Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E03939g3.498ON43543518940.0
Kwal_47.188953.498ON4434435724e-68
KLTH0G02398g3.498ON4624515464e-64
SAKL0F02552g3.498ON4784745466e-64
TPHA0A056903.498ON4784725117e-59
Kpol_480.113.498ON4634675021e-57
Suva_16.4803.498ON4524424696e-53
TDEL0D056603.498ON4424424485e-50
KNAG0A079703.498ON3883584412e-49
ZYRO0D09768g3.498ON4604654277e-47
Skud_16.4463.498ON4563784242e-46
KAFR0G037203.498ON4093654002e-43
YPR152C (URN1)3.498ON4653963997e-43
Smik_16.4043.498ON4603783883e-41
Ecym_12313.498ON3292313621e-38
AFR317C3.498ON3282383452e-36
CAGL0L08404g3.498ON4103632993e-29
NCAS0F035803.498ON4133712527e-23
NDAI0B059003.498ON5221742032e-16
TBLA0D029303.498ON2761611876e-15
KAFR0A002302.649ON556791213e-06
YKL012W (PRP40)2.649ON583691179e-06
KNAG0M024702.649ON606901142e-05
ZYRO0E00682g2.649ON570951081e-04
Smik_11.2432.649ON579691072e-04
Ecym_33972.649ON575791062e-04
Suva_11.2162.649ON585691043e-04
Skud_11.2172.649ON583691026e-04
Kpol_1073.42.649ON53087940.006
TBLA0C009302.649ON658251930.009
TPHA0L020202.649ON58376920.009
Kwal_14.9392.649ON56294890.022
KLTH0C00924g2.649ON56479860.052
ADR159C2.649ON56980810.24
SAKL0G19360g2.649ON56876790.39
CAGL0L05368g2.649ON59077780.44
TDEL0B074402.649ON57077751.2
NDAI0G046002.649ON64731751.3
KLLA0E18239g2.649ON57171731.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E03939g
         (435 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...   734   0.0  
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   224   4e-68
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   214   4e-64
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...   214   6e-64
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   201   7e-59
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   197   1e-57
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   185   6e-53
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   177   5e-50
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   174   2e-49
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   169   7e-47
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   167   2e-46
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   158   2e-43
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   158   7e-43
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   154   3e-41
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   144   1e-38
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...   137   2e-36
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...   119   3e-29
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...   101   7e-23
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...    83   2e-16
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    77   6e-15
KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649...    51   3e-06
YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1 s...    50   9e-06
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    49   2e-05
ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar ...    46   1e-04
Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012...    46   2e-04
Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar t...    45   2e-04
Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012...    45   3e-04
Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012...    44   6e-04
Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON} (4004..559...    41   0.006
TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {O...    40   0.009
TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {...    40   0.009
Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W ...    39   0.022
KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar ...    38   0.052
ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON} S...    36   0.24 
SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]...    35   0.39 
CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa] ...    35   0.44 
TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa] ...    33   1.2  
NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa] ...    33   1.3  
KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON} simi...    33   1.9  

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/435 (84%), Positives = 369/435 (84%)

Query: 1   MSEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVIC 60
           MSEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVIC
Sbjct: 1   MSEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVIC 60

Query: 61  KDGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGEIRD 120
           KDGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGEIRD
Sbjct: 61  KDGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGEIRD 120

Query: 121 VLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILXXXXXXXXXXXXXXXXXXXK 180
           VLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNIL                   K
Sbjct: 121 VLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILVSGYSSSSDDSGEESEVEEK 180

Query: 181 NDPSSIDVKEEDTLPSLNNTEIESKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLITSN 240
           NDPSSIDVKEEDTLPSLNNTEIESKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLITSN
Sbjct: 181 NDPSSIDVKEEDTLPSLNNTEIESKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLITSN 240

Query: 241 DKRDELFQTWCXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTLEPTKYHYLAHIISKANIT 300
           DKRDELFQTWC                            VTLEPTKYHYLAHIISKANIT
Sbjct: 241 DKRDELFQTWCSQQLNNSNNDNENNAQDSAENSDEEDSDVTLEPTKYHYLAHIISKANIT 300

Query: 301 PETLFSNIKKENKSLFKELEINKTLTKKEQEQFASKVIAYYKRMDNLQRTELFKKMMKNK 360
           PETLFSNIKKENKSLFKELEINKTLTKKEQEQFASKVIAYYKRMDNLQRTELFKKMMKNK
Sbjct: 301 PETLFSNIKKENKSLFKELEINKTLTKKEQEQFASKVIAYYKRMDNLQRTELFKKMMKNK 360

Query: 361 LRFPPISEKLSQLMLEETPSDSFKXXXXXXXXXXXXXXXXXXXNSYMQNEIMYYILGIKD 420
           LRFPPISEKLSQLMLEETPSDSFK                   NSYMQNEIMYYILGIKD
Sbjct: 361 LRFPPISEKLSQLMLEETPSDSFKLETQLLQLENALLILDNLQNSYMQNEIMYYILGIKD 420

Query: 421 KLAALKEILRDQYSK 435
           KLAALKEILRDQYSK
Sbjct: 421 KLAALKEILRDQYSK 435

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  224 bits (572), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 151/443 (34%), Positives = 234/443 (52%), Gaps = 19/443 (4%)

Query: 3   EWKRFKDPSGNFYYFNTRSKVSTKEKPKEFG-SQQAGMKELRV---PVFCLPLRNYWNLV 58
           +W+ +K P G+ YY+N  +K ST E P +F   Q +G K  ++   P+F L L N W L+
Sbjct: 4   QWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWALI 63

Query: 59  ICKDGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGEI 118
           IC  G +FF+N ES+ S++ L D+ S  LL K+D   L LL+GVA+GF+   DR+VY E+
Sbjct: 64  ICNTGLRFFYNSESHTSRWDLDDEASLELLAKLDREKLVLLVGVAKGFD-PGDRNVYQEL 122

Query: 119 RD-VLQAKLDSNDKEQNDITEERPQVT----NSNVDTEDKSESSNILXXXXXXXXXXXXX 173
            D + + K DSN+++    T E    T     S V     S+ S+               
Sbjct: 123 SDSISELKEDSNNRDFRKETAEESIPTAVPGQSLVSGYGSSDESDKDEDEEEEENDEGDS 182

Query: 174 XXXXXXKNDPSSIDVKEEDTLPSLNNTEIESKFIQLLNEIQLDPYSTWSIQAKRIMHDPR 233
                  N P + DV +  T+   ++   +++FI L ++  +DPYSTW++Q+++I  DP 
Sbjct: 183 TEAVSCTNVPDA-DVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQSRKIRDDPL 241

Query: 234 YYLITSNDKRDELFQTWCXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTLEPTKYHYLAHI 293
           +Y IT++  R ELF+ WC                             +LEP++YHYLAHI
Sbjct: 242 FYKITNDADRKELFENWCMNECSNQSEVPAIDEQIISSDDEDPAID-SLEPSRYHYLAHI 300

Query: 294 ISKANITPETLFSNIKKENKSLFKELEINKTLTKKEQEQFASKVIAYYKRMDNLQRTELF 353
           +SK+ IT  TL  +I+ + K LFK+  I  +L+K+EQ+ F SK++ YYKRM   QR  +F
Sbjct: 301 VSKSKITSSTLPKDIRTDQKELFKQFRIKDSLSKREQDAFLSKLLFYYKRMTPEQRIAIF 360

