            N                    +   +L    +++    +  N++ I    L +L   DY 
Sbjct: 329  NNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLNCNDY- 387

Query: 353  SLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSDKPPRLNP 412
              D L  I    P+ Y   +  W+P+ ++  ++E++YMI  ++ Y+++K++S+ P +LNP
Sbjct: 388  --DTLSTILNDFPNDYKTALNKWLPHGINTQDLELIYMINIIAIYTIYKLYSNLPIQLNP 445

Query: 413  FLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIATILNGHV 472
            FL  ++  W+ LS  +++GL+IDR EE    Y TP+IV A IRGA+ALR++IATILN HV
Sbjct: 446  FLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILNDHV 505

Query: 473  DEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSG-MDYDEIVELLTDIQKG 531
              K HDFKH+ F  FMSPHGRKLC+GAL      + AA+L  G  +  ++ ELL D+Q G
Sbjct: 506  STKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADLQAG 565

Query: 532  DRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNRFRMLRGLYKRCLCKF 591
            DR DEDV+Y+F+YEY DYN+                 NELE+  +  + +   +RC C F
Sbjct: 566  DRFDEDVKYIFEYEYQDYNELGEED---------EQTNELEELEKRSVKK---RRCNCIF 613

Query: 592  SXXXXXXXXXXXXXXXXYNGEKSVVGLDENGQINEAETPQTFSESSNAVAFTSLMTHRDS 651
                                       +++  + + E  +  +ES       +L + +  
Sbjct: 614  ---------------------------EDDKMLEDYEYYEVGNESRREDM--NLESDKSR 644

Query: 652  QNDFVSHLTT--GYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRLPDRNVT 709
             N +   + +   +D +G DWRD+PRG NLYY   Y+F+      ++     +     ++
Sbjct: 645  TNPYSVRVNSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTEKLS 704

Query: 710  FSQACTVLRSIATCVKLEQEQILLKLIT-----ATSAEVDLKVLPFSTDEVITAIFNDDG 764
               +  +L+S+A+CVKLEQE+++L+  +     +T  ++D +V P    + +  I+ ++ 
Sbjct: 705  DEDSLLLLQSVASCVKLEQEKMILENYSNTKNCSTEEDLDREVTP----DDVYEIWCEES 760

Query: 765  GIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTHRSYTFSSIHYVYELLFGLRGN 824
               +       N  + W++ DE++M +G+RR+L++ +TH     S +HY++EL+ GLRG 
Sbjct: 761  AFERMIYL---NKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQ 817

Query: 825  PARSYDLESTKNKQLGILS-WTPTGEFERVAAIEFSRQGVIELSAIEKKMLLQEFFVGVS 883
               S +    + K L +    T     E+V    FSRQG I LS IE KMLLQEFF    
Sbjct: 818  RDDSRNPGDDRLKSLLLQDMMTDKKGSEKVP---FSRQGSIILSEIETKMLLQEFFT--- 871

Query: 884  SGLLGEYNDAGFEAFSIKNPSKVYVDDYGEEFFSATSRKAEMSGKVKMVCFILEEVLNDK 943
                   N A F  FS  + + +  +D       A        G VK++CF+++ ++N+ 
Sbjct: 872  -------NAAIF--FSTNDTANMSSNDSENVSLYAI-------GLVKLICFMVKTLMNND 915

Query: 944  EFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSKALGKVLDLGTEGLDDRPNTDPD 1003
            +F+F   E   +EL+  LM W     EA  ++  LK+       ++G   ++ + ++D  
Sbjct: 916  KFDFSKSE-CTFELQTLLMNWIGIIPEAQELFFTLKA-------NVGEPSMEGKSDSDGT 967

Query: 1004 DQLLPVDFDKLKLSDIDDRWDTETDTSIENGDKTSIMSERFSRMLPVQSLDG--QPVDKV 1061
            D                            N  + S  + +   +LP  +  G   P  + 
Sbjct: 968  DS---------------------------NEGELSWYNSKLLALLPSPTNSGLENPAIET 1000

Query: 1062 FRHLLQKYPLTEGTPIHGRITLEYHDHILPLDIRTHQSLHREFL 1105
             R  L+KY  T   P+ GR  +   D ILP+       L RE +
Sbjct: 1001 LRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQPILLRELI 1044

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score =  395 bits (1016), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 313/1137 (27%), Positives = 537/1137 (47%), Gaps = 120/1137 (10%)

Query: 15   DSDVDESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECLIRMNDPYWVA---- 70
            D  +  S+LLE +++AL TT  G +V+  L    K +     +   I  N   W+A    
Sbjct: 80   DPQLKYSLLLEMVIVALLTTRAGLSVLALL----KPSGSNPSIPKCIS-NQRKWLAQVER 134

Query: 71   -------LFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFT 123
                   L   W +D  I   FL ++L+NE   +  E  +   +K+ + FL+ ++     
Sbjct: 135  KGKLHSDLISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQSKYRAAE 194

Query: 124  APLWDTSNILLDYLHNAKPLIESVLKKL----DGSQFLQCLMKYNRLYEFNGSYQWFT-P 178
              L  + N+L+DY     PL E  L++     +G    + ++ YNR+Y+F+G + W+T  
Sbjct: 195  LILDPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNRVYDFSGYFTWYTLQ 254

Query: 179  PQSTSHAESPTTIL-------ERNSTFLSTL-GNFGNDMVRALSQLKT------------ 218
             + ++H      IL       ++    +S +  N   + ++ + Q+++            
Sbjct: 255  TRGSNHPFVSQQILFDLIDSDDKEIEAVSQIESNDQEERIQIIDQIRSAIQDISSASLNS 314

Query: 219  ---GDIRLNSLESYGKNSGHNNPPLSKQDDHNPLNLNGKSDRFNLFFK-----------L 264
               GD   ++LE Y  N  H+    ++Q     LN +G  +  NL              L
Sbjct: 315  GFYGDEDRSALEEYSDNY-HHQVNQNEQVFSFDLNQDGSLELPNLMSHAAVRHEILMKVL 373

Query: 265  GLHKEPHPLLAEQFNSLCLFADPMTQPPPNXXXXXXXXXXXXXXXXXXTAYIVKLIPNYQ 324
             L+    PLL  QF  +    DP+TQP PN                  T  I + +   +
Sbjct: 374  KLNNSSSPLLQLQFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEE 433

Query: 325  KV-WKIHLSANLETITLAILQMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYDLSPP 383
               W+ H+  N++ I  A L  L   D+  L+++ +  +     +   +  W+P+  +  
Sbjct: 434  GCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINN--SDDNVDWRSQLDKWLPHGFNTQ 491

Query: 384  EMEILYMIAGLSFYSMHKMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQML 443
            ++E++ M+  ++ Y+++K++   P +LNPFL  ++  W+ L+  ++LGL+IDR EE    
Sbjct: 492  DLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELET 551

Query: 444  YGTPVIVSAVIRGASALRSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTY 503
            + TP++V A IRGA+ALR+I+AT+LNGHV+   HD KH+    FMSPHGRKLC GALY  
Sbjct: 552  FDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYAE 611

Query: 504  EMYYFAALLPSGMDYDEIVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLM 563
               + AALL  G + +++  L +D+Q GDR DEDVRYMF+YE+ DYND  + +       
Sbjct: 612  LRSHAAALLALGSELEDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREEDYSGF- 670

Query: 564  FTSTKNELEQKNRFRMLRGLYKRCLCKFSXXXXXXXXXXXXXXXXYNGEKSVVGLDENGQ 623
                 ++    ++    +G  +RC C F                 +   K ++       
Sbjct: 671  --DKYDDYTDSSKTHARKGFGRRCNCIFDDDEMLEDEDYENEYEGHKAPKQIL------- 721

Query: 624  INEAETPQTFSESSNAVAFTSLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMD 683
                  PQ    +S +++ T       S   F       +D +G DWRDIPR  NLYY  
Sbjct: 722  ------PQQNPTTSVSMSTTGKPHAIRSGGSF------EFDYSGKDWRDIPRMSNLYYSP 769

Query: 684  DYQFLSKLDKVSLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILLKLIT------ 737
            +Y F+  LD  ++  L  +   ++++  ++  +L S+ATCVK EQ++I+L  IT      
Sbjct: 770  NYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNITELHHQN 829

Query: 738  -ATSAEVDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRL 796
             +  ++V  K+   S D+ I  ++  D    K      CN  + W++ DE++M  G RR+
Sbjct: 830  GSRGSQVIDKLKDISPDD-IYEMWCKDSTFEK---MVYCNHEVAWRLMDEMLMCSGFRRV 885

Query: 797  LIYHLTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAI 856
            LI+ +TH     S IHY++EL+ GLR    +S+D  +  +     +S       E   ++
Sbjct: 886  LIWFITHMELNHSLIHYIFELVMGLR----KSFDENNENDNGDESISEMTKEAPEVRTSL 941

