Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E03125g5.473ON36836818360.0
KLTH0F15048g5.473ON36836816060.0
Kwal_55.212735.473ON36836815860.0
Ecym_23135.473ON37037015740.0
SAKL0G03520g5.473ON36936915660.0
YOR136W (IDH2)5.473ON36936915550.0
Smik_15.3165.473ON36936915310.0
AFR137C5.473ON36736815290.0
Skud_15.3005.473ON36936915270.0
NDAI0C014105.473ON36936915250.0
KNAG0B040705.473ON37337315130.0
CAGL0I07227g5.473ON36835715110.0
Suva_8.1885.473ON36936915060.0
Kpol_440.125.473ON36836814910.0
NCAS0H022505.473ON42236914860.0
TDEL0A033705.473ON37137114800.0
KAFR0B063705.473ON37837814140.0
Kpol_543.85.473ON36836914130.0
ZYRO0D11220g5.473ON36836814000.0
TBLA0B022405.473ON37337313870.0
TPHA0J027705.473ON37635013590.0
TPHA0E014805.473ON37735612671e-175
KLLA0F04103g2.278ON3613737171e-91
ZYRO0D02838g2.278ON3613747134e-91
ADL223W2.278ON3623717031e-89
Smik_14.2902.278ON3603726986e-89
NDAI0B035902.278ON3593736986e-89
KLTH0G10186g2.278ON3603456971e-88
Ecym_33162.278ON3623716971e-88
Skud_14.2932.278ON3613726926e-88
YNL037C (IDH1)2.278ON3603726857e-87
SAKL0E07876g2.278ON3613746841e-86
Kwal_23.50122.278ON3613456831e-86
TBLA0B069102.278ON3653756831e-86
NCAS0B062902.278ON3593716701e-84
CAGL0G02673g2.278ON3583456587e-83
TPHA0D015602.278ON3603736571e-82
TDEL0C038402.278ON3613496552e-82
Kpol_1039.352.278ON3593716473e-81
KNAG0A052802.278ON3613626465e-81
KAFR0J014102.278ON3503736142e-76
Suva_14.3022.278ON3002865321e-64
SAKL0E07656g2.287ON3683534175e-47
Kpol_1003.392.287ON3703534176e-47
TBLA0B059402.287ON3693534167e-47
CAGL0G02585g2.287ON3723534142e-46
KNAG0A054202.287ON3723904132e-46
ADL214C2.287ON3673534106e-46
YIL094C (LYS12)2.287ON3713904081e-45
NDAI0B035502.287ON3723544072e-45
NCAS0B062502.287ON3733534045e-45
TPHA0C034102.287ON3713954046e-45
Suva_9.1052.287ON3713904037e-45
KLLA0E08339g2.287ON3693534028e-45
Skud_9.792.287ON3713954011e-44
ZYRO0A01914g2.287ON3683893992e-44
Ecym_33262.287ON3663533941e-43
Smik_9.852.287ON3713803942e-43
KAFR0J013602.287ON3733523853e-42
Kwal_27.115282.287ON3673573835e-42
KLTH0G10384g2.287ON3673553783e-41
TDEL0G021802.287ON3693523774e-41
AAL012C1.402ON3723592302e-20
KLLA0D04906g1.402ON3623132194e-19
YCL018W (LEU2)1.402ON3643642179e-19
Skud_3.431.402ON3643632152e-18
NDAI0G042301.402ON3633632152e-18
ZYRO0E04796g1.402ON3622742133e-18
Ecym_12961.402ON3632762133e-18
Smik_3.661.402ON3643642124e-18
TBLA0C015001.402ON3652782116e-18
TDEL0B060001.402ON3623112081e-17
NCAS0C048701.402ON3652742045e-17
Suva_3.31.402ON3642742011e-16
KAFR0I022001.402ON3652742002e-16
SAKL0D08690g1.402ON3642761958e-16
Kpol_1048.631.402ON3643641903e-15
KLTH0H12188g1.402ON3643601861e-14
KNAG0I012801.402ON4473681817e-14
TPHA0B037301.402ON3653651772e-13
CAGL0H03795g1.402ON3653641762e-13
Kwal_0.2251.402ON3643151753e-13
Suva_14.303singletonON53511275e-09
NDAI0K022406.344ON777109678.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E03125g
         (368 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   711   0.0  
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   623   0.0  
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   615   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   610   0.0  
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   607   0.0  
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   603   0.0  
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   594   0.0  
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   593   0.0  
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   592   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   592   0.0  
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   587   0.0  
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   586   0.0  
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   584   0.0  
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   578   0.0  
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    577   0.0  
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   574   0.0  
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   549   0.0  
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   548   0.0  
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   543   0.0  
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   538   0.0  
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   528   0.0  
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   492   e-175
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   280   1e-91
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   279   4e-91
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   275   1e-89
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   273   6e-89
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   273   6e-89
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   273   1e-88
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   273   1e-88
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   271   6e-88
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   268   7e-87
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   268   1e-86
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   267   1e-86
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            267   1e-86
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   262   1e-84
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   258   7e-83
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   257   1e-82
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   256   2e-82
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   253   3e-81
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              253   5e-81
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   241   2e-76
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   209   1e-64
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   165   5e-47
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   165   6e-47
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   164   7e-47
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   164   2e-46
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              163   2e-46
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   162   6e-46
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   161   1e-45
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   161   2e-45
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   160   5e-45
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   160   6e-45
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   159   7e-45
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   159   8e-45
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   159   1e-44
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   158   2e-44
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   156   1e-43
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   156   2e-43
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   152   3e-42
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   152   5e-42
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   150   3e-41
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   149   4e-41
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...    93   2e-20
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...    89   4e-19
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...    88   9e-19
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)    87   2e-18
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...    87   2e-18
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...    87   3e-18
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...    87   3e-18
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)    86   4e-18
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...    86   6e-18
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...    85   1e-17
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...    83   5e-17
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)       82   1e-16
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...    82   2e-16
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...    80   8e-16
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...    78   3e-15
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...    76   1e-14
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...    74   7e-14
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...    73   2e-13
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}              72   2e-13
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...    72   3e-13
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    54   5e-09
NDAI0K02240 Chr11 (504932..507265) [2334 bp, 777 aa] {ON} Anc_6....    30   8.1  

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/368 (95%), Positives = 350/368 (95%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA
Sbjct: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60

Query: 61  AKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKT 120
           AKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 61  AKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKT 120

Query: 121 FGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180
           FGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE
Sbjct: 121 FGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180

Query: 181 RVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVL 240
           RVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVL
Sbjct: 181 RVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVL 240

Query: 241 KTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPD 300
           KTVQHPEAYDDVVVVCPNLYGDI                  ANIGHTVSIFEAVHGSAPD
Sbjct: 241 KTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPD 300

Query: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSF 360
           IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSF
Sbjct: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSF 360

Query: 361 TDAVIERL 368
           TDAVIERL
Sbjct: 361 TDAVIERL 368

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/368 (82%), Positives = 325/368 (88%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           MF+ S V+ S RFLATKKQPSIGRYTGKP+P TGKYTVSFIEGDGVGPEISK+VK IF+A
Sbjct: 1   MFKSSFVRNSARFLATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60

Query: 61  AKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKT 120
           AK PI+WESCDVSP+F+NGLTTIP PA  SINKNLIALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 61  AKAPIQWESCDVSPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120

Query: 121 FGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180
           FGLFANVRPAKS++GYKT Y+NV+LVLIRENTEGEYSGIEHVV+PGVVQSIKLITQDASE
Sbjct: 121 FGLFANVRPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITQDASE 180

Query: 181 RVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVL 240
           RVIRYAFEYARAV+R KV+VVHKSTIQRLADGLFV VA++LS EYPDIELQTEL+DNTVL
Sbjct: 181 RVIRYAFEYARAVERPKVVVVHKSTIQRLADGLFVSVAEQLSKEYPDIELQTELIDNTVL 240

Query: 241 KTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPD 300
            TV+ P  Y DVVVVCPNLYGDI                  ANIGH VSIFEAVHGSAPD
Sbjct: 241 HTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPD 300

Query: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSF 360
           IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAV TTIA+  ++RTGDLGGSASTSSF
Sbjct: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSF 360

Query: 361 TDAVIERL 368
            +AVI RL
Sbjct: 361 AEAVISRL 368

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/368 (81%), Positives = 321/368 (87%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           MFR    + + RF ATKKQPSIGRYTGKP+P TGKYTVSFIEGDGVGPEISK+VK IF+A
Sbjct: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60

Query: 61  AKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKT 120
           AK PI+WE+CDV+P+F+NGLTTIP PA  SINKNLIALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120

Query: 121 FGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180
           FGLFANVRPAKSI+G+KT Y+NV+LVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE
Sbjct: 121 FGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180

Query: 181 RVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVL 240
           RVIRYAFEYARAV+R KVLVVHKSTIQRLADGLFV VA+KL+ EYPDIELQTEL+DNTVL
Sbjct: 181 RVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVL 240

Query: 241 KTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPD 300
            TV+ P  Y DVVVVCPNLYGDI                  ANIGH VSIFEAVHGSAPD
Sbjct: 241 HTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPD 300

Query: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSF 360
           IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAV +TIAS  +NRTGDL GSASTSSF
Sbjct: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSF 360

Query: 361 TDAVIERL 368
            +AVI RL
Sbjct: 361 AEAVISRL 368

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/370 (80%), Positives = 323/370 (87%), Gaps = 2/370 (0%)

Query: 1   MFRQSIVKQSCRFLAT--KKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIF 58
           MF+QSI K S R+LA+  +KQPSIGR+TGKPNPKTGKYTVSFIEGDG+GPEIS+SVK IF
Sbjct: 1   MFKQSIFKGSRRYLASASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDIF 60

Query: 59  SAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLR 118
           SAAKVP+EWE CDV+PIF+NGLTTIPDPAV SINKNL+ALKGPLATPIGKGHRSLNLTLR
Sbjct: 61  SAAKVPVEWEYCDVTPIFINGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLR 120

Query: 119 KTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDA 178
           KTFGLFANVRPAKSIEG+KTTYENV+LVLIRENTEGEYSGIEHVV+PGVVQSIKLIT+DA
Sbjct: 121 KTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDA 180

Query: 179 SERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNT 238
           SERVIRYAFEYARAV R KV+VVHKSTIQRLADGLFV+VA+++  EYPDIELQ EL+DNT
Sbjct: 181 SERVIRYAFEYARAVGRPKVVVVHKSTIQRLADGLFVNVAQEVGKEYPDIELQPELIDNT 240

Query: 239 VLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSA 298
           VL  V  PE Y D V VCPNLYGDI                  ANIGHTVSIFEAVHGSA
Sbjct: 241 VLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSA 300

Query: 299 PDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTS 358
           PDIAGQN ANPTALLLSSVMMLNHMGL EHAD+IE AVL T+ASD KNRT DL G+A+TS
Sbjct: 301 PDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTS 360

Query: 359 SFTDAVIERL 368
           SFT AVIERL
Sbjct: 361 SFTKAVIERL 370

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/369 (80%), Positives = 323/369 (87%), Gaps = 1/369 (0%)

Query: 1   MFRQSIVKQ-SCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59
           M R  +++Q   RFL++KKQPSIGR+TGKPNP TGKYTVSFIEGDGVGPEISKSVK IF+
Sbjct: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60

Query: 60  AAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AA+VP+EWESCDV+P+F+NGLTTIP PAV SINKNLIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120

Query: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TFGLFANVRPAKS+EG+KTTYENV+LVLIRENTEGEYSGIEHVV+PGVVQSIKLIT+DAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180

Query: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTV 239
           ERVIRYAFEYARAV R KV+VVHKSTIQRLADGLFVDVAK+LSSEYPDI+LQ +LLDNTV
Sbjct: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240

Query: 240 LKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAP 299
           L  V +P AY D V VCPNLYGDI                  ANIGH VSIFEAVHGSAP
Sbjct: 241 LNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 300

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSS 359
           DIAGQNKANPTALLLSSVMMLNHMGL E AD IEKAVL+TIAS  +NRT DL GSASTSS
Sbjct: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360

Query: 360 FTDAVIERL 368
           FT+AVI+RL
Sbjct: 361 FTEAVIKRL 369

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/369 (79%), Positives = 321/369 (86%), Gaps = 1/369 (0%)

Query: 1   MFRQSIVKQ-SCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59
           M R +  +  S RFLAT KQPSIGRYTGKPNP TGKYTVSFIEGDG+GPEISKSVK IFS
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 60  AAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AA VPIEWESCDVSPIFVNGLTTIPDPAV SI KNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TFGLFANVRPAKSIEG+KTTYENV+LVLIRENTEGEYSGIEH+V PGVVQSIKLIT+DAS
Sbjct: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTV 239
           ERVIRYAFEYARA+ R +V+VVHKSTIQRLADGLFV+VAK+LS EYPD+ L+TEL+DN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSV 240

Query: 240 LKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAP 299
           LK V +P AY D V VCPNLYGDI                  ANIGH +SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSS 359
           DIAGQ+KANPTALLLSSVMMLNHMGLT HAD+I+ AVL+TIAS  +NRTGDL G+A+TSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 360 FTDAVIERL 368
           FT+AVI+RL
Sbjct: 361 FTEAVIKRL 369

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/369 (78%), Positives = 320/369 (86%), Gaps = 1/369 (0%)

Query: 1   MFRQSIVKQ-SCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59
           M R +  +  S RFLAT KQPSIG+YTGKPNP TGKYTVSFIEGDG+GPEISKSVK IFS
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 60  AAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AA VPIEWE CDV+PIFVNGLTTIPDPAV SI KNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TFGLFANVRPAKS+EG+KTTYENV+LVLIRENTEGEYSGIEH+V PGVVQSIKLIT+DAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTV 239
           ERVIRYAFEYARA+ R +V+VVHKSTIQRLADGLFV+VAK+LS EYPDI L+TEL+DN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDITLETELIDNSV 240

Query: 240 LKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAP 299
           LK V +P AY + V VCPNLYGDI                  ANIGH +SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSS 359
           DIAGQ+KANPTALLLSSVMMLNHMGLT +AD+I+ AVL+TIAS  +NRTGDL G+A+TSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAATTSS 360

Query: 360 FTDAVIERL 368
           FT+AVI+RL
Sbjct: 361 FTEAVIKRL 369

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/368 (79%), Positives = 317/368 (86%), Gaps = 1/368 (0%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           M RQ + + S R+LA+ +QPSIGRY GKPN   GKYTVSFIEGDGVGPEIS+SVK IFSA
Sbjct: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFSA 59

Query: 61  AKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKT 120
           A VP+EWE CDV+P+ VNGLTTIP+PAVASINKNL+ALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 60  ASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKT 119

Query: 121 FGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180
           FGLFANVRPAKSIEGYKTTY +V+LVLIRENTEGEYSGIEHVV+PGVVQSIKLIT++ASE
Sbjct: 120 FGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASE 179

Query: 181 RVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVL 240
           RVIRYAFEYAR V R KV+VVHKSTIQRLADGLFV+VA++L  EYPDIELQTELLDNTVL
Sbjct: 180 RVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVL 239