Query: 354 KKMMKNKLRFPPIS----EKLSQLMLEETPS-DSFKXXXXXXXXXXXXXXXXXXXNSYMQ 408
           K+ ++ K +         E+LS ++   TPS                        N+++Q
Sbjct: 361 KRFLEGKKKALKKGLKNQERLSTIL--STPSLPQENYAIETQLLILEDCIDTHGSNAFLQ 418

Query: 409 NEIMYYILGIKDKLAALKEILRD 431
            ++ YY+LGIKDK  AL++IL+D
Sbjct: 419 EDVQYYVLGIKDKTVALRDILKD 441

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  214 bits (546), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 145/451 (32%), Positives = 223/451 (49%), Gaps = 28/451 (6%)

Query: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEFG-SQQAGMKELRVP---VFCLPLRNYWNLVI 59
           W+ +K P G  YY+N  +K ST +KP +F  SQ    K  RV     F +PL N W L +
Sbjct: 10  WREYKTPDGTKYYYNVNTKRSTTDKPDDFEESQSFRSKSRRVDPGVTFVVPLSNDWVLSV 69

Query: 60  CKDGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGEI- 118
           C++G +FF+   +  S++ + D+ES  +L  VD + L LL+  ARGF++  +RDVY E+ 
Sbjct: 70  CENGQRFFYKSSTEESRWDIEDEESLRILSLVDKNKLVLLLATARGFDI-GERDVYQELL 128

Query: 119 RDVLQAKLDSNDKEQNDITE--ERPQVTN---SNVDTEDKSESSNILXXXXXXXXXXXX- 172
            D+   K      E +++ E  E P  T    SN  TE+ S++   L             
Sbjct: 129 EDINNLKQSRGVPEGSEVIEAAEEPSHTAGEPSNA-TEEPSQAVRTLISAYESSDEDGDS 187

Query: 173 -----XXXXXXXKNDPSSIDVKEEDTLPSLNNTEIESKFIQLLNEIQLDPYSTWSIQAKR 227
                        N+ S+ D+++ +      N   +  F  L +E  LDPYSTW++Q+K+
Sbjct: 188 SDEINAEKEVHSDNEGSNSDIEDLNAASHQYNEATKQMFTSLFDEYDLDPYSTWNMQSKK 247

Query: 228 IMHDPRYYLITSNDKRDELFQTWCXXXXXXXXXX---XXXXXXXXXXXXXXXXXXVTLEP 284
           I  +P +Y + S+ +R ELF+ WC                                 LEP
Sbjct: 248 ICDNPLFYQVASDAERRELFEDWCVAKVKLEDVIEDPAHQAVSSDGDGDDDDTSTDELEP 307

Query: 285 TKYHYLAHIISKANITPETLFSNIKKENKSLFKELEINKTLTKKEQEQFASKVIAYYKRM 344
           T+YHYLAHI+SKA + P TL  +++ E K LFK+ +I ++L KK+Q++F SK++ YYK M
Sbjct: 308 TRYHYLAHIVSKAEVAPSTLPRDLRSEQKQLFKQFKIKESLGKKQQDEFLSKLLFYYKNM 367

Query: 345 DNLQRTELFKKMMKNKLR-----FPPISEKLSQLMLEETPSDSFKXXXXXXXXXXXXXXX 399
              QR E+  K +K + +     F  I +  S L  ++ P+  F                
Sbjct: 368 TEEQRLEVLVKFLKTRRKLIMKGFRNIEQLESVLSQQDLPTSGF--AIESQLLRLEDCID 425

Query: 400 XXXXNSYMQNEIMYYILGIKDKLAALKEILR 430
               +  +Q+E+ YY+LGIK K  ALKE L+
Sbjct: 426 IHGVSKALQDEVQYYVLGIKQKTTALKEFLK 456

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score =  214 bits (546), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 153/474 (32%), Positives = 227/474 (47%), Gaps = 50/474 (10%)

Query: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKE--LRVPVFCLPLRNYWNLVICK 61
           W  F  PSG+ YY+N  +K ST EKP  F  Q++  ++     P + +PL   W+LV+C 
Sbjct: 5   WNEFTTPSGDKYYYNLETKQSTLEKPAGFDDQKSRKRQKLQHKPKYLVPLDKGWSLVLCN 64

Query: 62  DGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGEIRDV 121
            G+KF+HN  +N S + L D  S  LL ++D   L LLIG++RG+     R+VY EI + 
Sbjct: 65  TGTKFYHNKITNESHWTLDDPCSIELLQQLDKEKLVLLIGISRGYYCPR-RNVYDEIIND 123

Query: 122 LQ----------------AKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILXXXXX 165
           L+                A+ D    E     EE+     +   + D SE  NI      
Sbjct: 124 LKFLKDKSLEKQGVEPEMARADEEQVEYLHQGEEQGLGLVTGYGSSDDSEDENIEEEEEK 183

Query: 166 XXXXXXXXXXXXXXKNDPSSIDVKEEDTLPSLN---NTEIESKFIQLLNEIQLDPYSTWS 222
                           +  ++D  + D L +L+     + +++F  L ++  LDPYS W 
Sbjct: 184 AEVEGEGEEEEEEKAGEQETVDQADIDELNNLSEPPQLDAKNRFTILFDKYNLDPYSMWE 243

Query: 223 IQAKRIMHDPRYYLITSNDKRDELFQTWCXXXXXXXXXXXXXXXXXXXXXXXXXXXXVT- 281
            Q+++I  DP +YL+T+   R +LF+ WC                             T 
Sbjct: 244 FQSRKINKDPDFYLVTNGSSRKDLFEQWCTETIANSKDAISDANINENDADQRQESEATQ 303

Query: 282 --------------------LEPTKYHYLAHIISKANITPETLFSNIKKENKSLFKELEI 321
                               LEPT++HYL+HIISK++I   T+F +IKKENK+LFK   I
Sbjct: 304 KEEQEEKKEVEEDGEPDDENLEPTRFHYLSHIISKSSIEQTTIFLDIKKENKALFKTFRI 363

Query: 322 NKTLTKKEQEQFASKVIAYYKRMDNLQRTELFKKMMKNKLRFPPIS----EKLSQLMLEE 377
             +L KK+QE FASK++ YYKRMD  QR  +F+K++ +KL     +    EKL  +  E+
Sbjct: 364 KSSLKKKDQEDFASKLLFYYKRMDLEQRKLIFQKLLLSKLDIIRSNLRNVEKLRDIATEQ 423

Query: 378 -TPSDSFKXXXXXXXXXXXXXXXXXXXNSYMQNEIMYYILGIKDKLAALKEILR 430
            TP+DS+                     S++Q E+ YYILGIKDK   LK+ L+
Sbjct: 424 STPADSYAIETQLLMMEDCMDIHGKL--SFLQGEVHYYILGIKDKTIQLKQFLQ 475

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  201 bits (511), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 151/472 (31%), Positives = 221/472 (46%), Gaps = 45/472 (9%)

Query: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEF--GSQQAGMKELRVPVFCLPLRNYWNLVICK 61
           WK F  P+G  YY+N ++K +T ++P+    G+  +  ++   PVF  PL N W LVI  
Sbjct: 6   WKEFIAPNGQKYYYNLKTKKTTWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVISS 65

Query: 62  DGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGEIRD- 120
            G KF+ N   N+S  +L D+ +  LL  +D   L LL+GVARGF       VY EI + 
Sbjct: 66  LGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYEEIMEN 125