Query: 857  EFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEEFF 916
             FSRQG I+LS+IE KMLLQEFF   ++  L E +        +++ + +   + G    
Sbjct: 942  PFSRQGSIQLSSIETKMLLQEFFTN-AAIFLTEKSKEWIGEEPMEDEATINDGENGNVSL 1000

Query: 917  SATSRKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYA 976
             A        G +K++C ++   +   +F+F   E  V+EL+  LM W     EA  ++ 
Sbjct: 1001 YAV-------GLMKLICLMVRAFIKKGKFDFRESE-CVFELQTLLMNWIAIIPEAKDLFF 1052

Query: 977  LLKSKALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWDTETDTSIENGDK 1036
             LK+     V ++ ++ +DD   ++      P D +K KLS + +  +   + ++++   
Sbjct: 1053 ELKA----LVAEVHSDPMDDEELSNN-----PPDSNK-KLSSMVENDNINGNEAVDSEYN 1102

Query: 1037 TSIMSERFSRMLPVQSLDGQPVDKV-FRHLLQKYPLTEGTPIHGRITLEYHDHILPL 1092
              ++    S + PV     +    V  R+ ++KY      P+ GR  +   + ILPL
Sbjct: 1103 RKLI----SLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEILPL 1155

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score =  393 bits (1010), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 324/1140 (28%), Positives = 528/1140 (46%), Gaps = 134/1140 (11%)

Query: 4    EKSSVQRLFLADSDVDESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECLIRM 63
            EK       L D ++   +L E L + LFTT  G++++  +   A  + +    E     
Sbjct: 53   EKLLYDETILNDQEIRFPLLFEALSVTLFTTKSGKSILQTM--KASTSKERKAWEKSFEN 110

Query: 64   NDPYWVALFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFT 123
            +D  + ++  +W  D  +L  FL ++L N+T  + ++RY+   +K+ + FL+ ++    +
Sbjct: 111  HDSNYASIIRSWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPS 170

Query: 124  APLWDTSNILLDYLHNAKPLIESVL---KKLDGSQ--FLQCLMKYNRLYEFNGSYQWFTP 178
              L +  N+L DYL+     +E ++      D S   F   L +Y+R+ EF   Y W+  
Sbjct: 171  IILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWY-- 228

Query: 179  PQSTSHAESPTTILERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGHNNP 238
              S S  ++ T  L  N   ++ L +   D +  +S          S++  GK+  H   
Sbjct: 229  --SFSAEKNATPKLNHN---INLLMDSYEDNLDGVS----------SVDDAGKSDNHQKQ 273

Query: 239  P--------LSKQDDHNPLNLNGKSD------------RFNLFFK-LGLHKEPHPLLAEQ 277
            P        ++ Q+      LN                R  L FK L L     PLL +Q
Sbjct: 274  PKDTIIHRTVNDQEQIYSFELNQDGTLQIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQ 333

Query: 278  FNSLCLFADPMTQPPPNXXXXXXXXXXXXXXXXXXTAYI-VKLIPNYQKVWKIHLSANLE 336
            F++LC   DP+TQP PN                     I      N    WK ++  N++
Sbjct: 334  FSTLCGLVDPLTQPTPNDKHIISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQ 393

Query: 337  TITLAILQMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSF 396
             I  A +  L  + +  L+++ +        +   +  W+P+ L+  ++E+LYMI  L+ 
Sbjct: 394  KIIDATMLRLNCFGFEKLNSINNTDDTV--HWRTQLHIWLPHGLNTQDLELLYMIDILAV 451

Query: 397  YSMHKMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRG 456
            Y+++K++ + P +LNPFL  +L  W+ LS  ++L L+IDR EE +  Y TP++V A IRG
Sbjct: 452  YTIYKLYEEIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEEKGTYETPLMVRATIRG 511

Query: 457  ASALRSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGM 516
            A+ALRS+IA +LNG V    HDFKH+    FMSP+GRKLC+GALY     + A+LL  G 
Sbjct: 512  AAALRSVIAAVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGA 571

Query: 517  DYDEIVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNR 576
              +++ +L  D+Q GDR DED+RYMFDYE  DYN++  S   D +L       E   K +
Sbjct: 572  SIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNES-FSDCGDEELGEGVNSGE---KTK 627

Query: 577  FRMLRGLY-KRCLCKFSXXXXXXXXXXXXXXXXYNGEKSVVGLDENGQINEAETPQTFSE 635
              +  G Y +RC C F                  N +K V     N   N          
Sbjct: 628  TSIHNGFYQRRCNCIF------------------NDDKLVAEDGANASTNNDSIKNEIRS 669

Query: 636  SSNAVAFTSLMTHRDSQNDF-----VSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSK 690
              NA + T++     + +        S  T  +D +G+DWRD+P+  N+YY   Y F+ +
Sbjct: 670  DGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYYSPSYSFIQE 729

Query: 691  LDKVSLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILLKLITA------------ 738
                 +F L  R     ++  ++  ++RS+A+CVK EQ+Q++L  + +            
Sbjct: 730  PKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFTSIGENFEGG 789

Query: 739  ----TSAEVDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHR 794
                TS + + + L  +T + I  I++++    +       N  + W++ DE++M  G+R
Sbjct: 790  DTGITSDKTNDEELRRTTPDDIYEIWSEESAFERML---YVNHDVAWRLMDEMLMCTGYR 846

Query: 795  RLLIYHLTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVA 854
            R+LI+ LTH     S I+YV+EL+ GLRGNP      +  +   +         + E  +
Sbjct: 847  RILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILKKKQKNENTS 906

Query: 855  AIEFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEE 914
             + FSRQG I LS IE KMLLQEFF+          N A F   S KN      ++ GE+
Sbjct: 907  GLPFSRQGPIVLSDIETKMLLQEFFM----------NAAIF--LSSKN-----TEEEGED 949

Query: 915  FFSATSRKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSM 974
               A        G VK++C++++ ++ + +F F   E   +EL+  LM W     EA  +
Sbjct: 950  ---ADKVSLYSLGLVKLICYMVQTLIANDKFFFTKSE-CTFELQTLLMTWIGILPEAKDL 1005

Query: 975  YALLKSKALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWDTET-----DT 1029
            +  +KS+     L +  +G+ D      D   L +D  K   +    + + +        
Sbjct: 1006 FFQIKSR-----LAMEEDGITDNTVQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSN 1060

Query: 1030 SIENGDKTSIMSERFSRMLPVQSLDGQ---PVDKVFRHLLQKYPLTEG---TPIHGRITL 1083
              EN D ++I + R    +   S D Q   P  +V  H  +  PL +     P+H  ITL
Sbjct: 1061 PTENDDNSAISTLR--SFITDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYITL 1118

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score =  362 bits (929), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 301/1040 (28%), Positives = 496/1040 (47%), Gaps = 91/1040 (8%)

Query: 4    EKSSVQRLFLADSDVDESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECLIRM 63
            EK         D  +  ++LLE L+I LFTT+ G++ + +LI  +         +     
Sbjct: 51   EKILYNETMFNDQKICSNLLLEALIITLFTTISGKSAL-RLIQTSSLKERKSWAQSF-EN 108

Query: 64   NDPYWVALFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFT 123
            N   + ++  +W  +  +L  FL ++L N+T  + + RY+   +K+ + FL+ +   K T
Sbjct: 109  NSSSYASIVLSWKDNDILLLKFLRFLLANKTAPLQINRYNLPEYKLPLSFLIVS---KIT 165

Query: 124  AP---LWDTSNILLDYLHNAKPLIESVLK---KLDGSQFL--QCLMKYNRLYEFNGSYQW 175
             P   L +T N+L DYL++    IES++      D    +  + L  YNR+ E    Y W
Sbjct: 166  IPSILLNETYNLLKDYLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFW 225

Query: 176  FTPPQSTSHAESPTTILERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGH 235
            ++      +AE+   +   ++  L    + GN    A S L   D R +  +   +    
Sbjct: 226  YS-----FNAENRVNLTFSDNISLLMENDEGN----AGSGL--DDSRFDHQKQPREAIMG 274

Query: 236  NNPPLSKQDDHNPLNLNGKSD----------RFNLFFK-LGLHKEPHPLLAEQFNSLCLF 284
                  +Q     LN +G  +          R  L FK L L     PLL  QF++LC  
Sbjct: 275  RTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLCGL 334

Query: 285  ADPMTQPPPNXXXXXXXXXXXXXXXXXXTAYI-VKLIPNYQKVWKIHLSANLETITLAIL 343
             DP+ QP PN                  +  I      N    WK ++  N++ I  A +
Sbjct: 335  VDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATM 394

Query: 344  QMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMH 403
              L  +D+  L+++ +    +   +   +  W+P+ L+  ++E+LYMI  L+ Y+++K++
Sbjct: 395  LRLNCFDFDILNSVNNTD--NAVHWKTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLY 452