Query: 241 KTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPD 300
             V  PEAY DVV VCPNLYGDI                  ANIGH VSIFEAVHGSAPD
Sbjct: 240 NVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAPD 299

Query: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSF 360
           IAGQN+ANPTALLLSSVMMLNHMGL EHA +IEKAVL+TIAS  +NRT DL G+ASTSSF
Sbjct: 300 IAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSF 359

Query: 361 TDAVIERL 368
           T+AVIERL
Sbjct: 360 TNAVIERL 367

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/369 (77%), Positives = 320/369 (86%), Gaps = 1/369 (0%)

Query: 1   MFRQSIVKQ-SCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59
           M R ++ +  S RFLAT KQPSIGR+TGKPNP TG+YTVSFIEGDG+GPEISKSVK IF+
Sbjct: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60

Query: 60  AAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AA VPIEWESCDV+PIFVNGLTTIPD AV SI  NLIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120

Query: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TFGLFANVRPAKS+EG+KTTYENV+LVLIRENTEGEYSGIEH+V PGVVQSIKLIT+DAS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTV 239
           ERVIRYAFEYARA+ R +V+VVHKSTIQRLADGLFV+VAK+LS EYPDI L+TEL+DN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240

Query: 240 LKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAP 299
           LK V +P AY + V VCPNLYGDI                  ANIGH +SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSS 359
           DIAGQ+KANPTALLLSSVMMLNHMGLT HAD+I+ AVL+TIAS  +NRTGDL G+A+TSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 360 FTDAVIERL 368
           FT+AVI+RL
Sbjct: 361 FTEAVIKRL 369

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/369 (77%), Positives = 318/369 (86%), Gaps = 1/369 (0%)

Query: 1   MFRQSIVKQSCR-FLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59
           MFR  I++ + R FL+ K QPSIG++TGKPNP TGK+TVSFIEGDG+GPEIS+SVK IF 
Sbjct: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60

Query: 60  AAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AAKVPI+WE CDVSP+F+NGLTTIP+PAV SINKNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TFGLFANVRPAKSIEG+KT Y+NV+LV+IRENTEGEYSGIEHVV PGVVQSIKLIT+DAS
Sbjct: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180

Query: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTV 239
           ERVIRYA+EYARA+ R +V+VVHKSTIQRLADGLFVDVAK+LS EYPDI+L+TEL+DNTV
Sbjct: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240

Query: 240 LKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAP 299
           L  V +P +Y + V VCPNLYGDI                  ANIGH VSIFEAVHGSAP
Sbjct: 241 LNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 300

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSS 359
           DIAGQNKANPTALLLSSVMMLNHMGL  HADKIEKAVL+TIAS  + RTGDL G A+TSS
Sbjct: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360

Query: 360 FTDAVIERL 368
           FTDAVI RL
Sbjct: 361 FTDAVIGRL 369

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/373 (77%), Positives = 320/373 (85%), Gaps = 5/373 (1%)

Query: 1   MFRQSIVKQSC---RFLAT--KKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVK 55
           M R S+++ S    RFLAT  K QPSIGR+TGKPNP TGK+ VSFIEGDG+GPEIS+SVK
Sbjct: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60

Query: 56  AIFSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 115
            IF AA+VPI WE CDV+PIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120

Query: 116 TLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 175
           TLRKTF LFANVRPAKSIEG+KTTY +V+LVLIRENTEGEYSGIEHVVAPGVVQSIKLIT
Sbjct: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 176 QDASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELL 235
           +DASERVIRYAFEYA+A+ R +V+VVHKSTIQRLADGLFV+VAK+LS EYP+I+L+TEL+
Sbjct: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240

Query: 236 DNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVH 295
           DNTVL  V +P  Y D V VCPNLYGDI                  ANIG+ +SIFEAVH
Sbjct: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVH 300

Query: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSA 355
           GSAPDIAGQNKANPTALLLSSVMMLNHMGL + A +IE+AVLTTIAS +KNRTGDLGGSA
Sbjct: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360

Query: 356 STSSFTDAVIERL 368
           +TSSFTDAVI+ L
Sbjct: 361 TTSSFTDAVIKNL 373

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/357 (78%), Positives = 315/357 (88%), Gaps = 1/357 (0%)

Query: 12  RFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSAAKVPIEWESCD 71
           RFLAT  QPSIGR+TGKPNP TGK+TVSFIEGDG+GPEIS SVK IF AA VP+EWE+CD
Sbjct: 13  RFLATA-QPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRIFQAADVPVEWETCD 71

Query: 72  VSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAK 131
           V+PIFVNGLTTIPDPAV SINKNL+ALKGPLATPIGKGHRSLNLTLRKTF LFANVRPAK
Sbjct: 72  VTPIFVNGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRKTFNLFANVRPAK 131

Query: 132 SIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYAR 191
           SIEG+KTTYENV+LVLIRENTEGEYSGIEH+V+PGVVQSIKLIT+DASERVIRYA+EYAR
Sbjct: 132 SIEGFKTTYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLITRDASERVIRYAYEYAR 191

Query: 192 AVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKTVQHPEAYDD 251
           A+ R +++VVHKSTIQRLADGLFV+VAK+L++EYPDI+L+TEL+DNT L  V +P +Y D
Sbjct: 192 AIGRPRLIVVHKSTIQRLADGLFVNVAKELAAEYPDIQLETELIDNTCLNVVSNPSSYTD 251

Query: 252 VVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTA 311
            V VCPNLYGDI                  ANIGH VSIFEAVHGSAPDIAGQNKANPTA
Sbjct: 252 AVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTA 311

Query: 312 LLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           LLLSSVMMLNHMG+TEHAD+IEKAVL TIA  ++ RTGDLGGSAST+SFTDA+I++L
Sbjct: 312 LLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTDAIIKKL 368

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/369 (76%), Positives = 317/369 (85%), Gaps = 1/369 (0%)

Query: 1   MFRQSIVKQ-SCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59
           M R + ++  S RFL+T KQPSIGRYTGKP+P TG+YTVSFIEGDG+GPEISKSVK IFS
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 60  AAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AA VPI WE CDV+PIFVNGLTTIPDPAV SI KNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TFGLFANVRPAKSIEG+KTTYENV+LVLIRENTEGEYSGIEH+V PGVVQSIKLIT++AS
Sbjct: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180

Query: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTV 239
           ERVIRYAFEYARA+ R +++VVHKSTIQRLADGLFV+VAK+LS EYPDI  +TEL+DN V
Sbjct: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240

Query: 240 LKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAP 299
           L  V +P AY + V VCPNLYGDI                  ANIGH VSIFEAVHGSAP
Sbjct: 241 LNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 300

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSS 359
           DIAG++KANPTALLLSSVMMLNHMGLT HAD+I+ AVL+TIAS  +NRTGDL G+A+TSS
Sbjct: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 360 FTDAVIERL 368
           FT+AVI+RL
Sbjct: 361 FTEAVIKRL 369

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/368 (75%), Positives = 313/368 (85%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           M R +I + S   + T  QP+IGR+TGKPNP TGKYTV FIEGDGVGPEISKSVK IF+A
Sbjct: 1   MLRNTIYRGSFARMMTTGQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFAA 60

Query: 61  AKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKT 120
           AKVPIEWE CDV PIFVNGLTTIPD AV SINK+L+ALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 61  AKVPIEWEPCDVGPIFVNGLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLNLTLRKT 120

Query: 121 FGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180
           F LFANVRPA+S+  YKTTY+NV+LVLIRENTEGEYSGIEHV++PGV+QSIKLIT+DASE
Sbjct: 121 FNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLITKDASE 180

Query: 181 RVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVL 240
           RVIRYAFEY RA+ R +++VVHKSTIQR+ADGLFV+VAK+L+SEYPDIELQTEL+DNT+L
Sbjct: 181 RVIRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKELASEYPDIELQTELIDNTIL 240

Query: 241 KTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPD 300
             V HPE+Y D V VCPNLYGDI                  ANIG  VSIFEAVHGSAPD
Sbjct: 241 NVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPD 300

Query: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSF 360
           IAGQNKANPTALLLSSVMMLNHMGL EHA KIE A+L+TIAS ++NRTGDL G+A+TSSF
Sbjct: 301 IAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSF 360

Query: 361 TDAVIERL 368
           T+AVI +L
Sbjct: 361 TEAVINKL 368

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/369 (74%), Positives = 320/369 (86%), Gaps = 1/369 (0%)

Query: 1   MFRQSIVKQSCR-FLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59
           MFR SI++ + R  L+ K QPSIG+YTGKPNP TGKYTVSFIEGDG+GPEIS SVK IFS
Sbjct: 54  MFRSSILRTTTRRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFS 113

Query: 60  AAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AAKVPIEWE+CDV+P+F++GLTTIP+PAV SINKNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 114 AAKVPIEWETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 173

Query: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TFGLFANVRPA+S++G+KTTY NV+LVLIRENTEGEYSGIEHVV PGVVQSIKLIT++AS
Sbjct: 174 TFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREAS 233

Query: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTV 239
           ERVIRYAFEY RA+ R +++VVHKSTIQRL+DGLFV+VAK+LS EYPDI+ +TEL+DNTV
Sbjct: 234 ERVIRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTV 293

Query: 240 LKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAP 299
           LK V +P +Y D V VCPNLYGDI                   NIG+ +SIFEAVHGSAP
Sbjct: 294 LKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAP 353

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSS 359
           DIAG+N ANPTALLLSSVMMLNHMGL++HAD+IE AVL+TIAS  ++RTGDL G+A+TS+
Sbjct: 354 DIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTST 413

Query: 360 FTDAVIERL 368
           FTDAVI++L
Sbjct: 414 FTDAVIKKL 422

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/371 (76%), Positives = 316/371 (85%), Gaps = 3/371 (0%)

Query: 1   MFRQSIVKQSC-RFLA--TKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAI 57
           M R  I +++  R LA  T KQPSIG+YTGKP+PKTGKYTVSFIEGDGVGPEISKSVK I
Sbjct: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60

Query: 58  FSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTL 117
           F+AAKVPI WESC V+P+ VNG+TTIP+ A  SIN+NL+ALKGPLATPIGKGHRS+NLTL
Sbjct: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120

Query: 118 RKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQD 177
           RKTFGLFANVRPAKS+EG+KTTYE+V+LVLIRENTEGEY+GIEHV+ PGVVQSIKLIT++
Sbjct: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180

Query: 178 ASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDN 237
           ASERVIRYA+EYARAV R K++VVHKSTIQRLADGLFV VAK+L+ E+PDI+LQTEL+DN
Sbjct: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240

Query: 238 TVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGS 297
           TVL  V +P  Y DVV VCPNLYGDI                   NIGH VSIFEAVHGS
Sbjct: 241 TVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGS 300

Query: 298 APDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSAST 357
           APDIAGQNKANPTALLLSSVMMLNHMGL EHA KIEKAVLTTIA+  ++RTGDL GSAST
Sbjct: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360

Query: 358 SSFTDAVIERL 368
           SSFT+AVI RL
Sbjct: 361 SSFTEAVISRL 371

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/378 (71%), Positives = 311/378 (82%), Gaps = 10/378 (2%)

Query: 1   MFRQSIVKQ------SCRFLATK--KQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISK 52
           M RQ+++ +      + RFL+ +  +QPSIGR+TGKP+  TGKYTVSFIEGDG+GPEIS+
Sbjct: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60

Query: 53  SVKAIFSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRS 112
           SVK IF AA VPI WE+CDVSPI V+GLTTIPD AV SINKNL+ LKGPLATPIGKGHRS
Sbjct: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120

Query: 113 LNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIK 172
           LNLTLRKTF LFANVRPAKS+ G+KTTY+NV+LVLIRENTEGEYSGIEHVV PGVVQSIK
Sbjct: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180

Query: 173 LITQDASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSE--YPDIEL 230
           LIT+DASERVIRYAFEYA+A+ R KV+VVHKSTIQRL+DGLFV+VAK+L  E  + +IEL
Sbjct: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240

Query: 231 QTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSI 290
            TEL+DNTVL  V +P  Y D V VCPNLYGDI                  ANIG  +SI
Sbjct: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISI 300

Query: 291 FEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGD 350
           FEAVHGSAPDIAGQNKANPTALLLSSVMML+HMGL E+ DKIE AVL TIA+ +KNRTGD
Sbjct: 301 FEAVHGSAPDIAGQNKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGD 360

Query: 351 LGGSASTSSFTDAVIERL 368
           LGG+A+T+SFT+AVI+ L
Sbjct: 361 LGGTATTTSFTEAVIDNL 378

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/369 (72%), Positives = 307/369 (83%), Gaps = 2/369 (0%)

Query: 1   MFRQSI-VKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59
           MF   + ++   RFL+T  QPSIGR+TGKP+P TGK+TV FIEGDGVGPEIS+SVK IFS
Sbjct: 1   MFNSRLQLRTVSRFLSTG-QPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKIFS 59

Query: 60  AAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRK 119
           AAKVPIEW  CDV PIFVNG TTIP+PAV  INK+LIALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AAKVPIEWVPCDVGPIFVNGQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLNLTLRK 119

Query: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
           TF LFANVRPA+SI  YK+TYENV+LVLIRENTEGEYSGIEHV+ PGV+QSIKLIT++A+
Sbjct: 120 TFNLFANVRPARSIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLITREAT 179

Query: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTV 239
           ERV+RYAFEY +A+ R ++LV+HKSTIQR+ADGLFV VA++L+SEYPDI+L+TE++D ++
Sbjct: 180 ERVVRYAFEYTQAIGRPRLLVIHKSTIQRMADGLFVKVAEELASEYPDIKLETEIIDKSI 239

Query: 240 LKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAP 299
           L  V  PE Y D V VCPNLYGDI                  ANIG  VSIFEAVHGSAP
Sbjct: 240 LNVVSKPELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAP 299

Query: 300 DIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSS 359
           DIAGQNKANPTALLLSSVMML HMGL EHA+KIE AVLTTIAS ++NRT DL G+ASTSS
Sbjct: 300 DIAGQNKANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSS 359

Query: 360 FTDAVIERL 368
           FT+ VI+RL
Sbjct: 360 FTEEVIQRL 368

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/368 (70%), Positives = 309/368 (83%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           MF+  + +++   + + KQPSIG++TGKP+PKTG Y VSFIEGDG+GPEISKSVK IF+A
Sbjct: 1   MFKSQVCRRAVARMFSSKQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIFAA 60

Query: 61  AKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKT 120
           AKVP+++ES  V PI VNG+T+IP+ A  SIN NL+ALKGPLATP+GKGHRS+NLTLRKT
Sbjct: 61  AKVPVDFESVVVKPILVNGVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMNLTLRKT 120

Query: 121 FGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180
           FGLFAN+RPAKS+EG+KT Y+NVNLVLIRENTEGEY+GIEH + PGVVQSIKLIT++ASE
Sbjct: 121 FGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLITREASE 180

Query: 181 RVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVL 240
           RVIR+A+EYARA +R +++VVHKSTIQRL+DGLFVDVAK+L SE+PDI+L+TEL+DN VL
Sbjct: 181 RVIRFAYEYARAAERPRLIVVHKSTIQRLSDGLFVDVAKELQSEFPDIKLETELIDNAVL 240