Query: 121 -------------VLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILXXXXXXX 167
                         LQ  +    +E  D  +    +   N    D   SS+         
Sbjct: 126 LDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSSSDEEVDIREDK 185

Query: 168 XXXXXXXXXXXXKNDP-------SSIDVKEED--TLPSLNNTEIESKFIQLLNEIQLDPY 218
                       +ND        +  D  EE+  ++ +L+    + K+ QL  + QL+ +
Sbjct: 186 FNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYFQLFEKYQLNSF 245

Query: 219 STWSIQAKRIMHDPRYYLITSNDKRDELFQTWCXXXXXXXXXXXXXXXXXXXXXXXXXXX 278
           STWS Q+K +M DP +YLIT N  R+++F+ WC                           
Sbjct: 246 STWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKDDQTDSSGAHSS 305

Query: 279 X---------------VTLEPTKYHYLAHIISKANITPETLFSNIKKENKSLFKELEINK 323
                             LEPTKYHYL+HIISKANI+P+T+F +IKK+NK LFK+ +INK
Sbjct: 306 AEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFQDIKKDNKKLFKQFKINK 365

Query: 324 TLT-KKEQEQFASKVIAYYKRMDNLQRTELFKKMM-KNKLRFPPISEKLSQLMLEETPSD 381
            +T K++ E F+SK+I YYK+ D  QR ++F+ ++ +NK        + S  +L ET + 
Sbjct: 366 FITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHVVEHSDKVL-ETLNT 424

Query: 382 SFKXXXXXXXXXXXXXXXXXXXNSY--MQNEIMYYILGIKDKLAALKEILRD 431
           S                      S   + N+  YYILGIKDKL  LK  LR+
Sbjct: 425 SVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLECLKNYLRN 476

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  197 bits (502), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 152/467 (32%), Positives = 232/467 (49%), Gaps = 48/467 (10%)

Query: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEF--------GSQQAGMKELRVPVFCLPLRNYW 55
           WK F  P G  YY+N +SK ST  KP           GS +AG      P+F  PL N W
Sbjct: 6   WKEFNAPDGRKYYYNIKSKESTWTKPDSLYDTEKGKVGSDRAG-----APLFVFPLLNGW 60

Query: 56  NLVICKDGSKFFHNDESNVSQFK-LADDESKALLDKVDTSLLALLIGVARGFNLRNDRDV 114
           +L+IC  G K+++N   N +  K L+DD S  LL+ VD   L LLI VARG+N  +   +
Sbjct: 61  HLIICVGGEKYYYNKVLNDTISKELSDDSSLQLLNAVDKDKLILLIAVARGYNWPDYEKL 120

Query: 115 YGEIRDVLQAKLDSND---KEQNDITEERPQVTNSNVDTEDK--SESSNILXXXXXXXXX 169
           Y E+  + + +L SND    +Q ++T    +  + + + E    + S+  L         
Sbjct: 121 YDEL--LKEFELISNDMMQTQQAEVTSTEDEDEDEDENQEGNVVAVSNTGLIGGYLSSDD 178

Query: 170 XXXXXXXXXXKNDPSSI-----------DVKE-----EDTLPSLNNTEIE---SKFIQLL 210
                      ++ ++I           DV E     +  L SL++ ++E   S F +L 
Sbjct: 179 EESSDENQVEVSENTNIEEDLAKRSDQNDVDENLNSIDHGLDSLDDIDLEKSKSLFTRLF 238

Query: 211 NEIQLDPYSTWSIQAKRIMHDPRYYLITSNDKRDELFQTWCXXXXXXXXXXXXXXXXXXX 270
            E QLDPYS+W +Q K+I + P Y+ IT N  R+ELF++WC                   
Sbjct: 239 EEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTREELFESWCSSKFNGGKSNVTNFEGEDE 298

Query: 271 XXXXXXXXXVTLEPTKYHYLAHIISKANITPETLFSNIKKENKSLFKELEINKTL-TKKE 329
                       EPTK+HYLAHIISKA+I  +T+F +IK+ NKSLFKE +I   + +KK+
Sbjct: 299 ETLTSDEED-DFEPTKFHYLAHIISKADIAADTIFLDIKENNKSLFKEFKIKDFIKSKKD 357

Query: 330 QEQFASKVIAYYKRMDNLQRTELFKKMMK--NKLRFPPISEKLSQL--MLEETPSDSFKX 385
           QE F+SK++ +YK+    +R  LF +++K    L  P I+  +  +  +++    ++++ 
Sbjct: 358 QEAFSSKLLFFYKKFQLNERKNLFLQLLKENENLIIPNINSNIEIVRHIIKNDVDEAYEI 417

Query: 386 XXXXXXXXXXXXXXXXXXNSYMQNEIMYYILGIKDKLAALKEILRDQ 432
                             +  + N+  YYILGIKDKL  LKE L+D+
Sbjct: 418 ETQLLQIEKIIGLQNMLVD--LANDPKYYILGIKDKLILLKEYLKDK 462

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  185 bits (469), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 130/442 (29%), Positives = 219/442 (49%), Gaps = 42/442 (9%)

Query: 4   WKRFKDPSGNFYYFNTRSKVSTKEKP---KEFGSQ-QAGMKEL-RVPVFCLPLRNYWNLV 58
           W+ FK P+G  Y++N  +K S  +KP   K  G+Q +A + ++ R P+F L L + W+L+
Sbjct: 7   WQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHLI 66

Query: 59  ICKDGSKFFHNDESNVSQFKLADD---ESKALLDKVDTSLLALLIGVARGFNLRNDRDVY 115
           IC DG+KF++N ESN+S++++ ++   +  AL++ +D   L LLIGVARG+N+R + DV 
Sbjct: 67  ICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREE-DVE 125

Query: 116 GEIRDVLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILXXXXXXXXXXXXXXX 175
            +I + L  ++D   K Q  + EE+    N      +    +N                 
Sbjct: 126 -KIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYGSSSEEEEE 184

Query: 176 XXXXKNDPSSIDVKEEDTLPSLNNTEIESK--FIQLLNEIQLDPYSTWSIQAKRIMHDPR 233
               +ND + I     D L  +++ ++  +  F QL +  +LD +STWS+Q K+I +DP 
Sbjct: 185 EEEPENDDAGII----DDLNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIENDPD 240

Query: 234 YYLITSNDKRDELFQTWCXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTLEPTKYHYLAHI 293
           +Y +     R+ LF+ WC                              LEPTK+HYLA I
Sbjct: 241 FYKVGDAAVRESLFEEWCASASASASGNESEDEDDAD----------LLEPTKFHYLAQI 290

Query: 294 ISKANITPETLFSNIKKENKSLFKELEINKTL-TKKEQEQFASKVIAYYKRMDNLQRTEL 352
           ++KA I P+ +  +I+K+ K+LFK   I + + +K++Q++F S+++ YYK     QR E+
Sbjct: 291 VAKAEIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEI 350

Query: 353 FKKMMKNKLR-FPPISEKLS---------QLMLEETPSDSFKXXXXXXXXXXXXXXXXXX 402
           F++ +++  R F    + L          Q +L  T +D                     
Sbjct: 351 FQECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAADG-----ASVEDALLSIEHRCG 405

Query: 403 XNSYMQNEIMYYILGIKDKLAA 424
             +    +  YY+LGI DK A 
Sbjct: 406 VGAIALADPRYYVLGILDKTAG 427

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  177 bits (448), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 134/442 (30%), Positives = 213/442 (48%), Gaps = 24/442 (5%)