Query: 404  SDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSI 463
               P +LNPFL  ++  W+ LS  ++L L+IDR EE    Y TP++V A IRGA+ALRS+
Sbjct: 453  EKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSV 512

Query: 464  IATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVE 523
            IAT+LNG V    HDFKH+    FMSP+GRKLC+GALY     + A+LL  G   +++ +
Sbjct: 513  IATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTD 572

Query: 524  LLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNRFRMLRGL 583
            L  D+Q GDR DED+RYMFDYE  DY+++ +   +D   +  S  N  E+          
Sbjct: 573  LFADLQSGDRFDEDIRYMFDYECEDYDESFSE--SDHGGLDESVVNPTEKIASGSNNVFF 630

Query: 584  YKRCLCKFSXXXXXXXXXXXXXXXXYNGEKSVVGLDENGQINEAETPQTFSESSNAVAFT 643
             +RC C F+                 N E +V G   N +   A    T + S + V   
Sbjct: 631  RRRCNCIFNDDKLVAEDGANEAFGSTNSE-NVEGAMHNNR--NAVHNATTATSDHVVTSP 687

Query: 644  SLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRL 703
            + ++ R       S  T  +D +G+DWRD+PR  N+YY   Y F+ +     +F L  R 
Sbjct: 688  NPLSVR-------SRSTFEFDYSGEDWRDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLRG 740

Query: 704  PDRNVTFSQACTVLRSIATCVKLEQEQILLKLITAT----------------SAEVDLKV 747
                +   ++  ++RS+A+CV+ EQ+Q++L  + +                  +++D + 
Sbjct: 741  ATEKLNKEESILLVRSVASCVRNEQDQMILADLESNFSASINGDVEGEGNTKMSKIDNED 800

Query: 748  LPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTHRSYT 807
            L  +T + I  I++++    +       N  + W++ DE++M  G+RR+LI+ LTH    
Sbjct: 801  LRRTTPDDIYEIWSEESAFERML---NVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELK 857

Query: 808  FSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAIEFSRQGVIELS 867
             S I+YV+EL+ GLRG P      +  K   +         + E  + + FSRQG I LS
Sbjct: 858  HSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKKQKNEDASGLPFSRQGPIVLS 917

Query: 868  AIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEEFFSATSRKAEMSG 927
             IE KMLLQEFF+          N A F   S KN  +   D      +S         G
Sbjct: 918  DIETKMLLQEFFM----------NAAIF--LSSKNNEEENEDGEKISLYSL--------G 957

Query: 928  KVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSK-ALGKV 986
             V+++C++++ ++ + +F F   E   +EL+  LM W     EA  ++  +K++ A+ + 
Sbjct: 958  LVRLICYMVQTLIANDKFFFTKSE-CTFELQTLLMTWIGILPEAKDLFFKIKTRLAMEEE 1016

Query: 987  LDLGTEGLDDRPNTDPDDQL 1006
                T   + R N+D + +L
Sbjct: 1017 DSADTMQHEGRKNSDIEKKL 1036

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score =  362 bits (928), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 317/1144 (27%), Positives = 523/1144 (45%), Gaps = 143/1144 (12%)

Query: 4    EKSSVQRLFLADSDVDESVLLEKLVIALFTTVPGQAVV--TQLINDAKRTNDVDGVECLI 61
            EK       L D  V  S+L E L I LFTT  G++++   Q     KR       E   
Sbjct: 51   EKVLCDETMLNDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTSKKRKLWAQSFE--- 107

Query: 62   RMNDPYWVALFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPK 121
              N+  + ++  +W  +  +L  F+ ++L N+T  + ++RY+    K+ + FL+ ++   
Sbjct: 108  -NNNSNYASIVFSWKDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINI 166

Query: 122  FTAPLWDTSNILLDYLHNAKPLIESVL---KKLDGSQFL--QCLMKYNRLYEFNGSYQWF 176
             +  L +  N+L DYL++    IE +L    K +    +  + L  Y+R+ E    Y W+
Sbjct: 167  PSILLNEGYNLLKDYLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWY 226

Query: 177  T-PPQSTSHAESPTTILERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGH 235
                ++++H +    I    +  + +  N  N +         GD R+N+      N+ H
Sbjct: 227  YFNAENSAHLKFDDNI----ACLMGSENNTENGL---------GDSRVNN------NNYH 267

Query: 236  NNPP-------LSKQDDHNPLNLNGKSD------------RFNLFFK-LGLHKEPHPLLA 275
              P        ++ Q+      LN                R  L FK L L     PLL 
Sbjct: 268  KQPKDVVMSRTINDQEQIYSFELNHDGTLEIPNVMKHSLLRHELLFKILNLTPVSTPLLE 327

Query: 276  EQFNSLCLFADPMTQPPPNXXXXXXXXXXXXXXXXXXTAYIVKLIP-NYQKVWKIHLSAN 334
             QF++LC   DP+ QP PN                     I      N    WK +   N
Sbjct: 328  LQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGHNDHYDWKFYTCFN 387

Query: 335  LETITLAILQMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGL 394
            ++ I  A +  L  +D+  L+++ +    S   +   +  W+P+ L+  ++E+LYMI  L
Sbjct: 388  MQKIIDATMSRLNCFDFNILNSVNNTD--SSVHWRTQLHRWLPHGLNTQDLELLYMIDIL 445

Query: 395  SFYSMHKMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVI 454
            + Y+++K++   P +LNPFL  ++  W+ LS  ++L L+IDR EE    Y TP++V A I
Sbjct: 446  AVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATI 505

Query: 455  RGASALRSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPS 514
            RGA+ALRS+IATILNG V    HDFKH+    FMSP+GRKL +GALY     + A+LL  
Sbjct: 506  RGAAALRSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYADLRSHSASLLAF 565

Query: 515  GMDYDEIVELLTDIQKGDRIDEDVRYMFDYEYFDYN----DADTSKLTDGKLMFTSTKNE 570
            G   +++ +L  D+Q GDR DED+RYMFDYE  DY+    ++D   L +G     + + +
Sbjct: 566  GTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADYDESFSESDDEGLEEG---IVNAREK 622

Query: 571  LEQKNRFRMLRGLYKRCLCKFSXXXXXXX---XXXXXXXXXYNGEKSVVGLDENGQINEA 627
            ++  N   +     +RC C F+                    NGE+ V         N  
Sbjct: 623  IKSSNDNNVF--CQRRCNCIFNDDKLVAEDGLNEVFESTCNRNGERRVRN-------NID 673

Query: 628  ETPQTFSESSNAVAFTSLMTHRDSQNDFV--SHLTTGYDKNGDDWRDIPRGLNLYYMDDY 685
                T   +SN V+         S N F   +  T  +D +G+DWRD+PR  N+YY   Y
Sbjct: 674  VVSNTAITTSNHVS--------TSINPFSVRARSTFEFDYSGEDWRDVPRDFNMYYSPSY 725

Query: 686  QFLS--KLDKVSLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILLKLI------- 736
             F+   KLD +  F L  R     +   ++  ++RS+A+CVK EQ+Q++L  +       
Sbjct: 726  PFIHDPKLDVI--FNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTNLTGI 783

Query: 737  --------TATSAEVDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELM 788
                    + + ++ D + L  +T + I  I++++    +       N  + W++ DE++
Sbjct: 784  SKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERML---NVNHDVAWRLMDEML 840

Query: 789  MSHGHRRLLIYHLTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTG 848
            M  G+RR+LI+  TH     S I+YV+EL+ GLRG        +  K   +         
Sbjct: 841  MCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKKQ 900

Query: 849  EFERVAAIEFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYV 908
            + +  +++ FSRQG I LS IE KMLLQEFF+  +                      +++
Sbjct: 901  KNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAA----------------------IFL 938

Query: 909  DDYGEEFFSATSRKAEMS--GKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWST 966
                 E  +    K  +   G V+++C++++ ++ + +F F   E   +EL+  LM W  
Sbjct: 939  SSNNSEEENEDGEKISLYSLGLVRLICYMVQTLITNDKFFFTKSE-CTFELQTLLMTWIG 997

Query: 967  FSAEACSMYALLKSK-ALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWDT 1025
               EA  ++  +K++ A+ +  D GT   + R + D + +L      K            
Sbjct: 998  ILPEAKDLFFEIKTRLAMEEDNDTGTMQHEGRRSLDIEKKLNT----KPASKLNLKLLSL 1053

Query: 1026 ETDTSIENGDKTSIMSERFSRMLPVQSLDGQ---PVDKVFRHLLQKYPLTEG---TPIHG 1079
                S +NG+ ++I + R    +   S D Q   P  KV  +  +  PLT+     P+H 
Sbjct: 1054 FPSNSADNGENSAINTLR--NFITDYSFDTQVNPPGRKVVFYDGKILPLTKADKPIPLHE 1111