Query: 241 KTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPD 300
            TV  P  Y D V VCPNLYGDI                   NIGH VSIFEAVHGSAPD
Sbjct: 241 NTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPD 300

Query: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSF 360
           IAG++KANPTALLLSSVMML+HMGL EHA +IEKAVLTTIA+  ++RTGDL GSASTSSF
Sbjct: 301 IAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSF 360

Query: 361 TDAVIERL 368
           T+AVI++L
Sbjct: 361 TEAVIKKL 368

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/373 (69%), Positives = 307/373 (82%), Gaps = 5/373 (1%)

Query: 1   MFRQSIVKQSCRFLAT-----KKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVK 55
           M R    KQS R L +     +    +G+Y G PNP TG++TV FIEGDGVGPEISKSVK
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 56  AIFSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 115
            IF AA+VP++WE CDVSP+ +NGLTTIP+PAV  INK+ IALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120

Query: 116 TLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 175
           TLRKTFGLFANVRPA+SI GY+TTY+NV+LVLIRENTEGEYSGIEHVVAPGVVQSIKLIT
Sbjct: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 176 QDASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELL 235
           +DASERVIRYA+EYARA+ R +++VVHKSTIQ+LADGLFV++AK+L+ E+PDI+L+TEL+
Sbjct: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240

Query: 236 DNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVH 295
           DNTVL  V+ P +Y D V VCPNLYGDI                  ANIG+ VSIFEAVH
Sbjct: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVH 300

Query: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSA 355
           GSAPDIAGQNKANPTALLLSS MMLN+MGL  +++KIE A+L TIAS ++NRTGDL G+A
Sbjct: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360

Query: 356 STSSFTDAVIERL 368
           +TSSFT++VI+ L
Sbjct: 361 TTSSFTESVIKNL 373

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/350 (73%), Positives = 293/350 (83%), Gaps = 1/350 (0%)

Query: 19  QPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSAAKVPIEWESCDVSPIFVN 78
           QP+IGR+TGK N  +G YTV FIEGDGVGPEISKSVK IFSAA VPI+W+ CDV PIFVN
Sbjct: 28  QPTIGRFTGKTN-SSGTYTVPFIEGDGVGPEISKSVKDIFSAANVPIQWQPCDVGPIFVN 86

Query: 79  GLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGYKT 138
           GLTTIP+PAV +I ++L+ALKGPLATP+GKGHRSLNLTLRKTF LFANVRPAKS+  YK+
Sbjct: 87  GLTTIPEPAVKAIKESLVALKGPLATPVGKGHRSLNLTLRKTFDLFANVRPAKSVPNYKS 146

Query: 139 TYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVDRSKV 198
           TYENV+LVLIRENTEGEYSGIEH+V PGVVQSIKLIT++ASE+VIRYA+EYA AV R ++
Sbjct: 147 TYENVDLVLIRENTEGEYSGIEHIVTPGVVQSIKLITREASEKVIRYAYEYAIAVGRPRL 206

Query: 199 LVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPN 258
           +VVHKSTIQRL DGLFV +A +L SEYP I+L+T++LDNTVL  V +P  Y D V VCPN
Sbjct: 207 IVVHKSTIQRLGDGLFVQIANELQSEYPSIKLETQILDNTVLNVVSNPTLYKDAVSVCPN 266

Query: 259 LYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVM 318
           LYGDI                  ANIG  VSIFEAVHGSAPDIAGQNKANPTALLLSSVM
Sbjct: 267 LYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVM 326

Query: 319 MLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           MLNHMGL EHA +IE AVL+TIAS  ++RTGDLGGSA+TSSFT+ VI++L
Sbjct: 327 MLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  492 bits (1267), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 237/356 (66%), Positives = 282/356 (79%), Gaps = 1/356 (0%)

Query: 13  FLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSAAKVPIEWESCDV 72
           F+    + SIG + GKPNP+TG YTV FIEGDGVGPEISKSV+ IF AAKVPI+W +CD+
Sbjct: 22  FMTAADKISIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSVRTIFKAAKVPIDWVNCDI 81

Query: 73  SPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAKS 132
            P+ +NG TTIP  AV  IN +LIALKGPLATP+G+GHRS+NLTLRKTFGLFANVRPAKS
Sbjct: 82  GPLLINGETTIPQTAVDQINNSLIALKGPLATPVGQGHRSINLTLRKTFGLFANVRPAKS 141

Query: 133 IEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARA 192
           I    +TYENV+L++IRENTEGEYSGIEH + PGVVQSIKLIT+ ASE+VI+YAFEY R+
Sbjct: 142 IPNLASTYENVDLIVIRENTEGEYSGIEHEIVPGVVQSIKLITRKASEKVIKYAFEYTRS 201

Query: 193 VDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKTVQHPEAYDDV 252
           + RS ++VVHK+TIQR  DGLFV  A++++ +YPD+ L+ EL+DNTVL  + +PE Y D 
Sbjct: 202 IGRSNLIVVHKATIQRRGDGLFVQTAQEMADKYPDVNLKLELIDNTVLNCIMNPEKYADS 261

Query: 253 VVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTAL 312
           V VCPNLYGDI                  ANIG TV ++EAVHGSAPDIAGQ+KANPTAL
Sbjct: 262 VSVCPNLYGDILSDLNSGLSTGSLGLTPSANIGETV-LYEAVHGSAPDIAGQDKANPTAL 320

Query: 313 LLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           LLSSVMMLNHMGL ++AD IE AVLTTI S  + RT DLGGSA+T+SFT AVIE L
Sbjct: 321 LLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  280 bits (717), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 160/373 (42%), Positives = 223/373 (59%), Gaps = 20/373 (5%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           M RQ I  Q   F     +  +      P    G+YTV+ I GDGVG E++ SV  IF  
Sbjct: 1   MLRQGIAAQKKSFATLAAEQLL------PKKYGGRYTVTLIPGDGVGKEVTDSVVKIFEN 54

Query: 61  AKVPIEWESCDVSPIFVNGLTTIPD--PAVASINKNLIALKGPLATPIGK-GHRSLNLTL 117
             +PI+WE+ D+S     GL    +   AV S+ +N + LKG   TP  + GH SLN+ L
Sbjct: 55  ENIPIDWETIDIS-----GLENTENVQRAVESLKRNKVGLKGIWHTPADQTGHGSLNVAL 109

Query: 118 RKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQD 177
           RK   +FANV   KSI G KT   N+++V+IRENTEGEYSG+EH   PGVV+S+K++T+ 
Sbjct: 110 RKQLDIFANVALFKSIPGVKTRLNNIDMVIIRENTEGEYSGLEHESVPGVVESLKIMTRA 169

Query: 178 ASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKL-SSEYPDIELQTELLD 236
            SER+ R+AF++A   +R  V  VHK+ I +L DGLF +   ++ ++EYP+++++  ++D
Sbjct: 170 KSERIARFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNTVNEIGANEYPELDVKNIIVD 229

Query: 237 NTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFE-AVH 295
           N  ++ V  P  +D  V+V PNLYG I                  AN G   ++FE    
Sbjct: 230 NASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGSALIGGPGLVPGANFGREYAVFEPGSR 286

Query: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSA 355
               DI GQN ANPTA++LSS +ML H+GL  +AD+I KA    I S+ K+ T D+GGSA
Sbjct: 287 HVGLDIKGQNVANPTAMILSSTLMLRHLGLNAYADRISKATYDVI-SEGKSTTRDIGGSA 345

Query: 356 STSSFTDAVIERL 368
           STS FT+AVIE+L
Sbjct: 346 STSEFTNAVIEKL 358

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  279 bits (713), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 160/374 (42%), Positives = 234/374 (62%), Gaps = 22/374 (5%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           MFR S+ K++   +AT ++         P    G+YTV+ I GDGVG E++ SV +IF A
Sbjct: 1   MFRHSLTKRTLATVATTEKML-------PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFKA 53

Query: 61  AKVPIEWESCDVSPIFVNGLTTIPD--PAVASINKNLIALKGPLAT-PIGK-GHRSLNLT 116
             VP++W+  D+S     G+    D   AV S+ +N I LKG   T P  + GH SLN+ 
Sbjct: 54  ENVPVDWDRVDIS-----GVDRAEDVKSAVESLKRNRIGLKGIWHTSPADQAGHGSLNVA 108

Query: 117 LRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQ 176
           LRK   ++ANV   KSI G +    +V+LV+IRENTEGE+SG+EH   PGVV+S+K++TQ
Sbjct: 109 LRKELDIYANVARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEHESVPGVVESLKIMTQ 168

Query: 177 DASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSS-EYPDIELQTELL 235
           D  ER+ R+AF+YA+  DR +V+ VHK+ I ++ DGLF ++ +++   EYP++++   ++
Sbjct: 169 DNIERIARFAFDYAKKNDRKQVVAVHKANIMKMGDGLFKNLVQEVGEKEYPELQVGNIIV 228

Query: 236 DNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFE-AV 294
           DN  ++TV +P  +D  V+V P++YG I                  AN G  V++FE   
Sbjct: 229 DNASMQTVANPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANYGRDVALFEPGS 285

Query: 295 HGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGS 354
                DI GQN ANPTA++LSSV++LNH+GL   AD+I KAV   IA + K+ T D+GG+
Sbjct: 286 RHVGLDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIA-EGKSVTRDIGGT 344

Query: 355 ASTSSFTDAVIERL 368
           AST+ FT+AVI +L
Sbjct: 345 ASTTEFTEAVINKL 358

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  275 bits (703), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 155/371 (41%), Positives = 224/371 (60%), Gaps = 15/371 (4%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           MFR ++         TK+  + GR    P    G+YTV+ I GDG+G E++ SV  IF A
Sbjct: 1   MFRNTLSH------ITKRGYAAGREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFEA 54

Query: 61  AKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLRK 119
             VP++WES ++S +  N        AV S+ +N + LKG   TP  + GH SLN+  RK
Sbjct: 55  ENVPVDWESVELSALEENHEGV--QKAVESLKRNKVGLKGIWHTPADQTGHGSLNVAFRK 112

Query: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
              +FANV   KS  G KT  ++V+LV+IRENTEGEYSG+EH   PGVV+S+K++T+  S
Sbjct: 113 QLDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAKS 172

Query: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSS-EYPDIELQTELLDNT 238
           ER+ R+AF++A   +R  V  VHK+ I +L DGLF +   ++ + EYP++ + + ++DN 
Sbjct: 173 ERIARFAFDFALKNNRKAVCAVHKANIMKLGDGLFRNTVSEIGAKEYPEVNVSSIIVDNA 232

Query: 239 VLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFE-AVHGS 297
            ++ V  P  +D  V+V PNLYG I                  AN G   ++FE      
Sbjct: 233 SMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGCRHV 289

Query: 298 APDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSAST 357
             DI GQ+ ANPTA++LSS +ML H+GL E+AD+I +A   TIA + K  T D+GG+A+T
Sbjct: 290 GLDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIA-EGKRTTKDIGGTATT 348

Query: 358 SSFTDAVIERL 368
           + FT+AVI++L
Sbjct: 349 TEFTNAVIDKL 359

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  273 bits (698), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 156/372 (41%), Positives = 229/372 (61%), Gaps = 19/372 (5%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           M  ++I K   R LAT  Q         P    G++TV+ I GDGVG EI+ SVK IF A
Sbjct: 1   MLNRTIAK---RTLATAAQAE----RALPKKYGGRFTVTLIPGDGVGKEITDSVKTIFEA 53

Query: 61  AKVPIEWESCDVSPI-FVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLR 118
            K+P++WE+ ++       G+      AV S+ +N I LKG   TP  + GH SLN+ LR
Sbjct: 54  EKIPVDWETVNIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALR 109

Query: 119 KTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDA 178
           K   ++ANV   KS++G KT   +++L++IRENTEGE+SG+EH   PGVV+S+K++T+  
Sbjct: 110 KQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKIMTRPK 169

Query: 179 SERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSS-EYPDIELQTELLDN 237
           +ER+ R+AF++A+  +R  V  VHK+ I +L DGLF ++  ++   EYPDI++ + ++DN
Sbjct: 170 TERIARFAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDN 229

Query: 238 TVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFE-AVHG 296
             ++ V  P  +D  V+V P++YG I                  AN G   ++FE     
Sbjct: 230 ASMQAVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRH 286

Query: 297 SAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSAS 356
              DI GQN ANPTA++LSSV+MLNH+GL E+A +I KAV  TIA + K+ T D+GGS+S
Sbjct: 287 VGLDIKGQNVANPTAMILSSVLMLNHLGLNEYATRISKAVHETIA-EGKHTTKDIGGSSS 345

Query: 357 TSSFTDAVIERL 368
           T+ FT+ +I +L
Sbjct: 346 TTDFTNEIINKL 357

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  273 bits (698), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 161/373 (43%), Positives = 226/373 (60%), Gaps = 22/373 (5%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           MF+ S+ K+S   LA        + T  P    G++TV+ + GDGVG EI+ SV +IF +
Sbjct: 1   MFKHSVTKRSLVTLA--------KETIIPKKYGGRFTVTLLPGDGVGKEITDSVVSIFKS 52

Query: 61  AKVPIEWESCDVSPIFVNGL--TTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTL 117
             VPI+WE+ D+S     GL  T     AV S+ +N I LKG   TP  + GH SLN+  
Sbjct: 53  ENVPIDWETVDIS-----GLDHTEGVKAAVDSLKRNKIGLKGIWHTPADQVGHGSLNVAF 107

Query: 118 RKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQD 177
           RK   ++ANV   KSIEG KT   NV+LV+IRENTEGEYSG+EH   PGVV+S+K+IT+ 
Sbjct: 108 RKQLDIYANVAIFKSIEGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKS 167

Query: 178 ASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLS-SEYPDIELQTELLD 236
            SER+ R+AF++A+  +R  V  VHK+ I +L+DGLF +   K+   EYP+I+  + ++D
Sbjct: 168 KSERIARFAFDFAKRNNRKSVTAVHKANIMKLSDGLFRNTVSKIGEEEYPEIQTSSIIVD 227

Query: 237 NTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFE-AVH 295
           N  ++ V  P  +D  V+V P++YG I                   N G   ++FE    
Sbjct: 228 NASMQAVAKPHQFD--VMVTPSMYGTI-VGNIGAALIGGPGLVPGVNYGRDYAVFEPGSR 284

Query: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSA 355
               DI GQN ANPTA+LLS+ ++L+H+GL + A++I+ AV   IA + K  T D+GGSA
Sbjct: 285 HVGLDIKGQNVANPTAMLLSATLLLDHLGLEKSANRIKSAVYDVIA-EGKATTQDIGGSA 343

Query: 356 STSSFTDAVIERL 368
           ST+ FT AVI +L
Sbjct: 344 STTEFTQAVINKL 356

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  273 bits (697), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 153/345 (44%), Positives = 215/345 (62%), Gaps = 14/345 (4%)

Query: 29  PNPKTGKYTVSFIEGDGVGPEISKSVKAIFSAAKVPIEWESCDVSPIFVNGLTTIP--DP 86
           P    G+YTV+ I GDGVG E++ SV +IF +  VPI+WE+ ++S     GL        
Sbjct: 22  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENVPIDWETVEIS-----GLDNEEGVQK 76