Query: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEF----GSQQAGMKELRVPVFCLPLRNYWNLVI 59
           W  F  PSG  YY+N R+K ST ++P+ F    G+++  +     P + +PL N W LVI
Sbjct: 5   WTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFLVI 64

Query: 60  CKDGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGE-I 118
              G K++ +  +  + + L D ES  LL  +D + + LL+ +ARG+N      VY E I
Sbjct: 65  DDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDRVYQEVI 124

Query: 119 RDVLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILXXXXXXXXXXXXXXXXXX 178
            D+   +  S  +E+ +   E+   +  +   E++   S ++                  
Sbjct: 125 DDLKALRKGSAVEEEGEQEGEQESESIPSESEEEEKRPSGLIAGYSSSEEEENEI----- 179

Query: 179 XKNDPSSIDVKEEDTLPSLNN---TEIESKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYY 235
             +D   ++   +D LP  N+   ++I + F QLL   Q DPYSTWSIQA++I  DP +Y
Sbjct: 180 -DSDVEKLNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCDPYSTWSIQARKIQEDPLFY 238

Query: 236 LITSNDKRDELFQTWCXXXXXXXXX-XXXXXXXXXXXXXXXXXXXVTLEPTKYHYLAHII 294
            IT +  R+ +F+ WC                               LEP  +HYLAHI+
Sbjct: 239 RITDDSIRESMFEEWCEKAINRTTNPQDLVDEDNLDDDSREEEEEDELEPLPFHYLAHIV 298

Query: 295 SKANITPETLFSNIKKENKSLFKELEINKTL-TKKEQEQFASKVIAYYKRMDNLQRTELF 353
           SKANITP T+F +IK +NK+ FK+ +I + + +K +QE F SK++ YYK+    +R E+F
Sbjct: 299 SKANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIF 358

Query: 354 KKMMKNKLR-----FPPISEKLSQLMLEETPS-DSFKXXXXXXXXXXXXXXXXXXXNSYM 407
             ++++  R         SE +   + EE  S D++                       +
Sbjct: 359 HDLLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYAIETKLLKMENLIGLARDMEE--L 416

Query: 408 QNEIMYYILGIKDKLAALKEIL 429
            N+  YY+LGIKDK+  L   L
Sbjct: 417 ANDPKYYVLGIKDKMIELMHYL 438

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  174 bits (441), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/358 (31%), Positives = 178/358 (49%), Gaps = 37/358 (10%)

Query: 2   SEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRV-PVFCLPLRNYWNLVIC 60
           S W+ ++ P+G  YY NT +  +T + P     Q    +EL + P + +PL N WNLVIC
Sbjct: 3   SVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQ----RELSIKPQYVIPLLNAWNLVIC 58

Query: 61  KDGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGEIRD 120
            +G+KF+ N + +     L D +S  LL  VD   L LLIGVARG++  +   VY  + +
Sbjct: 59  NNGAKFYLNPDGD-PVLTLDDADSSELLSLVDREKLILLIGVARGYHCTSGDKVYNSVLE 117

Query: 121 VLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSES-SNILXXXXXXXXXXXXXXXXXXX 179
            +    D    ++  + EER ++    ++T  +SE   + L                   
Sbjct: 118 EISFLKDDLANDKAPLAEER-ELQEEPLETNVQSEPVPSALVSGYGSSSDGSDDEEEVPP 176

Query: 180 KNDPSSIDVKEEDTLPSLNNTEIESKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLITS 239
             D + I                   +  L +E  LD YS WSI++ +I +DPR+++I+ 
Sbjct: 177 DTDANRI------------------SYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISD 218

Query: 240 NDKRDELFQTWCXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTLEPTKYHYLAHIISKANI 299
           + +R+E+F+ WC                              L PTKYHYL+ I++K+ +
Sbjct: 219 DRQREEIFEEWCCSGVVDDSEDEGYSSGDDD-----------LSPTKYHYLSQIVAKSTV 267

Query: 300 TPETLFSNIKKENKSLFKELEINKTLTKKEQEQFASKVIAYYKRMDNLQRTELFKKMM 357
           TP T+F +IK+E  SLFK+  I + L+K+EQEQF S+++ YYK+    +R +LF K +
Sbjct: 268 TPTTIFQDIKQEKASLFKQYGIKQFLSKREQEQFVSQLLFYYKKFTLEERVQLFTKFI 325

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  169 bits (427), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 138/465 (29%), Positives = 211/465 (45%), Gaps = 50/465 (10%)

Query: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEFG--SQQAGMKELRV----PVFCLPLRNYWNL 57
           W+ +  P G  YY+N  +K ST  KP+      +  G+K  +     P   L L + W+L
Sbjct: 5   WREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGWHL 64

Query: 58  VICKDGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGE 117
           VIC  G KF++N E+N S + L D+ S+ L+D +D + L  LIG+ARG++      +Y E
Sbjct: 65  VICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGYS-PGGLHIYEE 123

Query: 118 -------IRDVLQAKLDSNDKEQNDIT----------------EERPQVTNSNVDTEDKS 154
                  +R   +AK    D+E+++ T                EE  +      D ED +
Sbjct: 124 LVTDLVKLRQEREAKRAEGDQEKDEATGEEVKDEDEEKDKANGEEVKEEDRDQNDGED-N 182

Query: 155 ESSNILXXXXXXXXXXXXXXXXXXXKNDPSSIDVKEEDTLPSLNNTEIESKFIQLLNEIQ 214
           ++ N L                     +P +I + E    P ++ +  +     L     
Sbjct: 183 DAQNGLVAGYSSSSESEDEGEGEGEGEEPLNIPITESVEEP-VDISGDKKALWDLFTRYD 241

Query: 215 LDPYSTWSIQAKRIMHDPRYYLITSNDKRDELFQTWCXXXXXXXXXXXXXXXXXXXXXXX 274
           L+PYS W  + K+I  DP +  +  +  R+++F+ WC                       
Sbjct: 242 LNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWC-----AHAISGDQVEPVDEIKSE 296

Query: 275 XXXXXVTLEPTKYHYLAHIISKANITPETLFSNIKKENKSLFKELEINKTLT-KKEQEQF 333
                  LEPTKYHYLAHI+SK+NITP T+F +IK +NKS FK+  I   LT KK+QE F
Sbjct: 297 DFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYNIKDFLTSKKDQESF 356

Query: 334 ASKVIAYYKRMDNLQRTELFKKMMKNKLRFPPISEKLSQ--------LMLEETPSDSFKX 385
            SK++ YYKRM   +R E+F +++K   +   I E LS         L  E   +D +  
Sbjct: 357 VSKLLFYYKRMKLEERKEVFVQLLKQNGK--TIEENLSNDMDKVRHCLAQEIDSNDPYAV 414

Query: 386 XXXXXXXXXXXXXXXXXXNSYMQNEIMYYILGIKDKLAALKEILR 430
                             +  +  E  YYILGI+DK+  L + L+
Sbjct: 415 ETKLFKMEKFMGLWGNLSD--LVEEPKYYILGIRDKMLELNDYLK 457

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  167 bits (424), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 117/378 (30%), Positives = 193/378 (51%), Gaps = 34/378 (8%)

Query: 4   WKRFKDPSGNFYYFNTRSKVSTKEKP--KEFGSQQAGMKELRV---PVFCLPLRNYWNLV 58
           W+ FK P+G  YY+N ++K S  E P  K F  Q+   K LR+   P F L L + W+LV
Sbjct: 2   WQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHLV 61