Query: 1080 RITL 1083
             ITL
Sbjct: 1112 YITL 1115

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score =  354 bits (909), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 316/1149 (27%), Positives = 513/1149 (44%), Gaps = 138/1149 (12%)

Query: 12   FLADSDVDESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECLIRMNDPYWVAL 71
             L D  +  S+L E L I LFTT  G++++  +     +   +      +R +D  + ++
Sbjct: 59   ILDDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLKEKKLWAQS--LRDDDSNYASV 116

Query: 72   FGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFTAPLWDTSN 131
               W  +  +   FL ++L N+T  + +++Y+   +K+ + FL+ ++    +  L +  N
Sbjct: 117  VQGWKDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHN 176

Query: 132  ILLDYLHNAKPLIESVLK--KLDGSQFL---QCLMKYNRLYEFNGSYQW--FTPPQSTSH 184
            +L DYL++    I+ +++   +     L   + L  Y+R+ EF+  Y W  F      + 
Sbjct: 177  MLKDYLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNF 236

Query: 185  AESPTTILERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGHNNPPLSKQD 244
              S    L  NS      G   +D  ++ +  K      N++     N            
Sbjct: 237  EFSDNFDLLMNSPEDHADGGVIDDRCKSDNPQKHAK---NTIIKRTINDQEQIYSFELDQ 293

Query: 245  DHN---PLNLNGKSDRFNLFFK-LGLHKEPHPLLAEQFNSLCLFADPMTQPPPNXXXXXX 300
            D     P  +     R  L FK L L     PLL  QF +LC   DP+ QP PN      
Sbjct: 294  DGTLQIPNIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVIS 353

Query: 301  XXXXXXXXXXXXTAYIVKLIP-NYQKVWKIHLSANLETITLAILQMLQIWDYRSLDNLKD 359
                           I      N    WK +   N++ I  A +  L   D+  L+++ +
Sbjct: 354  IDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNN 413

Query: 360  IQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSDKPPRLNPFLPMMLR 419
                S   +   +  W+P+ L+  ++E+LYMI  L+ Y+++K++   P +LNPFL  +L 
Sbjct: 414  TD--SVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLS 471

Query: 420  AWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIATILNGHVDEKLHDF 479
             W+ LS  ++L L+IDR EE    Y TP++V A IRGA+ALRS+IA++LNG V    HDF
Sbjct: 472  LWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDF 531

Query: 480  KHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVELLTDIQKGDRIDEDVR 539
            KH+    FMSP+GRKLC+GALY     + A+LL  G   +++ +L  D+Q GDR DED+R
Sbjct: 532  KHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIR 591

Query: 540  YMFDYEYFDYN----DADTSKLTD-----GKLMFTSTKNELEQKNRFRMLRGLY-KRCLC 589
            YMFDYE  DYN    ++D  +L +     GK+  +S+              G Y +RC C
Sbjct: 592  YMFDYECEDYNEPFSESDDEQLNEDANSRGKIKSSSSN-------------GFYQRRCNC 638

Query: 590  KFSXXXXXXXXXXXXXXXXYNGEKSVVGLDENGQINEAETPQTF-----SESSNAVAFTS 644
             F+                 +G      +  N  + E E P        + ++N+  F S
Sbjct: 639  IFNDDKLVAE----------DGTNEAFEISGNSNM-ENEMPNNVNVIPSTATTNSNRFAS 687

Query: 645  LMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRLP 704
             +     +    S  T  +D +G+DWRD+P+  N+YY   Y F+ +     +F L  R  
Sbjct: 688  SINPLSVR----SRSTFEFDYSGEDWRDVPKDFNMYYSPSYSFIQEPKLDVIFNLTLRGA 743

Query: 705  DRNVTFSQACTVLRSIATCVKLEQEQILLKLITATSAEVDLKVLPFSTDEV--------- 755
               +    +  ++ S+A+CVK EQ+Q++L  + +  AE+D      S++ +         
Sbjct: 744  TEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNFAEIDENPEAKSSNNITKTNNEELR 803

Query: 756  ------ITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTHRSYTFS 809
                  I  I++++    +       N  + W++ DE++M  G+RR+LI+ LTH     S
Sbjct: 804  RTTPDDIYEIWSEESAFERML---NVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHS 860

Query: 810  SIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAIEFSRQGVIELSAI 869
             I+YV+EL+ GLRG P      +  +   +         + E V+ + FSRQG I LS I
Sbjct: 861  LIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKKRKNEDVSGLPFSRQGPIVLSDI 920

Query: 870  EKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEEFFSATSRKAEMSGKV 929
            E KMLLQEFF+          N A F   S KN  +   D      +S         G V
Sbjct: 921  ETKMLLQEFFM----------NAAIF--LSSKNDEEENEDGEKISLYSL--------GLV 960

Query: 930  KMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSKALGKVLDL 989
            K++C++++ ++ + +F F   E   +EL+  LM W     EA  ++  +K++       L
Sbjct: 961  KLICYMVQTLIANDKFLFTKSE-CTFELQTLLMTWIGVLPEAKDLFFQIKTR-------L 1012

Query: 990  GTEGLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWDTETDTSIENGDKTSIMSERFSRML- 1048
              E   D+     DD                       D  +E    T   SE   ++L 
Sbjct: 1013 AMEEDSDKDGQQNDDN---------------------KDLEVERRPHTKSNSELNVKLLN 1051

Query: 1049 -----PVQSLDGQPVDKVFRHLLQKYPL-TEGTPIHGRITLEYHDHILPLDIRTHQSLHR 1102
                 P  + D   +    R  +  YP  T+ TP  GR  + Y   ILPL          
Sbjct: 1052 LFPSNPAGNNDNSAI-STLRSFITDYPFDTQITP-PGRKVVFYDGKILPLSKADKPIPLH 1109

Query: 1103 EFLAVFDID 1111
            E++ + +ID
Sbjct: 1110 EYITLAEID 1118

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
           complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score =  349 bits (896), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 295/1040 (28%), Positives = 484/1040 (46%), Gaps = 145/1040 (13%)

Query: 1   MLQEKSSVQRLFLADSDVDESVLLEKLVIALFTTVPGQAVVTQLIND---AKRTNDVDGV 57
           +L++++ V  L LAD +V  S + E  VIALFTT PG +++  L ++    +   D +  
Sbjct: 31  LLRDENQVLDL-LADIEVKGSFITEVTVIALFTTRPGISLLNCLTDNFGIDEDNKDFNPN 89

Query: 58  ECLIRMNDPYWVALFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTN 117
             L RM       L   W  D+ IL  FL +++ N    I+ +  +D   K+ + FL+ N
Sbjct: 90  SLLPRM-----PQLALKWMHDELILIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKN 144

Query: 118 QDPKFTAP--LWDTSNILLDYLHNAKPLIESVLK-KLDG---------SQFLQCLMKYNR 165
           +   F +   L +  +++ +YL    P +++++K  L+G         S F++ ++ Y R
Sbjct: 145 ETSDFISLNLLTNEVDVVREYLTAIWPKLKNIIKISLNGENEYIDCEDSFFVRTILSYKR 204

Query: 166 LYEFNGSYQWFTPPQSTSHAESPTTILERNSTFLSTLGNFGNDM-VRALSQLKTG----D 220
           LYE                     T+L       S++   G+D+ V+AL +  TG     
Sbjct: 205 LYE---------------------TLLHFEFYDYSSMKTNGSDIYVKALMKHLTGLSNFS 243

Query: 221 IRLNSLESYGKNSGHN---NP------PLSKQDDHNPLNLNGKSDRF------------- 258
            +L  L  Y  N+  N   NP      PLS   D   +  N ++D               
Sbjct: 244 FQLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDPDDGEVEENQETDNILQPSLLDFPDLMN 303

Query: 259 ----------NLFFKLGLHKE--PHPLLAEQFNSLCLFADPMTQPPPNXXXXXXXXXXXX 306
                      L     L K+    PLL  Q+ +L    DP+TQP PN            
Sbjct: 304 ETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDLLCN 363

Query: 307 XXXXXXTAYIVKLIPNYQKV-WKIHLSANLETITLAILQMLQIWDYRSL---DNLKDIQA 362
                   YI   + N   V W+ H+  N++ I +A L +L   D+  L   D  KD ++
Sbjct: 364 MFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTVDESKDWRS 423

Query: 363 RSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSDKPPRLNPFLPMMLRAWR 422
           +        +  W+P  L+   +E++YM   L+ Y+++K++SD P   NPFL  ++  W+
Sbjct: 424 Q--------LHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWK 475

Query: 423 GLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIATILNGHVDEKLHDFKHQ 482
            L+  ++ GLQIDR EE    + TP+IV A IRGA+ALRSI+AT+LN  ++ K HDF H+
Sbjct: 476 SLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHE 535