Query: 87  AVASINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNL 145
           AV S+ +N + LKG   TP  + GH SLN+ LRK   +FANV   K++ G  + + NV+L
Sbjct: 77  AVDSLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDL 136

Query: 146 VLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVDRSKVLVVHKST 205
           V+IRENTEGEYSG+EH   PGVV+S+K++T+  S+R+ R+AF++A   +R  V  VHK+ 
Sbjct: 137 VVIRENTEGEYSGLEHESVPGVVESLKIMTKAKSDRIGRFAFDFALKNNRKSVCAVHKAN 196

Query: 206 IQRLADGLFVDVAKKLSS-EYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIX 264
           I +L DGLF +   ++ + EYP+IE++  ++DN  ++ V  P  +D  V+V PNLYG I 
Sbjct: 197 IMKLGDGLFRNCINEIGAKEYPEIEVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 253

Query: 265 XXXXXXXXXXXXXXXXXANIGHTVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 323
                            AN G   ++FE        DI GQN ANPTA++LSS +ML H+
Sbjct: 254 LGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHL 313

Query: 324 GLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           GL  +AD+I KA    IA +AKN T D+GGSAST+ FT A+IE+L
Sbjct: 314 GLNSYADRISKATYDVIA-EAKNTTKDIGGSASTTDFTQAIIEKL 357

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  273 bits (697), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 155/371 (41%), Positives = 223/371 (60%), Gaps = 15/371 (4%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           M R + V+ S R  A      +      P    G+YTV+ I GDGVG E++ SV  IF A
Sbjct: 1   MLRNTFVQISKRRFALASGQLL------PKKYGGRYTVTLIPGDGVGKEVTDSVVNIFEA 54

Query: 61  AKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLRK 119
             VPI+WES ++S +  N        AV S+ +N + LKG  +TP  + GH SLN+  RK
Sbjct: 55  ENVPIDWESVELSGLEEN--MEGVQKAVESLKRNKVGLKGIWSTPADQTGHGSLNVAFRK 112

Query: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
              +FANV   KS  G KT  ++V+LV+IRENTEGEYSG+EH   PGVV+S+K++T+  S
Sbjct: 113 QLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAKS 172

Query: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSS-EYPDIELQTELLDNT 238
           ER+ R+AF++A   +R  V  VHK+ I +L DGLF +   ++ + EYP++E+++ ++DN 
Sbjct: 173 ERIARFAFDFALKNNRRSVCAVHKANIMKLGDGLFRNTVNEIGAKEYPELEVKSIIVDNA 232

Query: 239 VLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFE-AVHGS 297
            ++ V  P  +D  V+V PNLYG I                  AN G   ++FE      
Sbjct: 233 SMQAVAKPHQFD--VLVTPNLYGSI-LGNVGAALIGSPGLVPGANFGREYAVFEPGSRHV 289

Query: 298 APDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSAST 357
             DI GQ+ ANPTA++LSS +ML H+GL ++AD+I KA    IA + K+ T D+GG AST
Sbjct: 290 GLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIA-EGKHTTKDIGGHAST 348

Query: 358 SSFTDAVIERL 368
           + FT A++++L
Sbjct: 349 TQFTKAIVDKL 359

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  271 bits (692), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 155/372 (41%), Positives = 230/372 (61%), Gaps = 19/372 (5%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           M  ++I K   R LAT  Q         P    G++TV+ I GDGVG EI+ SV+ IF A
Sbjct: 1   MLNRTIAK---RTLATAAQAE----RTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEA 53

Query: 61  AKVPIEWESCDVSPI-FVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLR 118
            ++P++WE+ ++       G+      AV S+ +N I LKG   TP  + GH SLN+ LR
Sbjct: 54  ERIPVDWETINIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALR 109

Query: 119 KTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDA 178
           K   ++ANV   KS++G KT   +++L++IRENTEGE+SG+EH   PGVV+S+K++T+  
Sbjct: 110 KQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTKPK 169

Query: 179 SERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKL-SSEYPDIELQTELLDN 237
           +ER+ R+AF++A+  +R  V  VHK+ I +L DGLF ++  ++  +EYPDI++ + ++DN
Sbjct: 170 TERIARFAFDFAKKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQTEYPDIDVSSIIVDN 229

Query: 238 TVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFE-AVHG 296
             ++ V  P  +D  V+V P++YG I                  AN G   ++FE     
Sbjct: 230 ASMQAVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRH 286

Query: 297 SAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSAS 356
              DI GQN ANPTA++LSSV+MLNH+GL E+A +I KAV  TIA + K+ T D+GGS+S
Sbjct: 287 VGLDIKGQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIA-EGKHTTRDIGGSSS 345

Query: 357 TSSFTDAVIERL 368
           T+ FT+ VI +L
Sbjct: 346 TTDFTNEVINKL 357

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  268 bits (685), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 227/372 (61%), Gaps = 19/372 (5%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           M  ++I K   R LAT  Q         P    G++TV+ I GDGVG EI+ SV+ IF A
Sbjct: 1   MLNRTIAK---RTLATAAQAE----RTLPKKYGGRFTVTLIPGDGVGKEITDSVRTIFEA 53

Query: 61  AKVPIEWESCDVSPI-FVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLR 118
             +PI+WE+ ++       G+      AV S+ +N I LKG   TP  + GH SLN+ LR
Sbjct: 54  ENIPIDWETINIKQTDHKEGVY----EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALR 109

Query: 119 KTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDA 178
           K   ++ANV   KS++G KT   +++L++IRENTEGE+SG+EH   PGVV+S+K++T+  
Sbjct: 110 KQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPGVVESLKVMTRPK 169

Query: 179 SERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSS-EYPDIELQTELLDN 237
           +ER+ R+AF++A+  +R  V  VHK+ I +L DGLF ++  ++   EYPDI++ + ++DN
Sbjct: 170 TERIARFAFDFAKKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDN 229

Query: 238 TVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFE-AVHG 296
             ++ V  P  +D  V+V P++YG I                  AN G   ++FE     
Sbjct: 230 ASMQAVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRH 286

Query: 297 SAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSAS 356
              DI GQN ANPTA++LSS +MLNH+GL E+A +I KAV  TIA + K+ T D+GGS+S
Sbjct: 287 VGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIA-EGKHTTRDIGGSSS 345

Query: 357 TSSFTDAVIERL 368
           T+ FT+ +I +L
Sbjct: 346 TTDFTNEIINKL 357

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  268 bits (684), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 156/374 (41%), Positives = 228/374 (60%), Gaps = 22/374 (5%)

Query: 1   MFRQS--IVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIF 58
           MFR +  + K+S   +AT++          P    G+YTV+ I GDGVG E++ SV +IF
Sbjct: 1   MFRNTFAVSKRSLATVATEQLL--------PKKYGGRYTVTLIPGDGVGKEVTDSVVSIF 52

Query: 59  SAAKVPIEWESCDVSPI-FVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLT 116
            A  VPI+WE+ +++ +    G+      AV S+ +N I LKG   TP  + GH SLN+ 
Sbjct: 53  EAENVPIDWETINITGVDSEEGV----QKAVESLKRNKIGLKGIWHTPADQTGHGSLNVA 108

Query: 117 LRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQ 176
            RK   +FANV   K++ G KT   N++LV+IRENTEGEYSG+EH   PGVV+S+K+IT+
Sbjct: 109 FRKQLDIFANVALFKNVPGVKTKLSNIDLVVIRENTEGEYSGLEHESVPGVVESLKIITK 168

Query: 177 DASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKL-SSEYPDIELQTELL 235
             SER+ R+AF++A   +R  V  VHK+ I +L DGLF +   ++ +SEYP+I+++  ++
Sbjct: 169 AKSERIARFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNTVNEVGASEYPEIDVKNIIV 228

Query: 236 DNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFE-AV 294
           DN  ++ V  P  +D  V+V PNLYG I                  AN G   ++FE   
Sbjct: 229 DNASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGS 285

Query: 295 HGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGS 354
                DI G++ ANPTA++LSS +ML H+GL  +AD+I KA    IA + K+ T D+GGS
Sbjct: 286 RHVGLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIA-EGKHTTKDIGGS 344

Query: 355 ASTSSFTDAVIERL 368
           +ST+ FT +VI++L
Sbjct: 345 SSTTEFTKSVIDKL 358

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  267 bits (683), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 150/345 (43%), Positives = 214/345 (62%), Gaps = 14/345 (4%)

Query: 29  PNPKTGKYTVSFIEGDGVGPEISKSVKAIFSAAKVPIEWESCDVSPIFVNGLTTIP--DP 86
           P    G+YTV+ I GDGVG E++ SV +IF +  +PI+WE+ ++S     GL        
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENIPIDWETVEIS-----GLDNQEGVQK 77

Query: 87  AVASINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNL 145
           AV S+ +N + LKG   TP  + GH SLN+ LRK   +FANV   KS+ G  + + NV++
Sbjct: 78  AVESLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVDM 137

Query: 146 VLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVDRSKVLVVHKST 205
           V+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+AF++A   +R  V  VHK+ 
Sbjct: 138 VVIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIGRFAFDFAVKNNRKSVCAVHKAN 197

Query: 206 IQRLADGLFVDVAKKLSS-EYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIX 264
           I +L DGLF +   ++ + EYP+I+++  ++DN  ++ V  P  +D  V+V PNLYG I 
Sbjct: 198 IMKLGDGLFRNCINEVGAKEYPEIDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 254

Query: 265 XXXXXXXXXXXXXXXXXANIGHTVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 323
                            AN G   ++FE        DI GQN ANPTA++LSS +ML H+
Sbjct: 255 LGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSSLMLRHL 314

Query: 324 GLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           GL  +AD+I KA    IA +AK  T D+GGSAST+ FT+A+I +L
Sbjct: 315 GLNAYADRISKATYDVIA-EAKTTTQDIGGSASTTEFTEAIISKL 358

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  267 bits (683), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 163/375 (43%), Positives = 231/375 (61%), Gaps = 20/375 (5%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIG-RYTGKPNPKT--GKYTVSFIEGDGVGPEISKSVKAI 57
           MF+  + K   R LAT   P+ G R    P PK   G+YTV+ I GDGVG E++ SV +I
Sbjct: 1   MFKTVLAK---RGLAT--VPATGFRGFLNPLPKEYGGRYTVTLIPGDGVGKEVTDSVVSI 55

Query: 58  FSAAKVPIEWESCDVSPI-FVNGLTTIPDPAVASINKNLIALKGPLATPIGKG-HRSLNL 115
           F+A  +PI+WE  D+S +    G+    + AV S+ +N I LKG   T  G+  H SLN+
Sbjct: 56  FNAENLPIDWERVDISGLDHEEGV----EAAVNSLKRNKIGLKGIWHTSAGQSDHGSLNV 111

Query: 116 TLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 175
            LRK   ++ANV   K++ G KT   +V+LV+IRENTEGEYSG+EH   PGVV+S+K+IT
Sbjct: 112 ALRKQLDIYANVAHFKTLPGVKTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIIT 171

Query: 176 QDASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLS-SEYPDIELQTEL 234
           ++ SER+ R+AF++A+  DR  V  VHK+ I +L DGLF +    +  +EYPDI++ + +
Sbjct: 172 KEKSERIARFAFDFAKRFDRKLVTAVHKANIMKLGDGLFRNSVTSIGETEYPDIKVSSII 231

Query: 235 LDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFE-A 293
           +DN  +++V  P  +D  V+V P++YG I                  AN G   ++FE  
Sbjct: 232 VDNASMQSVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVPGANYGTECAVFEPG 288

Query: 294 VHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGG 353
                 DI GQN ANPTA++LSS ++L H+GL   A KIE AV  TIA + K  T D+GG
Sbjct: 289 SRHVGLDIKGQNVANPTAMILSSTLLLKHLGLNNEAKKIEDAVYKTIA-EGKVTTRDIGG 347

Query: 354 SASTSSFTDAVIERL 368
           SAST+ FT+ +I++L
Sbjct: 348 SASTTEFTNEIIKKL 362

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  262 bits (670), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 157/371 (42%), Positives = 221/371 (59%), Gaps = 18/371 (4%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           MFRQ+I K   R LAT     I + T  P    G+ TV+ + GDGVG EI+ SV +IF A
Sbjct: 1   MFRQTIAK---RTLAT----FIPKETILPKKYGGRMTVTLLPGDGVGKEITDSVVSIFQA 53

Query: 61  AKVPIEWESCDVSPI-FVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLR 118
             VPI+WE+ D+S +   +G+    + AV S+ +N I LKG   T   + GH SLN+  R
Sbjct: 54  ENVPIDWETVDISQLDHEDGV----NAAVESLKRNKIGLKGIWHTSADQVGHGSLNVAFR 109

Query: 119 KTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDA 178
           K   ++ANV   KSI G KT   NV+LV+IRENTEGEYSG+EH   PGVV+S+K++T+  
Sbjct: 110 KQLDIYANVAFCKSIPGVKTKIPNVDLVIIRENTEGEYSGLEHESVPGVVESLKIVTKVN 169

Query: 179 SERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNT 238
           SER+ ++AF++A   DR  V  VHK+ I +L+DGLF +   ++   YP I+  + ++DN 
Sbjct: 170 SERIAKFAFDFAMRHDRKMVTAVHKANIMKLSDGLFRNTVARVGEAYPQIKNDSIIVDNA 229

Query: 239 VLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFE-AVHGS 297
            ++ V  P  +D  V+V P++YG I                   N G   ++FE      
Sbjct: 230 SMQAVAKPHQFD--VMVTPSMYGTI-LGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHV 286

Query: 298 APDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSAST 357
             DI GQN ANPTA++LSS ++L H+GL + A +I KAV   I  +    T D+GG+AST
Sbjct: 287 GLDIKGQNVANPTAMILSSTLLLQHLGLNDTASRISKAVYDVI-KEGNATTKDIGGNAST 345

Query: 358 SSFTDAVIERL 368
           + FT AVI++L
Sbjct: 346 TEFTKAVIDKL 356

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  258 bits (658), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 149/345 (43%), Positives = 209/345 (60%), Gaps = 14/345 (4%)

Query: 29  PNPKTGKYTVSFIEGDGVGPEISKSVKAIFSAAKVPIEWESCDVSPIFVNGLTTIPD--P 86
           P    G+YTV+ I GDGVG EI+ SV +IF A  +P++WE  D+S         I D   
Sbjct: 20  PKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIPVDWERVDIST-----SDNIQDVSQ 74

Query: 87  AVASINKNLIALKGPLATPIG-KGHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNL 145
           AV S+ +N I LKG   T      H S N+ LRK   +FA+V   KS+ G KT   NV+L
Sbjct: 75  AVESLKRNKIGLKGIWHTSADIADHGSFNVALRKQLDMFAHVAFFKSVPGVKTKIPNVDL 134

Query: 146 VLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVDRSKVLVVHKST 205
           V+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++A+  +R  V  VHK+ 
Sbjct: 135 VVIRENTEGEYSGLEHESVPGVVESLKIITKAKSERIARFAFDFAKKYNRKSVCAVHKAN 194