Query: 59  ICKDGSKFFHNDESNVSQFKLA---DDESKALLDKVDTSLLALLIGVARGFNLRNDRDVY 115
           IC DG+KF++N +S V + +++   D +  AL++ +D   L LLIGVARG+++R D DV 
Sbjct: 62  ICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMR-DEDV- 119

Query: 116 GEIRDVLQAKLDSNDKEQNDITEERPQVTNSNVDTED-----KSESSNILXXXXXXXXXX 170
            +I + L  +++   K QN    E  +V  +N +  D     K   + ++          
Sbjct: 120 DKIFESLNEEINLFKKNQN----EAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSSEEE 175

Query: 171 XXXXXXXXXKNDPSSI--DVKEEDTLPSLNNTEIESK--FIQLLNEIQLDPYSTWSIQAK 226
                     +    +  D    D L  ++  + + +  F +L +  +LD +STWS+Q+K
Sbjct: 176 EEEEEEEEEDDGEQDLNKDATIIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQSK 235

Query: 227 RIMHDPRYYLITSNDKRDELFQTWCXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTLEPTK 286
           +I +DP +Y I  +  R+  F+ WC                              LEPTK
Sbjct: 236 KIENDPDFYTIGDDAVREGFFEEWCGHEHSDSAAAEASGSEDVGD---------VLEPTK 286

Query: 287 YHYLAHIISKAN-ITPETLFSNIKKENKSLFKELEINKTL-TKKEQEQFASKVIAYYKRM 344
           YHYLA I++KA  I P+ +  +I+K+ K L+K   I + + +K+EQ++F S+++ YYK  
Sbjct: 287 YHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTF 346

Query: 345 DNLQRTELFKKMMKNKLR 362
              QR E+F+  +++  R
Sbjct: 347 SLEQRKEIFQDCLRDHER 364

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  158 bits (400), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 114/365 (31%), Positives = 186/365 (50%), Gaps = 35/365 (9%)

Query: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVICKDG 63
           WK ++ P+G  YY+NT +K +T EKP      +A  +E   PVF + L N W LVIC +G
Sbjct: 5   WKEYRAPNGKKYYYNTETKKTTWEKP------EAAKREEIEPVFVIRLMNDWKLVICNNG 58

Query: 64  SKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGEIRDVLQ 123
            K++ ++E+  ++ +L+D+ES  L++  D   L  LIG+ARG+ + N   +YG I + ++
Sbjct: 59  MKYYLDNENEPTK-ELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIYGNIVEEVE 117

Query: 124 AKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILXXXXXXXXXXXXXXXXXXXKNDP 183
              +    EQ  + +E        V  E +    N++                       
Sbjct: 118 FLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEGYDSS----------------E 161

Query: 184 SSIDVKEEDTLPSLNNTEIE------SKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLI 237
           S  + +EED    LNN   E      +KF++L +   LD +S WS++  ++  DP +YL+
Sbjct: 162 SEEEEEEEDDYEFLNNVADEGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLV 221

Query: 238 TSNDKRDELFQTWCXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTLEPTKYHYLAHIISKA 297
           T + +R++LF+ WC                              LEPTK+HYL+ I+SK+
Sbjct: 222 TDDQEREDLFERWC----SGQGIHSTSDEEAKEGGEPEEHEERPLEPTKFHYLSQIVSKS 277

Query: 298 NITPETLFSNIKKENKSLFKELEINKTL-TKKEQEQFASKVIAYYKRMDNLQ-RTELFKK 355
            I   T+F +IK++NK LFKE +I   + + KEQE+F SK++ YYK    ++ RT+ F  
Sbjct: 278 EIRRTTIFQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFND 337

Query: 356 MMKNK 360
            ++ K
Sbjct: 338 FLREK 342

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  158 bits (399), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 118/396 (29%), Positives = 199/396 (50%), Gaps = 41/396 (10%)

Query: 2   SEWKRFKDPSGNFYYFNTRSKVSTKEKP--KEFGSQQAGMKEL---RVPVFCLPLRNYWN 56
            EW+ FK P+G  YY+N  +K S  EKP  K+  + ++  KE    R P F L L N W+
Sbjct: 3   GEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNGWH 62

Query: 57  LVICKDGSKFFHNDES-----NVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRND 111
           L+I  DG+K + ND+S     ++SQ    D   ++L++ +D   L LLIGVARG+ +R +
Sbjct: 63  LIIYNDGTKLYFNDDSKEFKNDISQED--DSRCRSLIESLDKEKLVLLIGVARGYTMREE 120

Query: 112 RDVYGEIRDVLQAKLDSND-----KEQNDITEERPQVTNSNVDTEDKSESSN--ILXXXX 164
                +I  +L++    N+     K   D  E + +++    D +   + S+  ++    
Sbjct: 121 -----DIDKILES---CNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYG 172

Query: 165 XXXXXXXXXXXXXXXKNDPSSI---DVKEEDTLPSLNNTEIESK--FIQLLNEIQLDPYS 219
                          + +   I   D+   D L  ++  +I+ +  F +L +  +LD +S
Sbjct: 173 SSSGEEDEEEDEEEDEENEEQIVNQDISIIDDLNRIDTDDIDERNIFFELFDRYKLDKFS 232

Query: 220 TWSIQAKRIMHDPRYYLITSNDKRDELFQTWCXXXXXXXXXXXXXXXXXXXXXXXXXXXX 279
           TWS+Q+K+I +DP +Y I  +  R+ LF+ WC                            
Sbjct: 233 TWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGERSGNATAEESDSEDNSEDDSE----- 287

Query: 280 VTLEPTKYHYLAHIISKAN-ITPETLFSNIKKENKSLFKELEINKTL-TKKEQEQFASKV 337
             LEPTKYHYLA I++ A  I P+T+  +I+K+ K+L+K  +I + + +K++Q++F S++
Sbjct: 288 -VLEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQL 346

Query: 338 IAYYKRMDNLQRTELFKKMMKNKLR-FPPISEKLSQ 372
           + YYK  D  QR E+F   +++  R F    E L Q
Sbjct: 347 LFYYKTFDLEQRKEIFCDCLRDHERDFTGAVESLRQ 382

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  154 bits (388), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 111/378 (29%), Positives = 183/378 (48%), Gaps = 35/378 (9%)

Query: 4   WKRFKDPSGNFYYFNTRSKVSTKEKP-----KEFGSQQAGMKELRVPVFCLPLRNYWNLV 58
           W+ FK P+G  YY+N  +K S  EKP      +        +  R+P F L L + W+L+
Sbjct: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHLI 64

Query: 59  ICKDGSKFFHNDESNVSQFKLADDESK---ALLDKVDTSLLALLIGVARGFNLRNDRDVY 115
           IC DG+K + N +S + +  +  +      AL++ +D   L LLIG+ARG++++ + D+ 
Sbjct: 65  ICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQ-EEDI- 122

Query: 116 GEIRDVLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILXXXXXXXXXXXXXXX 175
            +I + L  ++D   K Q+    E      + V     SES   L               
Sbjct: 123 DKIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSESHTGLISGYGSSSEEEEEEE 182

Query: 176 XXXXKNDPSSIDVKEE----DTLPSLNNTEIE-----SKFIQLLNEIQLDPYSTWSIQAK 226
               + D +   V +     D L  ++  +I+     S F QL +  +LD +STWS+Q+K
Sbjct: 183 EEEEEEDHAEQGVNQNVSIIDDLNHIDADDIDEGRERSLFFQLCDRYKLDKFSTWSLQSK 242