Query: 483 PFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVELLTDIQKGDRIDEDVRYMF 542
               FMSPHGRKLC+GALY     Y A++L  G ++ E+ +L++ +Q GD+ DEDV+YMF
Sbjct: 536 SLNTFMSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMF 595

Query: 543 DYEYFDYND--ADTSKLTDGKLMFTSTKNELEQKNRFRMLRGLYKRCLCKFSXXXXXXXX 600
           +YEY DYN+   D+S   +         N+              +RC C FS        
Sbjct: 596 EYEYEDYNEIYEDSSNENEENEEIDYAFNK--------------RRCNCIFSDDNLIEEE 641

Query: 601 XXXXXXXXYNGEKSVVGLDENGQINEAETPQTFSESSNAVAFTSLMTHRDSQNDFVSHLT 660
                         + G  E    ++  T +T    S      S      S+++F     
Sbjct: 642 EDDEEESDVEKTSDIDG--EIATKSKEHTEKTIESDSGLSNQLSKPHAVRSKSNF----- 694

Query: 661 TGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRLPDRNVTFSQACTVLRSI 720
             +D +G DWRDIPR  NLYY   Y F+ + D  ++F L  +     +T  +A  +L S+
Sbjct: 695 -EFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSEKLTKEEAALLLCSV 753

Query: 721 ATCVKLEQEQI----LLKLITATSAEVDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCN 776
           A+ VK EQ+++    LL+   +++A+        +T + I  I+ ++    +   F   N
Sbjct: 754 ASTVKNEQDRMIFGNLLEQDKSSTADEHEDTKKEATPDDIYEIWCEESAFERILHF---N 810

Query: 777 DSLGWKIFDELMMSHGHRRLLIYHLTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKN 836
             L WK+ DE++M  G+RR+LI+ +TH   + S I Y+++L+ G RG        +++KN
Sbjct: 811 PDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMMGSRGINKT----DTSKN 866

Query: 837 KQLGILSWTPTGEFERVAAIEFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFE 896
            +   ++   +       +++FSR G ++LS +E +M+LQE F   +           F 
Sbjct: 867 VKSTFITENISD--SNSNSLKFSRMGHLKLSELETRMILQELFTNAA---------IYFS 915

Query: 897 AFSIKNPSKVYVDDYGEEFFSATSRKAE-----MSGKVKMVCFILEEVLNDKEFEFVPHE 951
             + K+   +   DY  E                 G +K++C ++ +++ + +F  V   
Sbjct: 916 DKARKSNQSILTPDYSTEEEEFDEENEGGYSIYSVGLMKLICIMVSKLIENSKFN-VNES 974

Query: 952 DYVYELKRFLMQWSTFSAEA 971
           D V+EL+  LM W +   EA
Sbjct: 975 DCVFELQTLLMGWISILPEA 994

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1279

 Score =  347 bits (891), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 296/1026 (28%), Positives = 465/1026 (45%), Gaps = 158/1026 (15%)

Query: 140  AKPL----IESVLKKL---DGSQFLQCLMKYNRLYEFNGSYQWFTPPQSTSHAESPTTIL 192
            +KP+    IE +L +L   D S++     K N +   NG+ Q + P    +  +S    L
Sbjct: 320  SKPVVLWAIEEILSRLSFKDSSRY-----KKNNI---NGNGQNY-PQMERAQNQSDINYL 370

Query: 193  ERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNS--LESYGKNSGHNNPPLSKQDDHNPLN 250
             RN         + +D +  +  LK G+ ++ S  L + G  +   N  L+ +  H  LN
Sbjct: 371  NRNDG----ADEYDDDYLHRIDDLKDGEEKVYSFDLNNDGSITMPENLMLNTKKRHQILN 426

Query: 251  LNGKSDRFNLFFKLGLHKEPHPLLAEQFNSLCLFADPMTQPPPNXXXXXXXXXXXXXXXX 310
                S+ F          +  PLL  QF  +    DP++QPPPN                
Sbjct: 427  KLLNSNSF----------DSSPLLELQFKLMLGLVDPLSQPPPNDKHIISLDLLYQ---- 472

Query: 311  XXTAYIVKLIPNYQKV-------WKIHLSANLETITLAILQMLQIWDYRSLDNLKDIQAR 363
                +I  L PN++         WK H+   +  I    ++ L   D + L +L   Q  
Sbjct: 473  ---LFIAILYPNFEIFQNNLGFNWKTHVCFQMVKIINNCMEKLNCNDLQKLYDLTGFQGE 529

Query: 364  SPDA-----------------------YPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMH 400
            +                          +   +  W+P+ L+  ++E+LYM+  L+ Y++ 
Sbjct: 530  NNKEELLQQQQQQQQQQQQTDRFVDGNWRSTLEQWLPHGLNTQDLELLYMVMILASYTLQ 589

Query: 401  KMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASAL 460
            K++ + P +LNPFLP ++  W+ L+  LVLGL IDR EE    Y TP++V A IRGASAL
Sbjct: 590  KLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHETYKTPLLVKATIRGASAL 649

Query: 461  RSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDE 520
            RS++ATILN +++   HDFKH+    FMSPHGRKLCNGALY     + A+L   GMD  E
Sbjct: 650  RSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCDIKLFAASLYALGMDLIE 709

Query: 521  IVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTD-GKLMFTSTKN-ELEQKNRFR 578
            I  LL+ ++ GDR DED+ YMF+YEY DYN A      D GK + ++  N ++   N  +
Sbjct: 710  IRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHEDLGKTLKSNDDNSDIYVLNEVK 769

Query: 579  MLRGLYKRCLCKFSXXXXXXXXXXXXXXXXYNGEKSVVGLDENGQINEAETPQTFSESSN 638
            + R   +RC C F                             NG   + E  +      N
Sbjct: 770  LDR-YQRRCNCIFEDDKILQDDDDG-----------------NGDEQQGEQEEQEGTPKN 811

Query: 639  AVAFTSLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFE 698
              +F   +  R+      S  T  +D +G DWRDIPRG N+YY   Y F+      ++  
Sbjct: 812  VASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDSSLDTMIN 871

Query: 699  LLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILLK---------------LITATSAEV 743
            L  +   + +    +  +L+ +A+ +K EQ  +++K                +  +  E 
Sbjct: 872  LTSKASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKDLLKGKDQLHSNIINPLVNSKEEK 931

Query: 744  DLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTH 803
            +   +  + D++    F+ D   ++   F   N+ L W++ DE++M +G+RR+LI+++TH
Sbjct: 932  ERSTVVATPDDIFDYWFDKD-VFVEMLHF---NEELSWRLMDEMLMCNGYRRVLIWYITH 987

Query: 804  RSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAIEFSRQGV 863
                 S I Y++ELL GLRG+P  + +    KN+ L  L      +        FSRQG 
Sbjct: 988  MKLNHSLIQYIFELLMGLRGSPFANNN--ECKNELLHELML--GKKIVDNHTYPFSRQGP 1043

Query: 864  IELSAIEKKMLLQEFFVGVS----SGLLGEYNDAGFEA----FSIKNPSKVYVDDYGEEF 915
            + LS IE KMLLQEFF   +    + L     D   E      SI +      +++G   
Sbjct: 1044 LILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTEDISINSDEIENNENHGVSM 1103

Query: 916  FSATSRKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMY 975
            +S         G +K++C ++  ++ +K+F+F    D  +EL+  LM W     EA  ++
Sbjct: 1104 YSM--------GLMKLICIMVSSLIENKKFDFT-KSDCNFELQTLLMNWIGILKEAKELF 1154

Query: 976  ALLKSKALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWDTETDTSIENGD 1035
              LKS    +     T+G DD             DF+      ID R  +E++   E G 
Sbjct: 1155 FKLKSDI--EETSESTDGGDDD------------DFES-----IDSRKSSESNGKWE-GS 1194

Query: 1036 KTSIMSERFSRML----PVQS----LDGQPVDKVFRHLLQKYPLT-EGTPIHGRITLEYH 1086
            +   M++   R+L    P+ S    L+   V   FR LL+ Y  T +   + GR  +   
Sbjct: 1195 RIGKMNDFNKRLLRLLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTD 1254

Query: 1087 DHILPL 1092
            D ILPL
Sbjct: 1255 DEILPL 1260

 Score = 69.7 bits (169), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 89/164 (54%), Gaps = 19/164 (11%)

Query: 21  SVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECLIRMNDPYWVALFGTWATDKH 80
           S++LE LVIA FTT  GQ+++  L +  ++   V                L  TW  ++ 
Sbjct: 115 SIMLETLVIAYFTTKSGQSILNYLFDTKRKPPTVQNK------------ILRKTWEVNEF 162

Query: 81  ILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQ---DPKFTAPLWDTS-NILLDY 136
           +   F+ +++RN+ + I+++++++   K++++FLLT     + +  + + D++ N+L DY
Sbjct: 163 LYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDSNYNMLTDY 222