Query: 206 IQRLADGLFVDVAKKL-SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIX 264
           I ++ DGLF +   ++ ++EYPDI+  + ++DN  ++ V  P  +D  V+V P++YG I 
Sbjct: 195 IMKMGDGLFRNTVTEIGANEYPDIQTSSIIVDNASMQAVAKPHQFD--VMVTPSMYGTI- 251

Query: 265 XXXXXXXXXXXXXXXXXANIGHTVSIFE-AVHGSAPDIAGQNKANPTALLLSSVMMLNHM 323
                            A+ G   ++FE        DI G+N ANPTA++LSS +ML H+
Sbjct: 252 IGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILSSTLMLQHL 311

Query: 324 GLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           GLTE A +I KA    I S  +  T D+GGSAST+ FT+A+I+RL
Sbjct: 312 GLTESAKRIAKATHDVI-SLGQVTTKDIGGSASTTEFTEAIIKRL 355

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  257 bits (657), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 156/373 (41%), Positives = 223/373 (59%), Gaps = 21/373 (5%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           M RQ + K+S     TK    +      P    G+YTV+ I GDG+G E++ SV  IF++
Sbjct: 1   MLRQVVSKRSIASF-TKNHNIV------PKKYGGRYTVTLIPGDGIGKEVTDSVVKIFAS 53

Query: 61  AKVPIEWESCDVSPIFVNGLTTIPD--PAVASINKNLIALKGPLATPIGK-GHRSLNLTL 117
             +PI+WE  DV      G++   +   AV S+ +N I LKG   T   + G+ SLN+ L
Sbjct: 54  QGLPIDWERIDVP-----GMSNENEVKKAVESLKRNKIGLKGIWHTSADQTGYGSLNVAL 108

Query: 118 RKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQD 177
           RK   +FANV   KS++G KT   +V+LV+IRENTEGEYSG+EH   PGVV+S+K+IT+ 
Sbjct: 109 RKQLDIFANVAIFKSLKGVKTKIPDVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKP 168

Query: 178 ASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVD-VAKKLSSEYPDIELQTELLD 236
            +ER+ R+AF++A   +RS V  VHK+ I +L+DGLF + VA+    EYPDI++ T ++D
Sbjct: 169 KTERIARFAFDFALENNRSTVTAVHKANIMKLSDGLFKNTVAEVGEKEYPDIKVNTIIVD 228

Query: 237 NTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFE-AVH 295
           N  ++ V  P  +D  V+V P++YG I                  AN G   ++FE    
Sbjct: 229 NASMQAVAKPHQFD--VMVTPSMYGTI-LGNIGAALIGGPGLIPGANYGREHAVFEPGSR 285

Query: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSA 355
               DI  QN ANPTA++LS+ +MLN +GL E + +I  AV   I  + K  T D+GG+A
Sbjct: 286 HVGLDIENQNIANPTAMILSATLMLNQLGLREESKRISNAVYAVI-EEGKTTTKDIGGNA 344

Query: 356 STSSFTDAVIERL 368
           ST+ FTDAVI++L
Sbjct: 345 STTEFTDAVIDKL 357

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  256 bits (655), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 151/349 (43%), Positives = 216/349 (61%), Gaps = 21/349 (6%)

Query: 29  PNPKTGKYTVSFIEGDGVGPEISKSVKAIFSAAKVPIEWESCDVSPI-FVNGLTTIPDPA 87
           P    G++ V+ I GDGVG E++ SV +IF A  +PI+W+  D+S +    G+      A
Sbjct: 22  PKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAENLPIDWDRVDISGLDHEEGVQA----A 77

Query: 88  VASINKNLIALKG----PLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENV 143
           V S+ +N I LKG      A   GKG  SLN+ LRK   ++ANV   KS+ G KT   NV
Sbjct: 78  VDSLKRNKIGLKGIWHTSAADQAGKG--SLNVALRKELDIYANVALFKSVPGVKTKIPNV 135

Query: 144 NLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVDRSKVLVVHK 203
           +LV+IRENTEGEYSG+EH   PGVV+S+K++T+D +ER+ R+AF++A+  +R  V  VHK
Sbjct: 136 DLVVIRENTEGEYSGLEHESVPGVVESLKIMTEDKTERIARFAFDFAKKYNRHAVTAVHK 195

Query: 204 STIQRLADGLFVDVAKKLS-SEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGD 262
           + I +L DGLF +V  ++   EYPD+++ + ++DN  ++TV  P  +D  V+V P++YG 
Sbjct: 196 ANIMKLGDGLFRNVVTRVGEQEYPDVKVGSIIVDNASMQTVAKPHQFD--VLVTPSMYGT 253

Query: 263 IXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGS---APDIAGQNKANPTALLLSSVMM 319
           I                  AN G   ++FE   GS     DI  +N ANPTA++LS+ +M
Sbjct: 254 I-LGNIGAALIGGPGLVAGANYGREYAVFEP--GSRHVGLDIKDKNIANPTAMILSASLM 310

Query: 320 LNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           L+H+GL+  A KI  AV   IA + K+ T D+GGSAST+ FT AVIE+L
Sbjct: 311 LDHLGLSTSATKISNAVHQVIA-EGKSTTPDIGGSASTTEFTQAVIEKL 358

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  253 bits (647), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 149/371 (40%), Positives = 218/371 (58%), Gaps = 18/371 (4%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           MFR  I K++   +A+++          P    G+YTV+ + GDGVG EI+ SV +IF A
Sbjct: 1   MFRNLISKRAFTSIASRENII-------PKKYGGRYTVTLLPGDGVGREITDSVVSIFEA 53

Query: 61  AKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGK-GHRSLNLTLRK 119
             +PI+WE  ++S +    + T    AV S+ +N I LKG   T     GH S N+ LRK
Sbjct: 54  ENLPIDWERVELSGLEQEDVHT----AVESLKRNKIGLKGIWHTSADHDGHTSWNVALRK 109

Query: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
              ++ANV   KS +G  T   +V+LV+IRENTEGEYSG+EH   PGVV+S+K++T   +
Sbjct: 110 ELDIYANVAIFKSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTAQKT 169

Query: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSS-EYPDIELQTELLDNT 238
           ER+ R+AF+YA   +R  V  VHK+ I +L DGLF ++  ++ + EYP++ + + ++DN 
Sbjct: 170 ERIARFAFDYAMKYNRKSVTAVHKANIMKLGDGLFRNLVTEIGAKEYPEVGVSSIIVDNA 229

Query: 239 VLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFE-AVHGS 297
            ++ V  P  +D  V+V P++YG I                  AN G   ++FE      
Sbjct: 230 SMQAVAKPHQFD--VMVAPSMYGTI-LGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHV 286

Query: 298 APDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSAST 357
             DI  QN ANPTA++LS+ +MLNH+G    A +I KAV   IA + K  T D+GGSA+T
Sbjct: 287 GLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEVIA-EGKTTTRDIGGSATT 345

Query: 358 SSFTDAVIERL 368
           + FT+AVI +L
Sbjct: 346 TEFTNAVIAKL 356

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  253 bits (646), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 151/362 (41%), Positives = 211/362 (58%), Gaps = 13/362 (3%)

Query: 12  RFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSAAKVPIEWESCD 71
           R L +K+  +    T  PN   G+YTV+ + GDGVG E + SV ++F+A  +PI+WE  +
Sbjct: 3   RRLVSKRSLATLPETLFPNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIPIDWEIVN 62

Query: 72  VSPI-FVNGLTTIPDPAVASINKNLIALKGPLATPIG--KGHRSLNLTLRKTFGLFANVR 128
           +S +    G+      AV S+ +N I LKG   T      GH SLN+  RK   ++ANV 
Sbjct: 63  ISGLDHKEGVAA----AVQSLRRNKIGLKGLWHTSNADQSGHGSLNVAFRKQLDIYANVA 118

Query: 129 PAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFE 188
             KS++G KT   +V+LV+IRENTEGE+SG+EH    GVV+S+K+ T   +ER+ R+AF 
Sbjct: 119 VFKSLKGVKTMIPDVDLVVIRENTEGEFSGLEHESVEGVVESLKVTTLPKTERIARFAFN 178

Query: 189 YARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSS-EYPDIELQTELLDNTVLKTVQHPE 247
           YA+   R  V  VHK+ I +L DGLF +    +   EYPDIE  + ++DN  ++ V  P 
Sbjct: 179 YAQKNGRKAVCAVHKANIMKLGDGLFRNTVTSIGEKEYPDIETSSIIVDNASMQAVAKPH 238

Query: 248 AYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFE-AVHGSAPDIAGQNK 306
            +D  V+V P++YG I                  AN G   ++FE        DI GQN 
Sbjct: 239 QFD--VLVTPSMYGTI-IGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNI 295

Query: 307 ANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIE 366
           ANPTA+LLSS +MLNH+GLT+   +I  AV   IA +   RT D+GG A+T+ FT AVIE
Sbjct: 296 ANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIA-EGDVRTKDIGGDATTTEFTQAVIE 354

Query: 367 RL 368
           +L
Sbjct: 355 KL 356

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  241 bits (614), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 146/373 (39%), Positives = 221/373 (59%), Gaps = 32/373 (8%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           M R +++++S   ++ KK               G++ ++ I G+G+G E++ SV++IF A
Sbjct: 1   MLRNTLLRRSISTISPKKY-------------GGRFQITLIPGNGIGKEVTDSVRSIFQA 47

Query: 61  AKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLAT-PIGKGHRSLNLTLRK 119
             +PI+WE  ++     +G+ T    AV SI +N IALKG  ++ PI     SLN+ LRK
Sbjct: 48  ENLPIDWEIVNIES-HRDGIKT----AVDSIKRNKIALKGIWSSDPIDG---SLNVALRK 99

Query: 120 TFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDAS 179
              +FANV   KS +   T   NV+LV+IRENTEGE+SG+EH    GVV+S+K++T+  +
Sbjct: 100 QLDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDGVVESLKIVTKPKT 159

Query: 180 ERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKL-SSEYPDIELQTELLDNT 238
           ER+ R+AF++A+  +R+ V  VHK+ I +L DGLF ++   + ++EYP+I+  + ++DN 
Sbjct: 160 ERIARFAFDFAKKHNRNHVTAVHKANIMKLGDGLFKNIVAHIGNNEYPEIKNSSIIVDNA 219

Query: 239 VLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGS- 297
            ++ V  P  +D  V+V P++YG I                  AN G   ++FE   GS 
Sbjct: 220 SMQAVAKPHQFD--VLVSPSMYGTI-LGNIGAALIGGPGLVPGANFGRDYAVFEP--GSR 274

Query: 298 --APDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSA 355
               DI GQN ANPTA++LS+  ML H+GLT  A++I  AV   IA      T D+GG+A
Sbjct: 275 HVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQ-GTTVTKDIGGTA 333

Query: 356 STSSFTDAVIERL 368
           ST+ FTDAVI  L
Sbjct: 334 STTEFTDAVINEL 346

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  209 bits (532), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 173/286 (60%), Gaps = 11/286 (3%)

Query: 29  PNPKTGKYTVSFIEGDGVGPEISKSVKAIFSAAKVPIEWESCDVSPI-FVNGLTTIPDPA 87
           P    G++TV+ I GDGVG E++ SVK IF A  +PI+WE+ ++       G+    + A
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEAENIPIDWETINIKQTDHKEGV----NEA 77

Query: 88  VASINKNLIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLV 146
           V S+ +N I LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   +++L+
Sbjct: 78  VESLRRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLI 137

Query: 147 LIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVDRSKVLVVHKSTI 206
           +IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++A+  +R  V  VHK+ I
Sbjct: 138 VIRENTEGEFSGLEHESVPGVVESLKIMTKPKTERIARFAFDFAKKYNRKAVTAVHKANI 197

Query: 207 QRLADGLFVDVAKKLSS-EYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXX 265
            +L DGLF ++  ++   EYPDI++ + ++DN  ++ V  P  +D  V+V P++YG I  
Sbjct: 198 MKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-L 254

Query: 266 XXXXXXXXXXXXXXXXANIGHTVSIFE-AVHGSAPDIAGQNKANPT 310
                           AN G   ++FE        DI GQN ANPT
Sbjct: 255 GNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPT 300

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  165 bits (417), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 114/353 (32%), Positives = 185/353 (52%), Gaps = 27/353 (7%)

Query: 37  TVSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSP---IFVNGLTTIPDPAVASI 91
           T+  I GDG+G E+  + K +    ++K  +++   D+      F++    +PD  +  +
Sbjct: 22  TIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEIL 81

Query: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148
             +   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS++G  T    V+++++
Sbjct: 82  KSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIV 139

Query: 149 RENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYA----RAVDRSKVL 199
           RENTE  Y     + I+      V ++IK I++ A+  + + A E +    +A  ++ + 
Sbjct: 140 RENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATLT 199

Query: 200 VVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255
           V HKS +   +DGLF +V K +       Y  I    +++D+ V +  + PE +D  V+V
Sbjct: 200 VTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VIV 257

Query: 256 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315
            PNLYGDI                  AN+GH   + E  HGSAPDIAG+  +NP A + S
Sbjct: 258 APNLYGDILSDGAAALVGSLGVVPS-ANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRS 316

Query: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           + +ML  MG TE A  I KAV T I  + + +T DLGG ++T    D ++ ++
Sbjct: 317 TALMLEFMGYTEAAQDIHKAVDTNIREN-QIKTPDLGGKSTTQQVVDDILSKM 368

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  165 bits (417), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 114/353 (32%), Positives = 185/353 (52%), Gaps = 27/353 (7%)

Query: 37  TVSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSP---IFVNGLTTIPDPAVASI 91
           T+  I GDG+G E+  + K +      K  I+++  D+      F++    +PD  V+ +
Sbjct: 24  TIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSIL 83

Query: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148
            +    AL G + +P  K  G+ S  + LRK  GL+AN+RP KS+ G  T    V++V++
Sbjct: 84  KQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPVDMVIV 141

Query: 149 RENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYA----RAVDRSKVL 199
           RENTE  Y     + I+      V ++ K I++ A+ ++ + A + A    +   ++ + 
Sbjct: 142 RENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLT 201

Query: 200 VVHKSTIQRLADGLFVDVAKKLSSE----YPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255
           V HKS +   +DGLF +V + +  +    Y ++    +++D+ V +  + PE +D  VVV
Sbjct: 202 VTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFD--VVV 259

Query: 256 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315
            PNLYGDI                  AN+G  + I E  HGSAPDI+GQ  +NP A + S
Sbjct: 260 APNLYGDILSDGAAALVGSLGVVPS-ANVGPDIIIGEPCHGSAPDISGQGISNPVATIRS 318

Query: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           + +ML  +G  E A  I+ AV   I S  K +T DLGG +ST+  TD ++ +L
Sbjct: 319 AALMLQFLGYNEAAKDIQNAVDENIRS-GKIKTPDLGGDSSTTEVTDDILSKL 370

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  164 bits (416), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 120/353 (33%), Positives = 183/353 (51%), Gaps = 27/353 (7%)

Query: 37  TVSFIEGDGVGPEISKSVKAIFSA--AKVPIEWESCDVSP---IFVNGLTTIPDPAVASI 91
           T+  I GDG+G E+  + K +      K  + +E  D+      F++    +P   V  +
Sbjct: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82