Query: 227 RIMHDPRYYLITSNDKRDELFQTWCXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTLEPTK 286
           +I +DP +Y I  +  R+ LF+ WC                              LEPTK
Sbjct: 243 KIENDPEFYKIRDDTVREGLFEEWCEKHSAKESDSEDESN--------------VLEPTK 288

Query: 287 YHYLAHIISKA-NITPETLFSNIKKENKSLFKELEINKTLT-KKEQEQFASKVIAYYKRM 344
           YHYLA I++KA NI P+ +  +I+K  K+L+K   I + +  K+EQ++F S+++ YYK  
Sbjct: 289 YHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTF 348

Query: 345 DNLQRTELFKKMMKNKLR 362
           +  QR  +F+  + +  R
Sbjct: 349 NLEQRKTIFQDCLWDHER 366

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  144 bits (362), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 129/231 (55%), Gaps = 6/231 (2%)

Query: 204 SKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLITSNDKRDELFQTWCXXXXXXXX--XX 261
           ++FI L +  +L+PYS+WS+Q++++  DP +Y +  ++ R ELF+ WC            
Sbjct: 88  ARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGDSS 147

Query: 262 XXXXXXXXXXXXXXXXXXVTLEPTKYHYLAHIISKANITPETLFSNIKKENKSLFKELEI 321
                              +LEP K+HYL+HI+SK+ I P+T+FS++K ENK LFK   I
Sbjct: 148 ASLTGEEEEEEDDDDDEDESLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKNFNI 207

Query: 322 NKTLTKKEQEQFASKVIAYYKRMDNLQRTELFKKMMKNKLRFPPISE-KLSQLMLEET-P 379
           ++T  K+EQ QF S ++ YYK+  + +R E+FK ++  K++    +E +L Q++ +E  P
Sbjct: 208 DETHPKQEQRQFVSSLLFYYKKKSSKERVEIFKNLLDTKVKHEINNEDQLQQILDQENLP 267

Query: 380 SDSFKXXXXXXXXXXXXXXXXXXXNSYMQNEIMYYILGIKDKLAALKEILR 430
           +D+++                      +Q +I YY++G++DK   +KE LR
Sbjct: 268 NDAYEIESQLITMEKYIGMHDSLRQ--LQEDIKYYVVGVRDKTILIKEFLR 316

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 4  WKRFKDPSGNFYYFNTRSKVSTKEKPKEF 32
          WKR K   G FYY+ T S   T E+P+ F
Sbjct: 3  WKRAKTGEGEFYYYETVSGEKTWERPETF 31

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score =  137 bits (345), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 125/238 (52%), Gaps = 17/238 (7%)

Query: 204 SKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLITSNDKRDELFQTWCXXXXXXXXXXXX 263
           ++   L    +LDPYS W  ++ +I  D  +Y +  ++ R ELF+ WC            
Sbjct: 98  AELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADEGNAVL 157

Query: 264 XXXXXXXXXXXXXXXXVTLEPTKYHYLAHIISKANITPETLFSNIKKENKSLFKELEINK 323
                           V L PT++HYLAHI+SK+ + P+T++S++++E+K LF +LE++ 
Sbjct: 158 EDGEEAEE--------VELVPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEVD- 208

Query: 324 TLTKKEQEQFASKVIAYYKRMDNLQRTELFKKMMKNK-----LRFPPISEKLSQLM-LEE 377
            L KKEQ +F + ++ YYK+MD   R E+F+K++          F     +L +L+  +E
Sbjct: 209 ILDKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDE 268

Query: 378 TPSDSFKXXXXXXXXXXXXXXXXXXXNSYMQNEIMYYILGIKDKLAALKEILRDQYSK 435
            P DS+                     S +Q+EI YY+LG+KDKL  +KE+LR+  S+
Sbjct: 269 LPQDSYSIETDLFIVEKCIGLHGAL--SKLQSEIKYYVLGVKDKLVVMKEVLREMLSE 324

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 4  WKRFKDPSGNFYYFNTRSKVSTKEKP 29
          WKR K   G  YY+NT +  +T +KP
Sbjct: 3  WKRAKSEDGKAYYYNTETNETTWDKP 28

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score =  119 bits (299), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 99/363 (27%), Positives = 165/363 (45%), Gaps = 40/363 (11%)

Query: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRV-PVFCLPLRNYWNLVICKD 62
           WK +  P+G  YY+NT+++ +T  KP      +   KE+ + P+    L   W L+I  D
Sbjct: 9   WKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALIIFSD 68

Query: 63  GSKFFHNDESNVSQF--KLADDESKALLDKVDTSLLALLIGVARGFNLR-NDRDVYGEIR 119
           GSK ++N   N SQ+  K++  E   L+D ++   L LLIG+ RG+  R N +D+  EIR
Sbjct: 69  GSKKYYN--CNESQWSRKISHPECLKLIDLLNKDRLLLLIGIIRGYRCRTNAKDLVNEIR 126

Query: 120 DVLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILXXXXXXXXXXXXXXXXXXX 179
                       E  D   E      ++ D +  S  +N+                    
Sbjct: 127 ------------EDIDFIREDMNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEPA 174

Query: 180 KNDPSSIDVKEEDTLPSLN--------NTEIESKFIQLLNEIQLDPYSTWSIQAKRIMHD 231
           K D  ++ V+E D   +L           +I+  +  L  + +L+ YSTW I+++++  D
Sbjct: 175 KRDEQAV-VEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIESEKVSQD 233

Query: 232 PRYYLITSNDKRDELFQTWCXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTLEPTKYHYLA 291
           P +Y I  +  R+ +F+ WC                               EPTKYHYL+
Sbjct: 234 PEFYKIIDDAVRENIFEEWCNAGSVESNEESGDPGDDQ------------FEPTKYHYLS 281

Query: 292 HIISKANITPETLFSNIKKENKSLFKELEINKTLTKKEQEQFASKVIAYYKRMDNLQRTE 351
            +++  ++ P+T+      ++K L K+  I    TK EQ QF SK++A+YK M    R +
Sbjct: 282 QLVANYDLKPDTI-PEDIIKDKKLIKKYRIKDYTTKSEQRQFLSKMLAWYKHMSLEDRKQ 340

Query: 352 LFK 354
           +F+
Sbjct: 341 MFQ 343

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score =  101 bits (252), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 89/371 (23%), Positives = 166/371 (44%), Gaps = 46/371 (12%)

Query: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAG-MKELRVPVFCLPLRNYWNLVICKD 62
           W+ +K P+G  YY+N ++K +T  KP E    + G  KE++   F   L + W L+I  D
Sbjct: 7   WREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVK---FAFELFDGWYLLIRGD 63

Query: 63  GSKFFH---NDESNV-SQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDR-DVYGE 117
           G K F+   N++S + ++ K   + ++ +++ +D   + LLIG+ RGF  R+DR  + G 
Sbjct: 64  GGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGF--RDDRYHIKGV 121

Query: 118 IRDVLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILXXXXXXXXXXXXXXXXX 177
             D+ Q           DI   + ++ N  ++ E  +  +                    
Sbjct: 122 YDDIAQ-----------DINFLKQEILNDAMELERLNAEAEEEESEKEEALPQEEQDDHT 170

Query: 178 XXKNDPSSIDVKEEDTLPSLNNTEIESKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLI 237
               +    + +E+D         ++ +   L     LD YSTWS+Q+++I +   Y+L+
Sbjct: 171 VELLNNLEEEEEEQD---------VKDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLV 221

Query: 238 TSNDKRDELFQTWCXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTLEPTKYHYLAHIIS-- 295
             + +R+E+F+ WC                               EPTKYHYL+ I+   
Sbjct: 222 HDDTQREEMFEDWC------------AMKVAQLPEDESEAEDDDYEPTKYHYLSEIMYQL 269

Query: 296 KANITPETLFSNIKKENKSLFKELEINKTLT-KKEQEQFASKVIAYYKRMDNLQRTELFK 354
           +  I  +T+  +I + ++ LFK+  I + +  ++E     S+++ YYKR    +R  +F 
Sbjct: 270 RDEINADTVADDILRGHRPLFKQYHIKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFH 329

Query: 355 KMMKNKLRFPP 365
             +  +    P
Sbjct: 330 DYVSQRYGLLP 340

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 90/174 (51%), Gaps = 18/174 (10%)

Query: 202 IESKFIQLLNEIQLDPYSTWSIQAKRIMHDPR-YYLITSNDKRDELFQTWCXXXXXXXXX 260
           ++  F +LL++ +LD YSTWS+Q++RI+  P  +Y I+++ +R+E+F+ WC         
Sbjct: 255 VKQAFFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFEDWCRNRVHSTGL 314

Query: 261 XXXXXXXXXXXXXXXXXX--------------XVTLEPTKYHYLAHIISKA--NITPETL 304
                                              LEPTKYHYL+ +I K   +I   ++
Sbjct: 315 YSSNVKENNDGDTLVRGSYYEEEDKDDDDDDDDDDLEPTKYHYLSELIFKLRDSINERSI 374

Query: 305 FSNIKKENKSLFKELEINKTLT-KKEQEQFASKVIAYYKRMDNLQRTELFKKMM 357
           F +IK++ KSLFK+  I   +  KKE E+  S ++ YYK++   +R + F++ +
Sbjct: 375 FQDIKRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYKKLSEQERCDKFQEYV 428

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 76.6 bits (187), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 83/161 (51%), Gaps = 26/161 (16%)

Query: 203 ESKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLITSNDKRDELFQTWCXXXXXXXXXXX 262
           E++F +LL+   +D YS W ++AK+I  DP +Y I ++ +R++LF+ WC           
Sbjct: 72  ETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCYGKLHSREEE- 130

Query: 263 XXXXXXXXXXXXXXXXXVTLEPT-----KYHYLAHIISKANITPETLFSNIKKENKSLFK 317
                             T +P       YH LA +I   +I   T++ +I+K NK + +
Sbjct: 131 ------------------TTQPQLALALPYHDLAEMICCFDIQSNTIYKDIRKANKKMVR 172

Query: 318 ELEINKTLTKKEQEQFASKVIAYYKRMDNLQRTELFKKMMK 358
             +I++ ++K EQE+F +K++   K  D+     LF+++++
Sbjct: 173 --QIDEKISKNEQEKFGTKLLGILKYHDDASCQGLFEQVLE 211

>KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649
          YKL012W
          Length = 556

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 38/79 (48%), Gaps = 12/79 (15%)

Query: 1  MSEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVIC 60
          M +WK  KDP G  YY+NT +K ST EKPK F                 P  N W     
Sbjct: 1  MGDWKAAKDPKGRIYYYNTVTKKSTWEKPKNFAEPDQ------------PSANDWKTGKT 48

Query: 61 KDGSKFFHNDESNVSQFKL 79
          KDG  +++N ++  S++ L
Sbjct: 49 KDGKTYYYNVKTRESRWTL 67

>YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1
          snRNP protein involved in splicing, interacts with the
          branchpoint-binding protein during the formation of the
          second commitment complex
          Length = 583

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 34/69 (49%), Gaps = 10/69 (14%)

Query: 1  MSEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVIC 60
          MS WK  KD SG  YY+NT +K ST EKPKE  SQ+            L   N W     
Sbjct: 1  MSIWKEAKDASGRIYYYNTLTKKSTWEKPKELISQEE----------LLLRENGWKAAKT 50

Query: 61 KDGSKFFHN 69
           DG  +++N
Sbjct: 51 ADGKVYYYN 59

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON}
          Anc_2.649 YKL012W
          Length = 606

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 11/90 (12%)

Query: 1  MSEWKRFKDPSGNFYYFNTRSKVSTKEKPKEF-----GSQQAG------MKELRVPVFCL 49
          M +W++ +DP G  YYFN  ++ S  EKP E+     G+  AG      +++        
Sbjct: 1  MGKWEQARDPQGRVYYFNRETRKSQWEKPAEWEVTDDGAVAAGGAPTKKVEKATQGSSGE 60

Query: 50 PLRNYWNLVICKDGSKFFHNDESNVSQFKL 79
          P++  W     KDG  +F+N  +  S + L
Sbjct: 61 PVKGTWKSAKTKDGKVYFYNSATGKSSWTL 90

>ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 570

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 11/95 (11%)

Query: 2  SEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVICK 61
          S WK  KD SG  YY+N ++  S  EKP+E  S+Q            +  ++ W      
Sbjct: 5  SLWKEAKDTSGRIYYYNAKTGESKWEKPRELLSEQE----------LILAKHGWKSSKTS 54

Query: 62 DGSKFFHNDESNVSQFKLAD-DESKALLDKVDTSL 95
          DG  +++N ++  S+++L D  E K  + K DT++
Sbjct: 55 DGKLYYYNAQTKTSRWELPDLPEFKKEVKKEDTTI 89

>Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012W
          (REAL)
          Length = 579

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 37/69 (53%), Gaps = 10/69 (14%)

Query: 1  MSEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVIC 60
          MS WK  KD +G  YY+N+ +K ST EKPKE  S++  +  LR         N W     
Sbjct: 1  MSIWKEAKDANGRVYYYNSLTKKSTWEKPKELVSEEEQL--LR--------ENGWRAAKT 50

Query: 61 KDGSKFFHN 69
          K+G  +++N
Sbjct: 51 KEGKVYYYN 59

>Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar to
          Ashbya gossypii ADR159C
          Length = 575

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 11/79 (13%)

Query: 1  MSEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVIC 60
          M++WK   DP G  YY+N++ + +T  KP          KE+ V +  + L+  W +   
Sbjct: 1  MTDWKETIDPEGRVYYYNSKGE-TTWHKP----------KEMEVVLDAILLKQGWKVAST 49

Query: 61 KDGSKFFHNDESNVSQFKL 79
          +DG  +++N  +N S ++L
Sbjct: 50 EDGKVYYYNKNTNESTWEL 68

>Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012W
          (REAL)
          Length = 585

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 10/69 (14%)

Query: 1  MSEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVIC 60
          MS WK  KD +G  YY+NT +K S  EKP+E  SQQ  + +           N W     
Sbjct: 1  MSNWKEAKDANGRVYYYNTLTKKSIWEKPEELVSQQEQLLQ----------ENGWKAAKT 50

Query: 61 KDGSKFFHN 69
           +G  +++N
Sbjct: 51 AEGKIYYYN 59

>Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012W
          (REAL)
          Length = 583

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 10/69 (14%)

Query: 1  MSEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVIC 60
          MS WK  KD +G  YY+NT +K ST EKP +  S+Q  + +           N W     
Sbjct: 1  MSNWKEAKDANGRVYYYNTLTKKSTWEKPTQLVSKQEQLLQ----------ENGWRAAKT 50