Query: 137 LHNAKPLIESVLKKL---DGSQFLQCLMKYNRLYEFNGSYQWFT 177
           L      +  ++K      G  F   +++YNR+ +FNG +QW+T
Sbjct: 223 LDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWYT 266

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  345 bits (886), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 309/1131 (27%), Positives = 504/1131 (44%), Gaps = 138/1131 (12%)

Query: 19   DESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECLIRMND--------PYWVA 70
            +++   E L IALFTT PG  ++    N         G++  I  ND        P +  
Sbjct: 112  EDNFFYELLTIALFTTKPGNKILHFFKNT--------GLDSAIEHNDSDDTLFHSPAYEH 163

Query: 71   LFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLT--NQDPKFTAPLWD 128
            L   W  +   L   L ++L+N    IDL  Y   S+K  + FLLT  N + K    L +
Sbjct: 164  LKMLWKWEDEYLHNLLQFILKNRNVDIDLGNYCKTSYKRPLTFLLTCPNNNIKHRFLLSE 223

Query: 129  TSNILLDYLHNAKPLIES----VLKKLDGSQ---FLQCLMKYNRLYEFNGSYQWFTPPQS 181
              NIL +YL+ A+  I+S     ++   G     F   L  Y+R+ E+N SY  +     
Sbjct: 224  EFNILEEYLYAAQSNIKSKIAIAIQSTIGKHMNFFTMTLHLYDRVTEYNQSYLRY----- 278

Query: 182  TSHAESPTTILERNSTFLSTLGNF----GNDMVRALSQLKTGDI-RLNSLESYGKNSGHN 236
                +    + + + + L  L  F      D + A+  L++G I ++  + S  +   + 
Sbjct: 279  -EITDDENALCQFDESLLDVLLEFERYVTTDDIEAI-LLQSGRINKVKDISSAIERGDYK 336

Query: 237  ---------NPPLSKQDDHNP------LNLNGKSD----------RFNLFFK-LGLHKEP 270
                      P   K D+         +N NG  +          R ++ F+ LGL +  
Sbjct: 337  WEQGTLRSLTPNNHKADNEEEVILSFDINENGLQEVPNIMKDSMLRHSILFEFLGLSQRN 396

Query: 271  --HPLLAEQFNSLCLFADPMTQPPPNXXXXXXXXXXXXXXXXXXTAYIVKLIPNYQKVWK 328
               P L  QF +L    DP+TQP PN                     ++K        WK
Sbjct: 397  TLAPYLEMQFKTLAGLVDPLTQPTPNDTHIISIDLLHGLYTGLVHPALIKSGKARNYDWK 456

Query: 329  IHLSANLETITLAILQMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEIL 388
                 NL  I    L+ L    Y +L+N+ + +    + + + +  WIP +L+  ++E+L
Sbjct: 457  YLCGFNLIKIVWKSLKKLHCSSYDTLNNIGNFE--EGNDWRQTLEYWIPKNLNTQDLELL 514

Query: 389  YMIAGLSFYSMHKMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPV 448
            YMI  LS Y+++K++ D+P + NPFL  +   W+ ++  + LGLQ+DR EE      TP+
Sbjct: 515  YMIDILSVYAIYKLYEDQPIQNNPFLFELFSVWKYITKIIFLGLQVDRIEEQNDSEETPL 574

Query: 449  IVSAVIRGASALRSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYF 508
            ++ A +RGASA R+ + TILN  ++   HDFKH+P   FMSPHGRKLC+G+LY       
Sbjct: 575  MIRATVRGASAFRAALTTILNRQIENNEHDFKHEPINTFMSPHGRKLCSGSLYADMRVST 634

Query: 509  AALLPSGMDYDEIVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTK 568
               + +G++ D+I  LLTD+Q GDR DEDV YMFDYEY DYN    S+  D K       
Sbjct: 635  KIFVENGVELDDITNLLTDLQPGDRFDEDVEYMFDYEYEDYNLVSDSEDMDEK------- 687

Query: 569  NELEQKNRFRMLR--GLYKRCLCKFSXXXXXXXXXXXXXXXXYNGE---KSVVGLDENGQ 623
                  N    +R   +++RC C F                  + E    ++   DEN +
Sbjct: 688  ----ADNESDGVRPAPIFRRCNCVFEDDKIMDESTIDHQSLITDMELENNAISTKDENDK 743

Query: 624  INEAETPQTFSESSNAVAFTSLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMD 683
            I     P+ F+     V   S                  ++  G DWRDIPRG NLYY  
Sbjct: 744  IKIISQPEPFT-----VRMRSFF---------------DFNYGGKDWRDIPRGENLYYNG 783

Query: 684  DYQFLSKLDKVSLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILL--KLITATSA 741
            ++ F+ +           +  +  +  S++  +++ +A+C++ EQ+++++   +     A
Sbjct: 784  EFVFVQECSSSEFASYFSKAVNSVLDISESNRLIQLVASCIREEQDRMVIYHGMSQLPLA 843

Query: 742  EVDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHL 801
              D+     + DE+   I + +      +     +  L   + DEL+M  G+RR+LI+ L
Sbjct: 844  NGDVNKSKLTVDEIYDQISSSNNFAKMLYQ----DTELACGLMDELLMIVGYRRVLIWFL 899

Query: 802  THRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAIEFSRQ 861
            TH + TF  IHY++EL+ G R   +   D     NK+      + TG+        FSR 
Sbjct: 900  THINITFPLIHYIFELVMGYRVGFSDG-DANGDNNKK------SSTGK------CGFSRL 946

Query: 862  GVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKV-YVDDYGEEFFSATS 920
            G + LS+IEK+MLLQEFF+  +  L  +     FE+    N +++   DD  +E     S
Sbjct: 947  GTVALSSIEKQMLLQEFFLNATVSLSAK----SFES----NGTEIDNYDDNADEDNEYIS 998

Query: 921  RKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKS 980
              A   G V ++C +++ ++   + + V   +Y  EL+  L+ W +   EA  ++  LK 
Sbjct: 999  SYA--VGIVTLICNMVKTLVRAGQMD-VSKSEYTVELQTLLVNWISLIPEAKELFFFLKQ 1055

Query: 981  KALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWDTETDTSIENGDKTSIM 1040
            +A    +    E +++       +   P   D + L   DD  +T   +S +N + T  +
Sbjct: 1056 EAHEFDIQDSLEPINESELQTSGNINEPAATDSIPL---DDTINTSLTSSTKNSNATDAL 1112

Query: 1041 SERFSRMLPVQSLDGQPVDKVFRHLLQKYPLTEGT-PIHGRITLEYHDHIL 1090
            S     +        Q   KV     +  PL E   PI   +  E  +H++
Sbjct: 1113 STFLETVEETSVQPPQIGRKVIYKGTKILPLPEQERPIPFHLLFERAEHLI 1163

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_3.497
            YGR134W
          Length = 1074

 Score =  336 bits (861), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 272/916 (29%), Positives = 443/916 (48%), Gaps = 132/916 (14%)

Query: 222  RLNSLESYGKNSGHNNPPLSKQDDHNPLNLNGKSDRF-NLFFKL-------GLHKEPHPL 273
            R N + S+G+     +  +   D++N ++L   ++R  N+ +K+        +  E   L
Sbjct: 255  RENMMNSFGE---FQSSAMLTNDENNSIDLMKLTERRQNILYKVLIFSKLKQIEPESFQL 311

Query: 274  LAEQFNSLCLFADPMTQPPPNXXXXXXXXXXXXXXXXXXTAYIVKLIPNYQKV-WKIHLS 332
            ++  FN +C   DP+TQP PN                    ++  LI       W+  +S
Sbjct: 312  MSLLFNRICALVDPLTQPIPNDEHVISLDLLYKIFLAMMLPHVQVLIERESSYDWRYEIS 371

Query: 333  ANLETITLAILQMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIA 392
             NL+ I       L  +D   L+ + + +      + + +  W+P+ L+P  +E+LYMI 
Sbjct: 372  NNLQKILFYAFLNLNCYDMEKLNKVDETKH-----WKEQLHLWLPHGLNPQNLELLYMIC 426

Query: 393  GLSFYSMHKMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSA 452
                Y++ K++ DKP   NPFLP +L  W+ L+  ++ GLQ+DRFEE    + TP++V A
Sbjct: 427  IFCVYAIFKLYEDKPLHFNPFLPTLLSTWKKLTYVMLYGLQVDRFEEENESFNTPIMVRA 486

Query: 453  VIRGASALRSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALL 512
             IRGASALRS++A+ILN  +D K HDF+H+P   FMSPHGRKLC GALY     Y A++L
Sbjct: 487  TIRGASALRSVVASILNNQMDGKKHDFQHEPLNTFMSPHGRKLCTGALYADLKSYTASML 546