Query: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148
            NK   AL G + +P  K  G+ S  + LRK  GLFANVRP K++EG  T  + ++LV++
Sbjct: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140

Query: 149 RENTEGEYSGIEHVV-----APGVVQSIKLITQDASERVIRYAFEYARAVDRSK----VL 199
           RENTE  Y  IE           + ++ K IT+ A++R+ + A + A    ++K    + 
Sbjct: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200

Query: 200 VVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255
           V HKS +   +DGLF +V K++     S Y  +    +++D+ V +  + PE +D  V+V
Sbjct: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIV 258

Query: 256 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315
            PNLYGDI                  AN+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 259 APNLYGDILSDGAAALVGSLGLVPS-ANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRS 317

Query: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           +  ML ++G +  A  I KAV   I  D K +T DLGG ++T    D ++ +L
Sbjct: 318 TAQMLEYLGYSNPAQDIYKAVDANI-RDNKIKTADLGGDSTTQQVIDDILGKL 369

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  164 bits (414), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 120/353 (33%), Positives = 184/353 (52%), Gaps = 27/353 (7%)

Query: 37  TVSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSP---IFVNGLTTIPDPAVASI 91
           T+  I GDG+G E+  + K I      K  ++++  D+      F N    +PD  V  +
Sbjct: 26  TIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVL 85

Query: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148
            ++   AL G + +P  K  G+ S  + LRK  GLFANVRP K++EG  T    V++V++
Sbjct: 86  RRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIV 143

Query: 149 RENTEGEYSGIEHVV---APG--VVQSIKLITQDASERVIRYAFEYARAVDRSK----VL 199
           RENTE  Y  IE      A G  V ++ K I++ A+ R+   A + A    +S+    + 
Sbjct: 144 RENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLT 203

Query: 200 VVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255
           V HKS +   +DGLF ++ K +      +Y  I+   +++D+ V +  + PE +D  VVV
Sbjct: 204 VTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVV 261

Query: 256 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315
            PNLYGDI                  AN+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 262 APNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRS 320

Query: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           + +ML  +G  E A  I KAV + I  + + +T DLGG ++T    D ++ ++
Sbjct: 321 TALMLEFLGYPEAAQPIYKAVDSNIREN-QIKTPDLGGKSTTQQVVDDILSKI 372

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  163 bits (413), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 126/390 (32%), Positives = 194/390 (49%), Gaps = 41/390 (10%)

Query: 1   MFRQSIVK-QSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59
           M R +  K   CR LAT             N      T+  I GDG+G E+  + K +  
Sbjct: 2   MLRSAANKLAGCRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLQ 48

Query: 60  A--AKVPIEWESCDVSPIFVNGLTT---IPDPAVASINKNLI-ALKGPLATPIGK--GHR 111
           +   K  + ++  D+   F     T   +PD  V  + +    AL G + +P  K  G+ 
Sbjct: 49  SLNPKHGLNFDFIDLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYS 108

Query: 112 SLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVV---APG-- 166
           S  + LRK  GL+AN+RP KS+EG  +    V+++++RENTE  Y  IE      A G  
Sbjct: 109 SPIVALRKAMGLYANIRPVKSVEG--SNERPVDMIIVRENTEDLYIKIEKTYIDKATGTR 166

Query: 167 VVQSIKLITQDASERVIRYAFEYA----RAVDRSKVLVVHKSTIQRLADGLFVDVAKKL- 221
           V ++ K I++ A++R+   A + A    +   ++ + V HKS +   +DGLF +V +++ 
Sbjct: 167 VAEATKRISEIATQRIATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMY 226

Query: 222 ---SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXX 278
                +Y  I    +++D+ V +  + PE +D  V+V PNLYGDI               
Sbjct: 227 EANKDKYAGITYNEQIVDSMVYRMFREPECFD--VIVAPNLYGDILSDGAAALVGSLGVV 284

Query: 279 XXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLT 338
              AN+G  + I E  HGSAPDIAG+  ANP A + S+ +ML  +G  E A  I KAV  
Sbjct: 285 PS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDA 343

Query: 339 TIASDAKNRTGDLGGSASTSSFTDAVIERL 368
            +  D   +T DLGG+A+T +  D ++ RL
Sbjct: 344 NL-RDGLVKTADLGGNATTQNVVDDILARL 372

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  162 bits (410), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 113/353 (32%), Positives = 179/353 (50%), Gaps = 28/353 (7%)

Query: 37  TVSFIEGDGVGPEI----SKSVKAIFSAAKVPIEWESCDVS-PIFVNGLTTIPDPAVASI 91
           T+  I GDG+G E+     + ++AI     +   +E  D     F+     +P   V ++
Sbjct: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81

Query: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148
            +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KS+ G   T + V+LV++
Sbjct: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVIV 138

Query: 149 RENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERV----IRYAFEYARAVDRSKVL 199
           RENTE  Y     + ++      V ++IK I++ A+ER+    +R A +  R   R  + 
Sbjct: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198

Query: 200 VVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255
           V HKS +    DGLF +V +++       Y  IE   +++D+ V +  + P  +D  VVV
Sbjct: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VVV 256

Query: 256 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315
            PNLYGD+                   N+G+ + I E  HGSAPDIAG+  ANP A + S
Sbjct: 257 APNLYGDLLSDGAAALVGSLGLVPS-VNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315

Query: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
             +ML  +GL E A  I++AV   +  D +  + DLGG  +T    D ++ R+
Sbjct: 316 VSLMLQFLGLEEAASDIDQAVTGNL-KDRQVVSPDLGGKNTTQEVLDDILARI 367

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  161 bits (408), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 128/390 (32%), Positives = 192/390 (49%), Gaps = 41/390 (10%)

Query: 1   MFRQSIVKQS-CRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59
           MFR    + S CR LA+             N      T+  I GDG+G E+  + K +  
Sbjct: 1   MFRSVATRLSACRGLAS-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47

Query: 60  A--AKVPIEWESCDVSPIFVNGLTT---IPDPAVASINKNLI-ALKGPLATPIGK--GHR 111
              +K  + +   D+   F     T   +PD  V  + +    AL G + +P  K  G+ 
Sbjct: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYS 107

Query: 112 SLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVV---APG-- 166
           S  + LR+  GLFANVRP KS+EG K   + +++V++RENTE  Y  IE      A G  
Sbjct: 108 SPIVALRREMGLFANVRPVKSVEGEKG--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165

Query: 167 VVQSIKLITQDASERVIRYAFEYA----RAVDRSKVLVVHKSTIQRLADGLFVDVAKKL- 221
           V  + K I++ A+ R+   A + A    +   ++ + V HKS +   +DGLF ++ K++ 
Sbjct: 166 VADATKRISEIATRRIATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVY 225

Query: 222 ---SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXX 278
                +Y  I+   +++D+ V +  + P+ +D  V+V PNLYGDI               
Sbjct: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAALVGSLGVV 283

Query: 279 XXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLT 338
              AN+G  + I E  HGSAPDIAG+  ANP A + S+ +ML  +G  E A  I KAV  
Sbjct: 284 PS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDA 342

Query: 339 TIASDAKNRTGDLGGSASTSSFTDAVIERL 368
            +  +   +T DLGG AST    D V+ RL
Sbjct: 343 NL-REGSIKTPDLGGKASTQQVVDDVLSRL 371

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  161 bits (407), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 116/354 (32%), Positives = 184/354 (51%), Gaps = 28/354 (7%)

Query: 37  TVSFIEGDGVGPEISKSVKAIFSA--AKVPIEWESCDVSPIFVNGLTT---IPDPAVASI 91
           T+  I GDG+G E+  + K +     +K  + ++  D+   F   L T   +PD  +  +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84

Query: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+EG  TT + V++V++
Sbjct: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142

Query: 149 RENTEG------EYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYA----RAVDRSKV 198
           RENT        E + I+      V ++ K I++ A+ R+   A + A    +   ++ +
Sbjct: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202

Query: 199 LVVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVV 254
            V HKS +   +DGLF ++ K +      +Y  I    +++D+ V +  + P+ +D  VV
Sbjct: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VV 260

Query: 255 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLL 314
           V PNLYGDI                  AN+G  + I E  HGSAPDIAG+  +NP A + 
Sbjct: 261 VAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319

Query: 315 SSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           S+ +ML  +G  E A  I +AV   +  + K +T DLGG ++T   T+ V+ RL
Sbjct: 320 STALMLEFLGHNEAAQDIHRAVEANLKEN-KVKTPDLGGKSTTQEVTEDVLARL 372

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  160 bits (404), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 118/353 (33%), Positives = 183/353 (51%), Gaps = 27/353 (7%)

Query: 37  TVSFIEGDGVGPEISKSVKAIFSA--AKVPIEWESCDVSPIFVNGLTT---IPDPAVASI 91
           T+  I GDG+G E+  + K +     +K  ++++  D+   F   L T   +PD  V  +
Sbjct: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86

Query: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148
                 AL G + +P  K  G+ S  + LRK  GLFANVRP KS+ G K     V++V++
Sbjct: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIV 144

Query: 149 RENTEGEYSGIEHVV---APG--VVQSIKLITQDASERVIRYAFEYA----RAVDRSKVL 199
           RENTE  Y  IE      A G  V ++ K I++ A+ R+   A + A    +   ++ + 
Sbjct: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204

Query: 200 VVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255
           V HKS +   +DGLF ++ K +      +Y  I    +++D+ V +  + P+ +D  V+V
Sbjct: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIV 262

Query: 256 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315
            PNLYGDI                  AN+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 263 APNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321

Query: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           + +ML  +G  + A  I +AV   +  + K +T DLGG+++T   T+ V+ RL
Sbjct: 322 TALMLEFLGHNDAAQDIHRAVEANMREN-KIKTPDLGGNSTTQQVTEDVLARL 373

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  160 bits (404), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 122/395 (30%), Positives = 196/395 (49%), Gaps = 51/395 (12%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAI--- 57
           M R+S+  +         Q +IG  + K N      T+  I GDG+G E+  S + +   
Sbjct: 1   MLRRSVYNRQF-------QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLET 48

Query: 58  --------FSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLI-ALKGPLATPIGK 108
                   F+   +   W++      F++    +P   V ++ +N   AL G + +P  K
Sbjct: 49  IGPKHGLTFNFIDLQAGWQT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTTK 102

Query: 109 --GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHV---- 162
             G+ S  + LRK  GL+AN+RP KS++      + V++V++RENTE  Y  +E      
Sbjct: 103 VEGYSSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYIDE 160

Query: 163 -VAPGVVQSIKLITQDASERVIRYAFEYA----RAVDRSKVLVVHKSTIQRLADGLFVDV 217
                V  + K I++ A+ R+ + A + A    +     ++ V HKS +   +DGLF +V
Sbjct: 161 KTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREV 220

Query: 218 AKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXX 273
            K++     + Y DI+   +++D+ V +  + PE +D  V+V PNLYGDI          
Sbjct: 221 CKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAALVG 278

Query: 274 XXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIE 333
                   AN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G ++ A  I+
Sbjct: 279 SLGVVPS-ANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQ 337

Query: 334 KAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
            AV + +  D K +T DLGG  STS   + VI RL
Sbjct: 338 TAVDSNLRED-KIKTPDLGGKNSTSDVVNDVIRRL 371

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  159 bits (403), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 128/390 (32%), Positives = 190/390 (48%), Gaps = 41/390 (10%)

Query: 1   MFRQSIVKQS-CRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59
           MFR    + S CR LA+             N      T+  I GDG+G E+  + K I  
Sbjct: 1   MFRSVATRISACRGLAS-------------NAARKSLTIGLIPGDGIGKEVIPAGKQILE 47

Query: 60  A--AKVPIEWESCDVSPIFVNGLTT---IPDPAVASINKNLI-ALKGPLATPIGK--GHR 111
              +K  + +   D+   F     T   +PD  +  +      AL G + +P  K  G+ 
Sbjct: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYS 107

Query: 112 SLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVV---APG-- 166
           S  + LR+  GL+ANVRP KS+EG K   + +++V++RENTE  Y  IE      A G  
Sbjct: 108 SPIVALRREMGLYANVRPVKSVEGTKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165

Query: 167 VVQSIKLITQDASERVIRYAFEYA----RAVDRSKVLVVHKSTIQRLADGLFVDVAKKL- 221
           V  +IK I++ A+ R+ + A + A    +    + + V HKS +   +DGLF ++ K + 
Sbjct: 166 VADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVY 225

Query: 222 ---SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXX 278
                +Y  I+   +++D+ V +  + P+ +D  V+V PNLYGDI               
Sbjct: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAALVGSLGVV 283

Query: 279 XXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLT 338
              AN+G  + I E  HGSAPDIAG+  ANP A + S+ +ML  +G  + A  I KAV  
Sbjct: 284 PS-ANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDA 342

Query: 339 TIASDAKNRTGDLGGSASTSSFTDAVIERL 368
            +   A   T DLGG AST    D V+ RL
Sbjct: 343 NLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  159 bits (402), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 118/353 (33%), Positives = 180/353 (50%), Gaps = 27/353 (7%)

Query: 37  TVSFIEGDGVGPEISKSVKAIFSA--AKVPIEWESCDVSP---IFVNGLTTIPDPAVASI 91
           T+  I GDG+G E+  + K I  +   K  + ++  D+      F N    +PD  +  +
Sbjct: 22  TIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPDETIDIL 81

Query: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148
            N+   AL G + +P  K  G+ S  + LRK  GLFANVRP KS++G K     V+LV++
Sbjct: 82  KNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVIV 139

Query: 149 RENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAV----DRSKVL 199
           RENTE  Y     S I+      V  + K IT+ A++ +   A + A+        + + 
Sbjct: 140 RENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGHATLT 199

Query: 200 VVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255
           V HKS +   +DGLF +V ++       +Y  ++   +++D+ V +  + PE +D  VVV
Sbjct: 200 VTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFD--VVV 257

Query: 256 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315
            PNLYGDI                  AN+G  + I E  HGSAPDIAG+  +NP A + S
Sbjct: 258 APNLYGDILSDGAAALVGSLGVVPS-ANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRS 316

Query: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           + +ML  +G  E A  I KAV   I  + K  T DLGG+++T    + V+ +L
Sbjct: 317 TALMLEFLGYPEPAKDIHKAVDANI-REGKYLTPDLGGNSTTQQVLEDVLSKL 368

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  159 bits (401), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 131/395 (33%), Positives = 189/395 (47%), Gaps = 51/395 (12%)

Query: 1   MFRQSIVKQS-CRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFS 59
           MFR    + S CR LAT             N      T+  I GDG+G E+  + K +  
Sbjct: 1   MFRSVATRVSACRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLE 47

Query: 60  A--AKVPIEWESCDVSPIFVNGLTT---IPDPAVASINKNLI-ALKGPLATPIGK--GHR 111
              +K  + +   D+   F     T   +PD  V  + K    AL G + +P  K  G+ 
Sbjct: 48  NLNSKHGLSFNFIDLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYS 107

Query: 112 SLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVV---APG-- 166
           S  + LR+  GLFANVRP KS+EG +   + +++V++RENTE  Y  IE      A G  
Sbjct: 108 SPIVALRREMGLFANVRPVKSVEGSRN--KPIDMVIVRENTEDLYIKIEKTYIDKATGTR 165