Query: 61 KDGSKFFHN 69
           +G  +++N
Sbjct: 51 AEGKVYYYN 59

>Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON}
          (4004..5596) [1593 nt, 531 aa]
          Length = 530

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 10/87 (11%)

Query: 4  WKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVICKDG 63
          WK  KD +G  YY+N+++  S  EKP E  S+Q            L  +N W++   K G
Sbjct: 5  WKEAKDNNGRVYYYNSKTGESRWEKPVEAPSKQEQ----------LLKKNGWSIGKSKAG 54

Query: 64 SKFFHNDESNVSQFKLADDESKALLDK 90
            +++N ++  S ++L   +   ++DK
Sbjct: 55 KIYYYNTKTGESSWELPKFDEVKIIDK 81

>TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {ON}
           Anc_2.649 YKL012W
          Length = 658

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 102/251 (40%), Gaps = 55/251 (21%)

Query: 2   SEWKRFKDPSGNFYYFNTRSKVSTKEKPK-EFGSQQAGMKELRVPVFCLPLRN------- 53
           ++WK+ KDP G  YY+N ++K S  + PK   G+ ++   E +V V    L+N       
Sbjct: 3   NDWKQAKDPKGRVYYYNLKTKESRWDLPKSSTGTNKSISTEKQVSVKKNELKNKIDLEFL 62

Query: 54  ---YWNLVICKDGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRN 110
               W     K+G  +++N ++  S++   +                    + +  +L+N
Sbjct: 63  KLHGWRTAQTKEGRIYYYNVDTKESRWDPPN--------------------LPKNTSLKN 102

Query: 111 DRDVYGEIRDVLQAKLDSNDKEQNDITEERPQVTNSN-VDTEDKSESSNILXXXXXXXXX 169
             D+     D     L ++  EQN    E+ Q T  N  D   +S + + L         
Sbjct: 103 ADDIIK--NDSPVEPLSTSRPEQNMHDSEKKQPTFENKADVHSESLTHSNLSGSEDLEKY 160

Query: 170 XXXXXXXXXXKNDPSSIDVKEEDTLPSLNNTEIESKFIQLLNEIQLDPYSTWS---IQAK 226
                      N  S I       +  L  +E E +FIQ+L E Q+D  STWS   I + 
Sbjct: 161 -----------NKKSMIQC-----VTQLTKSEAEDQFIQMLTENQVD--STWSFGKIISD 202

Query: 227 RIMHDPRYYLI 237
               DPRY+++
Sbjct: 203 LGTVDPRYWVV 213

>TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa]
          {ON} Anc_2.649 YKL012W
          Length = 583

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 12/76 (15%)

Query: 2  SEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVICK 61
          S W+  KD +G  YY+NT++ VS  EKP       A ++ L+        ++ W +   K
Sbjct: 5  SLWRTAKDSNGKVYYYNTKTGVSQWEKP----GVSADIETLK--------QHGWGVARTK 52

Query: 62 DGSKFFHNDESNVSQF 77
          DG  +++N  +  S++
Sbjct: 53 DGKLYYYNSSTGESRW 68

>Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W
          (PRP40) - U1 snRNP protein [contig 244] FULL
          Length = 562

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 47/94 (50%), Gaps = 10/94 (10%)

Query: 1  MSEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVIC 60
          M  W    DP G  YY+N+ S  +T +KP+E  S+     EL++       ++ W     
Sbjct: 1  MGNWNEAHDPEGRVYYYNSESGETTWDKPRELYSEL----ELQLE------KHGWKTGET 50

Query: 61 KDGSKFFHNDESNVSQFKLADDESKALLDKVDTS 94
          + G  +++N+ S  S++++   ES    + V+++
Sbjct: 51 EGGKLYYYNESSGESRWEVPTFESDEKEEAVEST 84

>KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 564

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 10/79 (12%)

Query: 1  MSEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVIC 60
          MS WK   D  G  YY+N  S  +T +KP+E  +Q     EL++       ++ W     
Sbjct: 1  MSSWKEANDAEGRVYYYNADSGETTWDKPRELFTQL----ELKLE------KHGWKTGKT 50

Query: 61 KDGSKFFHNDESNVSQFKL 79
           +G  +++N E+  S +++
Sbjct: 51 DEGQVYYYNQETGKSCWEI 69

>ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKL012W
          (PRP40)
          Length = 569

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 15/80 (18%)

Query: 1  MSEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPL--RNYWNLV 58
          MS+WK  +D +G  YY+N++ + S   KP +             PV   P      W + 
Sbjct: 1  MSDWKEAQDSTGRVYYYNSKGETSWN-KPND------------TPVELEPRLEECGWKVA 47

Query: 59 ICKDGSKFFHNDESNVSQFK 78
            +DG+ +++N E+  S+++
Sbjct: 48 TTEDGNVYYYNRETGESRWE 67

>SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 568

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 10/76 (13%)

Query: 4  WKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVICKDG 63
          WK  KD  G  YY+NT +  +T  KP+E  S+     E R+      L + W +      
Sbjct: 6  WKEAKDLQGRIYYYNTATSETTWTKPQELYSEL----ERRL------LAHGWKVGSTAGK 55

Query: 64 SKFFHNDESNVSQFKL 79
            +++N+ S  S+++L
Sbjct: 56 QTYYYNEASGESRWEL 71

>CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012w PRP40 splicing factor
          Length = 590

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 12/77 (15%)

Query: 2  SEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNY-WNLVIC 60
           +WK+  D +G  YY+NT +K S  +KP E       +K+         LR+  WN+   
Sbjct: 3  GQWKKATDSNGKVYYYNTVTKESRWDKPVE---DTTDLKQ--------KLRDAGWNVAKT 51

Query: 61 KDGSKFFHNDESNVSQF 77
          K+G  +++N ++  S++
Sbjct: 52 KEGKVYYYNVKTKESRW 68

>TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa]
          {ON} Anc_2.649 YKL012W
          Length = 570

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 10/77 (12%)

Query: 2  SEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNYWNLVICK 61
          SEWK   D  G  YY+N ++  S  EKP+E  +++            + L++ W      
Sbjct: 5  SEWKEALDDKGRTYYYNAKNGESRWEKPQELFTEEE----------LVLLKHGWKSSRTA 54

Query: 62 DGSKFFHNDESNVSQFK 78
          +G  +++N  +  S+++
Sbjct: 55 EGKIYYYNSITKESRWE 71

>NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa]
          {ON} Anc_2.649 YKL012W
          Length = 647

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 2  SEWKRFKDPSGNFYYFNTRSKVSTKEKPKEF 32
          ++W+  KD  G  YY+N  +K S  EKPKE 
Sbjct: 12 NQWRSAKDAKGRIYYYNLITKESKWEKPKEL 42

>KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON}
          similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 571

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 13/71 (18%)

Query: 4  WKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRVPVFCLPLRNY-WNLVICKD 62
          W+  KDP G  YY+N   + +T EKP+E  ++           F   L  Y W   + +D
Sbjct: 3  WQETKDPQGRVYYYNDTGQ-TTWEKPEELFTE-----------FERKLLKYGWKTALAED 50

Query: 63 GSKFFHNDESN 73
          G  +++  ++ 
Sbjct: 51 GRVYYYKSDTG 61

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,007,282
Number of extensions: 1744631
Number of successful extensions: 6868
Number of sequences better than 10.0: 59
Number of HSP's gapped: 7009
Number of HSP's successfully gapped: 81
Length of query: 435
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 322
Effective length of database: 40,524,141
Effective search space: 13048773402
Effective search space used: 13048773402
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)