Query: 513  PSGMDYDEIVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELE 572
              GM++ +I ELL+ +Q GD  DEDV+YMF+YEY DYN+ +  +  +        +N  E
Sbjct: 547  ACGMEFKDITELLSYLQPGDCFDEDVKYMFEYEYDDYNEPEEDESDE-----DGERNNSE 601

Query: 573  QKNRFRMLRGLYKRCLCKFSXXXXXXXXXXXXXXXXYNGEKSVVGLDENGQINEAETPQT 632
            +  +F   R   +RC C FS                   +  V+   E+G  N+A +  +
Sbjct: 602  ENIKFNFNR---RRCRCVFS-------------------DDDVL---EHGDFNDANSEYS 636

Query: 633  FS-ESSNAVAFTSLMTHRDSQNDFVSHLTTG--YDKNGDDWRDIPRGLNLYYMDDYQFLS 689
             S E+SN V    L       ND +     G  +D +G DWR +PR LN++Y  DY F+ 
Sbjct: 637  NSEENSNDVDNFVL------PNDGIDKPKNGVEFDFDGKDWRAVPRHLNMFYSFDYIFIE 690

Query: 690  KLDKVSLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQE-QILLKLITATSAEVDLKVL 748
               +V +  L+       ++  ++  +LR+IA+ +K+ Q+ +IL    +    +      
Sbjct: 691  NPLEVLIRSLISEASASALSKKKSHLLLRNIASVIKINQDSRILGSKRSPNGTDSSKSQN 750

Query: 749  PFSTDEVITAIFNDDG--GIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTHRSY 806
              ST ++I  I   D    I+K       N  LG  + DEL+M  G+RR+L++ LTH + 
Sbjct: 751  GLSTGDLIKLITAGDTFENILK------FNRELGCFLMDELLMILGYRRVLLWFLTHLTL 804

Query: 807  TFSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAIEFSRQGVIEL 866
            + + I+Y++ELL   RG  +   D E  +++    LS+T            FSRQG + L
Sbjct: 805  SHTIIYYIFELLMHHRGQVS---DTEREQSE----LSYT------------FSRQGELRL 845

Query: 867  SAIEKKMLLQEFFVGV----SSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEE-FFSATSR 921
            S +E++MLLQEFF       SS  +   +D G       + +++  D  GEE  +S  + 
Sbjct: 846  SDLEREMLLQEFFTNATMFFSSKSVLFASDTG-------DNNEINTDVDGEEGLYSLYA- 897

Query: 922  KAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSK 981
                 G +++ C ++  + ++ +F+    E  ++EL+  LM W     EA  ++  LK  
Sbjct: 898  ----VGLMRVTCIMIISLFDNADFDLSSSES-IFELQTLLMGWINIIPEAKLLFFKLKES 952

Query: 982  ALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWDTETDTSIENGDKTSIMS 1041
                       G+D     +P+            L  I++   T   T+I+   +    +
Sbjct: 953  V------KSFNGID-----NPE------------LKSIEESSTTTKKTTIDENSEQYRFN 989

Query: 1042 ERFSRMLP--VQSLDGQPVDKVFRHLLQKYPLTEGTPIHGRITLEYHDHILPL-DIRTHQ 1098
            ++  +  P      DG  + K F+  L+ Y      P  GR  +   D IL L DI    
Sbjct: 990  KKLLKTFPKSFSGDDGDILLKTFKDFLRNYSFDSEPPYIGRKVIYESDEILQLTDIEKPI 1049

Query: 1099 SLHREFLA---VFDID 1111
            SLH+ FL+   ++D+D
Sbjct: 1050 SLHK-FLSGEQLYDVD 1064

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_3.497
            YGR134W
          Length = 1307

 Score =  338 bits (866), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 329/1270 (25%), Positives = 549/1270 (43%), Gaps = 212/1270 (16%)

Query: 15   DSDVDESVLLEKLVIALFTTVPGQAVVT------QLINDAKRTNDV-------------- 54
            DS+  +S+L E L++ALFTT  G +V+          ND ++ N++              
Sbjct: 35   DSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDKQKKNNLVPTTATAAVDSKHN 94

Query: 55   --DGVECLIRMN----------------DPYWVALFGTWATDKHILSLFLGWVLRNETDH 96
              + ++  +  N                  +   L   W  DK  L  F  ++L+N    
Sbjct: 95   KDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRNDKITLLKFTKFILKNSNFP 154

Query: 97   IDLERYSDQSFKMAMRFLLTN-----QDPKFTAP----------LWDTS-NILLDYLHNA 140
            ++   + D   K+ + FLL N      D   T+           L D + N+LLDYLH +
Sbjct: 155  LNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIYNNTLLMDKNYNLLLDYLHVS 214

Query: 141  KPLIESVL-KKLDGSQFLQCLMKYNRLYEFNGSYQ--W--FTPPQSTSHAESPTTILERN 195
             PL+ S+L   LD   F   +  YN+ +E     +  W  F   + T++  + T  ++  
Sbjct: 215  TPLLISLLHTNLDPLLFNNIISSYNKSFELTNDNKCLWYDFIDSKDTTNFGTITNCIDII 274

Query: 196  STFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGHNNPPLSKQDDHNPLNLNGKS 255
            + FL       N  + A       +I  +S      ++ +    L+   D N +  +  S
Sbjct: 275  NNFLEIFDMHKNFTLNAEISNSLFNISSSSTTKSNMHNENEGADLNLLMDENSMGEHTLS 334

Query: 256  DRFNLFFKLGLHKEPHP-----------------------------LLAEQFNSLCLFAD 286
              FNLF     H   HP                             LL  QF  LC   D
Sbjct: 335  --FNLFENNINHGILHPDLMAHISKRHDILAKILNVGDNDKYYNSPLLHLQFKLLCALVD 392

Query: 287  PMTQPPPNXXXXXXXXXXXXXXXXXXTAYIVKLIPNYQKV-WKIHLSANLETITLAILQM 345
            P+TQP PN                     + +         WK  +  N+E I  ++++ 
Sbjct: 393  PLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAEDGTNWKFLVCFNMEKIINSVMKK 452

Query: 346  LQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSD 405
            L   D+ +L+++ +  +     +   +  W+P   +  ++E+LYM+  L+ Y+++K++ D
Sbjct: 453  LNCVDFNTLNSINN--SDESVHWRTQLHKWLPRGFNTQDLELLYMVNILATYTIYKLNED 510

Query: 406  KPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIA 465
             P +LNPFL  M+  W+ LS  ++LGL+IDR EE    + TP+IV A +R ++ALRSIIA
Sbjct: 511  LPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETFDTPLIVRATVRSSTALRSIIA 570

Query: 466  TILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVELL 525
            TILN HV+   HDFKH+    FMSP+GRKLCNGALYT    + + +L    D + + +L+
Sbjct: 571  TILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDFRSHASTILALTGDLEHVTQLI 630

Query: 526  TDIQKGDRIDEDVRYMFDYEYFDYN---------DADTS-----------KLTDGKLMFT 565
            +D+Q GDR DEDV+YMF++E  DYN         D +TS           ++ +G  +  
Sbjct: 631  SDLQPGDRFDEDVKYMFEFE--DYNTLPNVLGGEDDETSTDTLKNREMLKEIHNGNFIPD 688

Query: 566  STKNE-------LEQKNRFRMLRGLYKRCLCKFSXXXXXXXXXXXXX---XXXYNGEKSV 615
            + +N+       LEQK R       ++RC C FS                    NG +S 
Sbjct: 689  NEENDEREIRNYLEQKLR---EMNCHRRCNCIFSDDEIKDTSISDKNYMGNSSSNGIESR 745

Query: 616  VGLDENGQINEAETPQTFSESS--------------------------------NAVAFT 643
            + L  N   +      T SE                                  +AV  +
Sbjct: 746  IALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSSTEMESLRVTGFNKPHAVRTS 805

Query: 644  SLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRL 703
            +L  +  S N+  +     +D NG DWRD PRG+NLYY  +Y+F+ K +   +F+L  + 
Sbjct: 806  NLNNNPSSVNNKNNQNIFDFDYNGKDWRDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKA 865

Query: 704  PDRNVTFSQACTVLRSIATCVKLEQEQILL----------KLITATSAEVDLKVLPFSTD 753
             +  +    +  +LR +A+ VK EQ++I+           +++      V+ + LP + +
Sbjct: 866  TNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKN 925

Query: 754  --------EVITAIFNDDGGII--KPFPFS---GCNDSLGWKIFDELMMSHGHRRLLIYH 800
                    E+IT I  DD   I  +   F      N  + +++ DE++M +G+RR+LI+ 
Sbjct: 926  RIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWF 985

Query: 801  LTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPT-----------GE 849
            +TH   + S IHY++EL+ G RG    +   E       G ++                +
Sbjct: 986  ITHLELSHSVIHYIFELVMGFRGTSEENGATEDKHTNTKGNVNELENKNENELVNMLLND 1045