Query: 167 VVQSIKLITQDASERVIRYAFEYA----RAVDRSKVLVVHKSTIQRLADGLFVDVAKKL- 221
           V  + K I++ A+ R+   A + A    +    + + V HKS +    DGLF ++ K++ 
Sbjct: 166 VADATKRISEIATRRIATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVY 225

Query: 222 ---SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXX 278
                +Y  I+   +++D+ V +  + P+ +D  V+V PNLYGDI               
Sbjct: 226 ESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAALVGSLGVV 283

Query: 279 XXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLT 338
              AN+G  + I E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I KAV  
Sbjct: 284 PS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAV-- 340

Query: 339 TIASDAKNRTG-----DLGGSASTSSFTDAVIERL 368
               DA  R G     DLGG AST    D V+ RL
Sbjct: 341 ----DANLREGAITTPDLGGKASTQQVVDDVLSRL 371

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  158 bits (399), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 121/389 (31%), Positives = 194/389 (49%), Gaps = 42/389 (10%)

Query: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60
           MFR S+ K + R   +              PK+ K  +  I GDG+G E+  + K +  A
Sbjct: 1   MFRSSVAKVAARRAYSA-------------PKSMK--IGLIPGDGIGKEVIPAGKQVLEA 45

Query: 61  --AKVPIEWESCDVSP---IFVNGLTTIPDPAVASINKNLI-ALKGPLATPIGK--GHRS 112
             +K  ++++  D+      F      +PD  V  + +    AL G + +P  K  G+ S
Sbjct: 46  LGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSS 105

Query: 113 LNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEY-----SGIEHVVAPGV 167
             + LRK  GL+ANVRP KS+E  K    NV+++++RENTE  Y     + ++      V
Sbjct: 106 PIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRV 163

Query: 168 VQSIKLITQDASERVIRYAFEYARAVDRSK----VLVVHKSTIQRLADGLFVDVAK---- 219
            ++IK I++ A+ ++   A + +    +S+    + V HKS +   +DGLF ++ K    
Sbjct: 164 AEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYE 223

Query: 220 KLSSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXX 279
           K   +Y +++   +++D+ V +  + PE +D  VVV PNLYGDI                
Sbjct: 224 KNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAALVGSLGVVP 281

Query: 280 XXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTT 339
             AN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  E A  I KAV   
Sbjct: 282 S-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDAN 340

Query: 340 IASDAKNRTGDLGGSASTSSFTDAVIERL 368
           +     N T DLGG A+T    D ++ ++
Sbjct: 341 LIKGDVN-TPDLGGKATTQQVVDDILSKI 368

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  156 bits (394), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 110/353 (31%), Positives = 181/353 (51%), Gaps = 26/353 (7%)

Query: 36  YTVSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSP---IFVNGLTTIPDPAVAS 90
           +T+  I GDG+G E+    + +      K  ++++  D+      F++    +PD  V  
Sbjct: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79

Query: 91  INKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVL 147
           +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KS++G  T    V+LV+
Sbjct: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDRPVDLVI 137

Query: 148 IRENTE-----GEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVDRSK----V 198
            RENTE      E + I+      V ++IK I++ A+  +   A E A    + K    +
Sbjct: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197

Query: 199 LVVHKSTIQRLADGLFVDVAKKL---SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255
            V HKS +   +DGLF ++ K +   + ++ +++   +++D+ V +  + P+ +D  V+V
Sbjct: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFD--VIV 255

Query: 256 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315
            PNLYGDI                   N+G  + I E  HGSAPDI GQ  ANP A + S
Sbjct: 256 APNLYGDILSDGAAALVGSLGVVPS-VNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRS 314

Query: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           + ++L  +GL E A  IEK V   I  + K +T DLGG+++     + ++ R+
Sbjct: 315 AALLLEFLGLPEAARHIEKVVDENIREN-KIKTPDLGGNSTGEQVANDILSRI 366

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  156 bits (394), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 124/380 (32%), Positives = 186/380 (48%), Gaps = 40/380 (10%)

Query: 10  SCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA--AKVPIEW 67
           +CR LAT             N      T+  I GDG+G E+  + K +     +K  + +
Sbjct: 11  TCRGLAT-------------NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSF 57

Query: 68  ESCDVSPIFVNGLTT---IPDPAVASINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTF 121
              D+   F     T   +PD  V  + +    AL G + +P  K  G+ S  + LR+  
Sbjct: 58  NFIDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREM 117

Query: 122 GLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVV---APG--VVQSIKLITQ 176
           GLFANVRP KS+EG K   + +++V++RENTE  Y  IE      A G  V  + K I++
Sbjct: 118 GLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISE 175

Query: 177 DASERVIRYAFEYA----RAVDRSKVLVVHKSTIQRLADGLFVDVAKKL----SSEYPDI 228
            A+ R+   A + A    +    + + V HKS +   +DGLF ++ K++      +Y  I
Sbjct: 176 IATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQI 235

Query: 229 ELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTV 288
           +   +++D+ V +  + P+ +D  V+V PNLYGDI                  AN+G  +
Sbjct: 236 KYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPEI 292

Query: 289 SIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRT 348
            I E  HGSAPDIAG+  ANP A + S+ +ML  +G    A  I KAV   +   A  +T
Sbjct: 293 VIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAI-KT 351

Query: 349 GDLGGSASTSSFTDAVIERL 368
            DLGG AST    + V+ RL
Sbjct: 352 PDLGGKASTQQVVEDVLSRL 371

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  152 bits (385), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 111/352 (31%), Positives = 182/352 (51%), Gaps = 25/352 (7%)

Query: 37  TVSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSPIFVNGLTT---IPDPAVASI 91
           T+  I GDG+G E+  + K +    +++  + +   D+   F   L T   +PD  V  +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84

Query: 92  NKNLIA-LKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148
            +     L G + +P  +   + S  + LRK   L+AN+RP KS+ G  +  + V++V++
Sbjct: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIV 143

Query: 149 RENTEGEYSGIEHVVAPG----VVQSIKLITQDASERVIRYAFEYA----RAVDRSKVLV 200
           RENTE  Y  IE          V ++ K IT+ A+ ++ + A + A    +   ++ + V
Sbjct: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203

Query: 201 VHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVC 256
            HKS +   +DGLF ++ K +      +Y  I    +++D+ V +  + PE +D  V+V 
Sbjct: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPEYFD--VIVA 261

Query: 257 PNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSS 316
           PNLYGDI                  AN+G  + + E  HGSAPDIAG+  ANP A + S+
Sbjct: 262 PNLYGDILSDGAAALVGSLGVVPS-ANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320

Query: 317 VMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
            +ML  +G  E A  I KAV + +  + K +T DLGG++ST +  D V+E+L
Sbjct: 321 ALMLEFLGHKEAAQDIHKAVESNMREN-KIKTPDLGGNSSTQNVVDDVLEKL 371

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  152 bits (383), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 113/357 (31%), Positives = 183/357 (51%), Gaps = 28/357 (7%)

Query: 33  TGKYTVSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSP---IFVNGLTTIPDPA 87
           T   T+  I GDG+G E+  + K +    ++K  +++   D+      F++    +PD  
Sbjct: 18  TKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDET 77

Query: 88  VASI-NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVN 144
           +  + N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+    +  + ++
Sbjct: 78  IDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSV---LSQEKPID 134

Query: 145 LVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYA---RAVDRS 196
           +V++RENTE  Y     + I+      V ++IK I++ A+  +   A E A   + V+ S
Sbjct: 135 MVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNGS 194

Query: 197 KVLVV-HKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDD 251
             L V HKS +   +DGLF ++ +++      ++  I    +++D+ V +  + PE +D 
Sbjct: 195 ATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFD- 253

Query: 252 VVVVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTA 311
            V+V PNLYGDI                  AN+G    + E  HGSAPDIAG+  +NP A
Sbjct: 254 -VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGFDFVVGEPCHGSAPDIAGKGISNPVA 311

Query: 312 LLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
            + S+ +ML  MG  E A  I KAV   +  D   +T DLGG ++T    D V+ R+
Sbjct: 312 TIRSTALMLEFMGHPEAAQDIHKAVDANL-RDNTVKTPDLGGKSTTQQVVDDVLSRM 367

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  150 bits (378), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 111/355 (31%), Positives = 181/355 (50%), Gaps = 32/355 (9%)

Query: 37  TVSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSP---IFVNGLTTIPDPAVASI 91
           T+  I GDG+G E+  + + +    ++K  ++++  D+      F      +PD  +  +
Sbjct: 22  TIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDIL 81

Query: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+   +     V+++++
Sbjct: 82  RNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQERP---VDMIIV 138

Query: 149 RENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVDRSKV----- 198
           RENTE  Y     + I+      V ++IK I++ A++ +   A E A  + R KV     
Sbjct: 139 RENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIA--LQRQKVNGEAT 196

Query: 199 -LVVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVV 253
             V HKS +   +DGLF +V +++      ++  I+   +++D+ V +  + PE +D  V
Sbjct: 197 LTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--V 254

Query: 254 VVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALL 313
           +V PNLYGDI                  AN+G    + E  HGSAPDIAG+  +NP A +
Sbjct: 255 IVAPNLYGDILSDGAAALVGSLGVVPS-ANVGFDFVVGEPCHGSAPDIAGKGISNPVATI 313

Query: 314 LSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
            S+ +ML  MG  E A  I KAV   +  D   +T DLGG ++T    + V+ R+
Sbjct: 314 RSTALMLEFMGHPEAAQDIHKAVDANL-RDNSIKTPDLGGKSTTQQVVEDVLSRM 367

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  149 bits (377), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 112/352 (31%), Positives = 180/352 (51%), Gaps = 27/352 (7%)

Query: 38  VSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSP---IFVNGLTTIPDPAVASI- 91
           +  I GDG+G E+  + K +    + K  + ++  D+      F      +P+  V  + 
Sbjct: 24  IGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLK 83

Query: 92  NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIR 149
           N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+EG K     V++V++R
Sbjct: 84  NQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYANVRPVKSVEGTKD--RPVDMVIVR 141

Query: 150 ENTEGEYSGIEHVV---APG--VVQSIKLITQDASERVIRYAFEYA----RAVDRSKVLV 200
           ENTE  Y  +E      A G  V ++ K I++ A+ R+   A + A    +    + + V
Sbjct: 142 ENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTV 201

Query: 201 VHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVC 256
            HKS +   +DGLF ++ K +      +Y  +    +++D+ V +  + PE +D  VVV 
Sbjct: 202 THKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVA 259

Query: 257 PNLYGDIXXXXXXXXXXXXXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSS 316
           PNLYGDI                  AN+G  + I E  HGSAPDIAG+  +NP A + S+
Sbjct: 260 PNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 318

Query: 317 VMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
            +ML  +G  + A  I +AV   +  D K +T DLGG+++T    + ++ +L
Sbjct: 319 GLMLEFLGHNKPAQDIYRAVDANLRED-KVKTPDLGGNSTTQQVVEDILSKL 369

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 97/359 (27%), Positives = 160/359 (44%), Gaps = 48/359 (13%)

Query: 41  IEGDGVGPEISKSVKAIFSAAKVPIEWESCDVSPIFVNGL------TTIPDPAVASINKN 94
           + GD +G E+ +    +  A +  +     D     V G       + +PD A+ +  + 
Sbjct: 10  LPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGAAKEA 69

Query: 95  LIALKGPLATPIGKG-----HRSLNLTLRKTFGLFANVRP----AKSIEGYK----TTYE 141
              L G +  P  +G      + L L LR+  G++AN+RP    A S+            
Sbjct: 70  DAVLLGAVGGPKWQGGAVRPEQGL-LKLRQELGVYANLRPCNFAADSLLELSPLRPEIAR 128

Query: 142 NVNLVLIRENTEGEYSGIEHV-VAPGVVQSIKLITQDASERVIRYAFEYA---------R 191
           + +++++RE   G Y G  H     GV       T    +R+ R A   A          
Sbjct: 129 DTDIMVVRELLGGSYFGERHEDEGDGVAWDTDKYTVKEVQRIARMAGFLALQHDPPLPVW 188

Query: 192 AVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKTVQHPEAYDD 251
           ++D++ VL    S + R        V +   SE+P+++LQ +L+D+  +  V++P A++ 
Sbjct: 189 SLDKANVLA--SSRLWRKT------VEETFQSEFPNVQLQHQLIDSAAMILVKNPRAFNG 240

Query: 252 VVVVCPNLYGDIXXXXXXX--XXXXXXXXXXXANIGHTVSIF---EAVHGSAPDIAGQNK 306
           VVV   N++GDI                    A++  + S F   E  HGSAPD+    K
Sbjct: 241 VVVTS-NMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPDLPA-GK 298

Query: 307 ANPTALLLSSVMMLN-HMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAV 364
           ANP   +LS+ MML   + +    + +E+AV   +  D+  RTGDL GS+STS   DA+
Sbjct: 299 ANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVL--DSGVRTGDLLGSSSTSEVGDAI 355

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score = 89.0 bits (219), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 89/313 (28%), Positives = 139/313 (44%), Gaps = 42/313 (13%)

Query: 81  TTIPDPAVASINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK---- 131
           T +PD A+ +  K    L G +  P  G G     + L L +RK  GL+AN+RP      
Sbjct: 54  TPLPDEALEASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASD 112

Query: 132 ---SIEGYKTTY-ENVNLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITQDASERVIRYA 186
               +   K  Y +  + V++RE   G Y G  +     GV    +  +    +R+ R A
Sbjct: 113 SLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMA 172

Query: 187 FEYA---------RAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDN 237
              A          ++D++ VL    S + R        V + + +E+P + +Q +L+D+
Sbjct: 173 AFLALQQNPPLPIWSLDKANVLA--SSRLWRKT------VEETIKTEFPQLTVQHQLIDS 224

Query: 238 TVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHTVSIFE 292
             +  V+ P   + VV+   N++GDI                        +      ++E
Sbjct: 225 AAMILVKSPTKLNGVVITN-NMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYE 283

Query: 293 AVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVLTTIASDAKNRTGDL 351
             HGSAPD+   NK NP A +LS+ MML   + L E    +E+AV   +  DA  RTGDL
Sbjct: 284 PCHGSAPDLPA-NKVNPIATILSAAMMLKLSLDLVEEGRALEEAVRNVL--DAGVRTGDL 340

Query: 352 GGSASTSSFTDAV 364
           GGS ST+   DA+
Sbjct: 341 GGSNSTTEVGDAI 353

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score = 88.2 bits (217), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 100/364 (27%), Positives = 160/364 (43%), Gaps = 50/364 (13%)

Query: 41  IEGDGVGPEIS-------KSVKAIFSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINK 93
           + GD VG EI+       K++  + S  K   E      + I   G+  +PD A+ +  K
Sbjct: 10  LPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVP-LPDEALEASKK 68

Query: 94  NLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGYKTTY- 140
               L G +  P  G G     + L L +RK   L+AN+RP          +   K  + 
Sbjct: 69  ADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKPQFA 127

Query: 141 ENVNLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITQDASERVIRYAFEYA--------- 190
           +  + V++RE   G Y G  +     GV    +  T    +R+ R A   A         
Sbjct: 128 KGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEPPLPI 187