Query: 850  FERVAAIE--FSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVY 907
            + ++  ++  FSRQG IELS IE+KML+QEF    +     E N+      S  N +   
Sbjct: 1046 YSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIH-FNERNNLKHNPNSNDNSNSNE 1104

Query: 908  V---DDYGEEFFSATSRKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQW 964
                 D  E+  S  S      G ++++CF+++  L++ + + +  +D ++EL+  LM W
Sbjct: 1105 DNINKDEDEDEISLYS-----IGLMRLICFMIQAFLDNNKLK-IEVDDSIFELQTLLMNW 1158

Query: 965  STFSAEACSMYALLKSKALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWD 1024
             T   EA  ++  +K       +D      +   + D D+  +     K    D +D+ D
Sbjct: 1159 ITIIPEAKKLFFQIKDIISNNQIDNNNFNNNLILDLDQDNNTIENQTSK----DNNDKMD 1214

Query: 1025 TETDTSIENGDKTSIMSERFSRMLPVQSLDGQPVDKVFRHLLQKYPLTEGTPIHGRITLE 1084
             E+     N      + E F +M      +   +D   ++ L+K+   +  PI GR  + 
Sbjct: 1215 -ESSKVDSNSSFNKKLIELFPKMSHTNKEENTAID-TLKNYLKKFRFHQEVPIIGRKVIY 1272

Query: 1085 YHDHILPLDI 1094
                IL + I
Sbjct: 1273 EDGKILKIPI 1282

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
           Anc_3.497 YGR134W
          Length = 1038

 Score =  262 bits (669), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 181/567 (31%), Positives = 281/567 (49%), Gaps = 62/567 (10%)

Query: 23  LLEKLVIALFTTVPGQAVVTQLINDAKRTNDVD-GVECLIRMNDPYWVALFGTW---ATD 78
           LLE+ V+ LFTT  GQ V   L         +D GV  L +        +   W   A  
Sbjct: 11  LLEECVVTLFTTYRGQHVCQML-------EQLDLGVFSLSKTPSRIVQQVRTAWTEEALS 63

Query: 79  KHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFTAPLWDTSNILLDYLH 138
           K+I  LF   V R+  D   + +Y++ +FK+ +  L  ++  K    L    ++LLD+++
Sbjct: 64  KYI-HLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYDVLLDFVN 122

Query: 139 NAKPLIESVLKK-LDGSQFLQCLMKYNRLYEFNGSYQWFTPPQSTSHAESPTTILERNS- 196
             +P ++ ++++ + GS     + KY R+YEF+  + WF   +    A     IL + + 
Sbjct: 123 TVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKK-KFANRDVLILNKGTP 181

Query: 197 --------TFLST-----------LGNF--GNDMVRALSQLKTGD--IRLNSLESYGKNS 233
                   +F S            LG    GN+ V+   QL T +     +  E     S
Sbjct: 182 DLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVK-YQQLGTNEHVYEFDLDEETHNGS 240

Query: 234 GHNNPPLSKQDDHNPLNLNGKSDRFNLFFK-LGLHKEPHPLLAEQFNSLCLFADPMTQPP 292
           G+    +      N         R  +  + L L +   P L EQF  +    DP+TQPP
Sbjct: 241 GNRTVAVDLMQQSN--------QRHEILTRMLNLKEIDSPHLYEQFKCMISLVDPLTQPP 292

Query: 293 PNXXXXXXXXXXXXXXXXXXTAYIVKLIPNYQKVWK---IHLSANLETITLAILQMLQIW 349
           P+                      +  +P  Q   +     L  N++ I    L  L+ W
Sbjct: 293 PSDTYVVSLDLLY--------KLFLAFLPKNQDTEQNDTFLLCFNMQKIITRTLWRLKCW 344

Query: 350 DYRSLDNLKDIQARSPDA---YPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSDK 406
           DY  L ++   Q    ++   Y  ++  W+P  L+  ++E+LYM+  ++ Y+++  +S  
Sbjct: 345 DYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYTIYNAYSHL 404

Query: 407 PPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIAT 466
           P +LNPFL M++  W+ LS+ L+L L++DR EE    + TP++V A IRGASALR+++A 
Sbjct: 405 PIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRGASALRAVVAC 464

Query: 467 ILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVELLT 526
           +LNGHV E  HDFKH+P   FMSPHGRKLC G+LY     + AA+L  G+D +++ ELL+
Sbjct: 465 VLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLGVDLEDVTELLS 524

Query: 527 DIQKGDRIDEDVRYMFDYEYFDYNDAD 553
           D+Q GDR DED+RYMF+YEY DYN  D
Sbjct: 525 DLQPGDRFDEDIRYMFEYEYEDYNLVD 551

 Score =  152 bits (383), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 133/453 (29%), Positives = 211/453 (46%), Gaps = 49/453 (10%)

Query: 663  YDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRLPDRNVTFSQACTVLRSIAT 722
            +D +G+DWRD+PRGLNLY+   Y+FL++        +  +     +   ++  +L+ +A+
Sbjct: 625  FDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVSSKAAGGKLNPMESQQLLKLVAS 684

Query: 723  CVKLEQEQILLKLI---TATSAEVDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDSL 779
             +K+EQE I++  +   T   A  D  +L  + D +  A F D   +     F   N  L
Sbjct: 685  AIKIEQECIIMGTVYPQTEGIAVGDDGLL--TPDNIYDAWFQDK--VFDRILF--MNQEL 738

Query: 780  GWKIFDELMMSHGHRRLLIYHLTHRSYTFSSIHYVYELLFGLRGNP-ARSYDLESTKNKQ 838
             WK+ DEL+M HG+RR+L++ +TH     S IHY++EL+ GLRG   +    LE  + + 
Sbjct: 739  AWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELVMGLRGQELSADVTLEEQRKQA 798

Query: 839  LGILSW--TPTGEFERVAAIEFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFE 896
            L  L    TP G       + FSRQG + LS IE KMLLQEFF           N A F 
Sbjct: 799  LHNLMEIDTPNG-----GTLMFSRQGNLALSEIEVKMLLQEFFT----------NAAIFL 843

Query: 897  AFSIKNPSKVYVDDYGEEFFSATSRKAEMSGKVKMVCFILEEVLNDKEFEFVPHEDYVYE 956
            + S     +    D     +S         G VK++CF+++ ++ + +FEF   E   +E
Sbjct: 844  SASESEEPESETSDVS--LYSI--------GLVKLICFMVKTLIVNHKFEFSKSE-CTFE 892

Query: 957  LKRFLMQWSTFSAEACSMYALLKSKALGKVLDLGTEGLDDRPNTDPDDQLLPVDFDKLKL 1016
            L+  LM W     +A  ++ LLK K +       T          P D + P       L
Sbjct: 893  LQTLLMNWLGIVPDAQELFFLLK-KNISDTKTATTTTTTTSALGAPGD-IFPT------L 944

Query: 1017 SDIDDRWDTETDTSIENGDKTSIMSERFSRMLPVQSLDGQPVDKVFRHLLQKYPLTEGTP 1076
            +D DD  +   +   E   K  ++  R ++     S   Q +D + R+ ++K+ L+   P
Sbjct: 945  TDADDDNNAVAENLSEFNKKLVMLLPRATQSEGKGS--SQAIDAL-RNFMRKHSLSSEIP 1001

Query: 1077 IHGRITLEYHDHILPLDIRTHQSLHREFLAVFD 1109
            + GR  +     ILP          RE+L  +D
Sbjct: 1002 VLGRRIVRRGSQILPQATPERTVTLREYLGSYD 1034

>Suva_2.417 Chr2 (740137..742695) [2559 bp, 852 aa] {ON} YDR251W
           (REAL)
          Length = 852

 Score = 33.1 bits (74), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 47/109 (43%), Gaps = 8/109 (7%)

Query: 170 NGSYQWFTPPQSTSHAESPTTILERNST-----FLSTLGN--FGNDMVRALSQLKTGDIR 222
           NG +    PPQ   HA  PT+   RNS      ++  + N  +G  +    + +     R
Sbjct: 619 NGRFSQQAPPQQYMHAVKPTSRKNRNSVMPNIGYVPGMANNEYGRKLNGNANAVNGTQSR 678

Query: 223 LNSLESYGKNSGHNNPPLSKQDDH-NPLNLNGKSDRFNLFFKLGLHKEP 270
           LNSL +         PP  +Q    N  + N +S+R +     GL+++P
Sbjct: 679 LNSLSNQSTFRSQQGPPTPQQKPFPNNGSTNIRSNRVSSANYNGLNQKP 727

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 124,362,911
Number of extensions: 5702927
Number of successful extensions: 15430
Number of sequences better than 10.0: 28
Number of HSP's gapped: 15640
Number of HSP's successfully gapped: 48
Length of query: 1132
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1012
Effective length of database: 39,721,479
Effective search space: 40198136748
Effective search space used: 40198136748
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)