Query: 191 RAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKTVQHPEAYD 250
            ++D++ VL    S + R        V + + +E+P +++Q +L+D+  +  V++P   +
Sbjct: 188 WSLDKANVLA--SSRLWRKT------VEETIKNEFPTLKVQHQLIDSAAMILVKNPTHLN 239

Query: 251 DVVVVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHTVSIFEAVHGSAPDIAGQN 305
            +++   N++GDI                        +      ++E  HGSAPD+  +N
Sbjct: 240 GIIITS-NMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KN 297

Query: 306 KANPTALLLSSVMMLN-HMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAV 364
           K NP A +LS+ MML   + L E    IE AV   +  DA  RTGDLGGS ST+   DAV
Sbjct: 298 KVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVL--DAGIRTGDLGGSNSTTEVGDAV 355

Query: 365 IERL 368
            E +
Sbjct: 356 AEEV 359

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 99/363 (27%), Positives = 159/363 (43%), Gaps = 50/363 (13%)

Query: 38  VSFIEGDGVGPEIS-------KSVKAIFSAAKVPIEWESCDVSPIFVNGLTTIPDPAVAS 90
           +  + GD VG EI+       K++  + S  K   E      + I   G+  +PD A+ +
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVP-LPDEALEA 65

Query: 91  INKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGYKT 138
             K    L G +  P  G G     + L L +RK   L+AN+RP          +   K 
Sbjct: 66  SKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 139 TY-ENVNLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITQDASERVIRYAFEYA------ 190
            + +  + V++RE   G Y G  +     GV    +  T    +R+ R A   A      
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGERKEDDGDGVAWDCEQYTVPEVQRITRMAAFMALQHEPP 184

Query: 191 ---RAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKTVQHPE 247
               ++D++ VL    S + R        V + + +E+P +++Q +L+D+  +  V++P 
Sbjct: 185 LPIWSLDKANVLA--SSRLWRKT------VEETIKNEFPTLKVQHQLIDSAAMILVKNPT 236

Query: 248 AYDDVVVVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHTVSIFEAVHGSAPDIA 302
             + +++   N++GDI                        +      ++E  HGSAPD+ 
Sbjct: 237 HLNGIIITS-NMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP 295

Query: 303 GQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFT 361
            +NK NP A +LS+ MML   + L E    IE AV   +  DA  RTGDLGGS ST+   
Sbjct: 296 -KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVKRVL--DAGIRTGDLGGSNSTTEVG 352

Query: 362 DAV 364
           DAV
Sbjct: 353 DAV 355

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 98/363 (26%), Positives = 169/363 (46%), Gaps = 50/363 (13%)

Query: 38  VSFIEGDGVGPEIS-KSVKAIFSAAKVP------IEWESCDVSPIFVNGLTTIPDPAV-A 89
           +  + GD VG EI+ ++VK + + A+V        ++     + I   G+  +PD A+ A
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVP-LPDEALEA 64

Query: 90  SINKNLI---ALKGP-LATPIGKGHRSLNLTLRKTFGLFANVRP----AKSIEGYKTTYE 141
           S N + +   A+ GP   T   +  + L L +RK  GL+AN+RP    ++S+ G      
Sbjct: 65  SKNSDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 142 NV----NLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITQDASERVIRYAFEYA------ 190
            +    + +++RE   G Y G  +     GV    +  +    +R+ R A   A      
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRKEDEGDGVAWDSEQYSVPEVQRITRMAAFLALQHNPP 183

Query: 191 ---RAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKTVQHPE 247
               ++D++ VL    S + R        V + + +E+P + +Q +L+D+  +  V++P 
Sbjct: 184 LPIWSLDKANVLA--SSRLWRKT------VEETIKNEFPTLTVQNQLIDSAAMILVKNPT 235

Query: 248 AYDDVVVVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHTVSIFEAVHGSAPDIA 302
             + +++   N++GDI                        +      ++E  HGSAPD+ 
Sbjct: 236 QLNGIIITS-NMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP 294

Query: 303 GQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFT 361
            + K NP A +LS+ MML   + L +  D IE+AV   +  DA  RTGDLGGS ST+   
Sbjct: 295 -KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVL--DAGIRTGDLGGSNSTTEVG 351

Query: 362 DAV 364
           DA+
Sbjct: 352 DAI 354

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 126/274 (45%), Gaps = 36/274 (13%)

Query: 115 LTLRKTFGLFANVRPAK-------SIEGYKTTY-ENVNLVLIRENTEGEYSG-IEHVVAP 165
           L +RK   L+AN+RP          +   K  + +  + V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 166 GVVQSIKLITQDASERVIRYAFEYA---------RAVDRSKVLVVHKSTIQRLADGLFVD 216
           GV    +  T+   +R+ R A   A          ++D++ VL    S + R        
Sbjct: 152 GVAWDSEKYTKPEVQRLTRMAAFLALQHNPPLPIWSLDKANVLA--SSRLWRKT------ 203

Query: 217 VAKKLSSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXX-- 274
           V + + +E+P ++L  +L+D+  +  V+ P   + +V+   NL+GDI             
Sbjct: 204 VEETIKNEFPQLKLNHQLIDSAAMILVKSPTQLNGIVLTS-NLFGDIISDEASVIPGSLG 262

Query: 275 ---XXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHAD 330
                      +      ++E  HGSAPD+  + K NP A++LS+ MML   + L++  +
Sbjct: 263 LLPSASLASLPDTNEAFGLYEPCHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGE 321

Query: 331 KIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAV 364
            +EKAV   +  D+  RTGDLGGS STS   DA+
Sbjct: 322 AVEKAVKQVL--DSGVRTGDLGGSNSTSEVGDAI 353

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 123/276 (44%), Gaps = 32/276 (11%)

Query: 115 LTLRKTFGLFANVRP----AKSIEGYK----TTYENVNLVLIRENTEGEYSG-IEHVVAP 165
           L +RK  GL+AN+RP    +KS+ G         +  + V++RE   G Y G  +     
Sbjct: 94  LAIRKELGLYANLRPCSFISKSLLGLSPLKPEIAQGTDFVILRELVGGIYFGERKEDDGD 153

Query: 166 GVVQSIKLITQDASERVIRYAFEYARAVDR-------SKVLVVHKSTIQRLADGLFVDVA 218
           GV    +  T    ER+ R     A   D         K  V+  S + R        V 
Sbjct: 154 GVAWDSEKYTVSEVERITRMGAFLALQHDPPLPLWSFDKANVLASSRLWRRT------VN 207

Query: 219 KKLSSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXX---- 274
           + +  E+P + +Q +L+D+  +  +++P  ++ +V+   N++GDI               
Sbjct: 208 ETIKREFPQLSVQHQLIDSAAMIMIKNPRKFNGIVITS-NIFGDIISDAASVIPGSLGLL 266

Query: 275 -XXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKI 332
                    +  +   ++E  HGSAPD+  + +ANP A +LS+ MML   + + +    I
Sbjct: 267 PSASLASEPDKNNAFGLYEPCHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAI 325

Query: 333 EKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           E AV   I S    RTGDLGG+ +T+   DAV   L
Sbjct: 326 ENAVKQVIESGI--RTGDLGGNNTTTEVGDAVTHAL 359

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 100/364 (27%), Positives = 162/364 (44%), Gaps = 58/364 (15%)

Query: 41  IEGDGVGPEIS-KSVKAIFSAAKVPIEWESCDVSPIFVNGL----------TTIPDPAVA 89
           + GD VG EI+ +++K + + ++V       DV+  F N L            +PD A+ 
Sbjct: 10  LPGDHVGQEITAEAIKVLKAISEV-----RSDVNFDFENHLIGGAAIDATGVPLPDEALE 64

Query: 90  SINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGYK 137
           +  K    L G +  P  G G     + L L +RK   L+AN+RP          +   K
Sbjct: 65  ASKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIK 123

Query: 138 TTY-ENVNLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITQDASERVIRYAFEYA----- 190
             + +  + V++RE   G Y G  +     GV    +  T    +R+ R A   A     
Sbjct: 124 PQFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHEP 183

Query: 191 ----RAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKTVQHP 246
                ++D++ VL    S + R        V + + +E+P +++Q +L+D+  +  V++P
Sbjct: 184 PLPIWSLDKANVLA--SSRLWRKT------VEETIKNEFPTLKVQHQLIDSAAMILVKNP 235

Query: 247 EAYDDVVVVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHTVSIFEAVHGSAPDI 301
              + +++   N++GDI                        +      ++E  HGSAPD+
Sbjct: 236 THLNGIIITS-NMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDL 294

Query: 302 AGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSF 360
             +NK NP A +LS+ MML   + L E    IE AV   +  DA  RTGDLGGS ST+  
Sbjct: 295 P-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVL--DAGIRTGDLGGSNSTTEV 351

Query: 361 TDAV 364
            DAV
Sbjct: 352 GDAV 355

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 85.9 bits (211), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 133/278 (47%), Gaps = 37/278 (13%)

Query: 115 LTLRKTFGLFANVRPAKSIE----GYKTTYENV----NLVLIRENTEGEY---------S 157
           L +RK  GL+ N+RP K I     G     E V    + V++RE   G Y         S
Sbjct: 94  LKIRKELGLYGNLRPCKFISDKLIGLSPLKEEVCKGTDFVVVRELVGGIYFGERQEDDGS 153

Query: 158 GIEHVVAPGVVQSIKLITQDASERVIRYAFEYA-RAVDRSKVLVVHKSTIQRLADGLFVD 216
           G+        ++ +K IT+ A+   ++        ++D++ VL    S + R A    VD
Sbjct: 154 GVAWDSEKYSIEEVKRITKMAAFLSLQNDPPLPIWSLDKANVLA--SSRLWRAA----VD 207

Query: 217 VAKKLSSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXX-- 274
              +  +E+P++++Q +L+D+  +  V++P   + +++   N++GDI             
Sbjct: 208 ---ETIAEFPNLKVQHQLIDSAAMMLVKNPTQLNGIILTN-NMFGDIISDEASVIPGSLG 263

Query: 275 ---XXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHAD 330
                      +      ++E  HGSAPD+A + K NP A +LS+ MML   + + +  +
Sbjct: 264 LLPSASLASLPDKNKAFGLYEPCHGSAPDLA-RGKVNPVATILSAAMMLKLSLDMVQEGE 322

Query: 331 KIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
            IE+AV  ++  D   RT DLGG+++TS   DAV + L
Sbjct: 323 AIERAV--SVVLDRGIRTADLGGNSTTSELGDAVAQEL 358

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 87/311 (27%), Positives = 136/311 (43%), Gaps = 42/311 (13%)

Query: 83  IPDPAVASINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK------ 131
           +PD A+ +  K    L G +  P  G G     + L L +RK   L+AN+RP        
Sbjct: 56  LPDEALEASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSL 114

Query: 132 -SIEGYKTTY-ENVNLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITQDASERVIRYAFE 188
             +   K  Y +  + V++RE   G Y G  +     GV    +  +    +R+ R A  
Sbjct: 115 LELSPLKAQYAQGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEQYSVPEVQRITRMAAF 174

Query: 189 YA---------RAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTV 239
            A          ++D++ VL    S + R        V K +  E+P + +  +L+D+  
Sbjct: 175 LALQHNPPLPIWSLDKANVLA--SSRLWRKT------VEKTIKEEFPTLSVNHQLIDSAA 226

Query: 240 LKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHTVSIFEAV 294
           +  V++P   + +++   N++GDI                        +      ++E  
Sbjct: 227 MILVKNPTQLNGIIITS-NMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPC 285

Query: 295 HGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVLTTIASDAKNRTGDLGG 353
           HGSAPD+A + K NP A +LS+ MML   + + E    IEKAV   +  D   RTGDLGG
Sbjct: 286 HGSAPDLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKKVL--DDGIRTGDLGG 342

Query: 354 SASTSSFTDAV 364
           S STS   DAV
Sbjct: 343 SNSTSEVGDAV 353

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score = 83.2 bits (204), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 125/274 (45%), Gaps = 36/274 (13%)

Query: 115 LTLRKTFGLFANVRP----AKSIEGYKTTYENV----NLVLIRENTEGEYSG-IEHVVAP 165
           L +RK  GL+AN+RP    ++ + G       +    + +++RE   G Y G  +     
Sbjct: 95  LKIRKELGLYANLRPCNFASEPLLGLSPLRPEIAKGTDFMVVRELVGGIYFGERKEDDGD 154

Query: 166 GVVQSIKLITQDASERVIRYAFEYA---------RAVDRSKVLVVHKSTIQRLADGLFVD 216
           GV    +  +    ER+ R A   A          ++D++ VL    S + R        
Sbjct: 155 GVAWDSEKYSVPEVERITRMAAFLALQHNPPLPIWSLDKANVLA--SSRLWRKT------ 206

Query: 217 VAKKLSSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXX-- 274
           V   + +E+P + +Q +L+D+  +  V++P   + +++   N++GDI             
Sbjct: 207 VEATIKNEFPTLTVQNQLIDSAAMILVKNPTQLNGIIITS-NMFGDIISDEASVIPGSLG 265

Query: 275 ---XXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHAD 330
                      +      ++E  HGSAPD+  +NK NP A +LS+ MML   + + +  +
Sbjct: 266 LLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KNKVNPVATILSAAMMLKLSLNMVKEGE 324

Query: 331 KIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAV 364
            +E+AV   +  DA  RTGDLGGS ST    DA+
Sbjct: 325 AVEEAVRRVL--DAGVRTGDLGGSNSTQEVGDAI 356

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 122/274 (44%), Gaps = 36/274 (13%)

Query: 115 LTLRKTFGLFANVRPAK-------SIEGYKTTY-ENVNLVLIRENTEGEYSGI-EHVVAP 165
           L +RK   L+AN+RP          +   K  +    + V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASESLLELSPIKPQFARGTDFVVVRELVGGIYFGKRKEDDGD 153

Query: 166 GVVQSIKLITQDASERVIRYAFEYA---------RAVDRSKVLVVHKSTIQRLADGLFVD 216
           GV    +  T    +R+ R A   A          ++D++ VL    S + R        
Sbjct: 154 GVAWDSEQYTVPEVQRITRMAAFMALQHQPPLPIWSLDKANVLA--SSRLWRKT------ 205

Query: 217 VAKKLSSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXX-- 274
           V + + +E+P +++Q +L+D+  +  V++P   + +++   N++GDI             
Sbjct: 206 VEETIKNEFPTLKVQHQLIDSAAMILVKNPTQLNGIIITS-NMFGDIISDEASCIPGSLG 264

Query: 275 ---XXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHAD 330
                      +      ++E  HGSAPD+  +NK NP A +LS+ MML   + +T    
Sbjct: 265 LLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNMTAEGQ 323

Query: 331 KIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAV 364
            IE AV   +  DA  RTGDLGGS ST    DAV
Sbjct: 324 AIEDAVKKVL--DAGIRTGDLGGSNSTIEVGDAV 355

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 123/274 (44%), Gaps = 36/274 (13%)

Query: 115 LTLRKTFGLFANVRPAKSIEGY--------KTTYENVNLVLIRENTEGEYSGIEHVVAP- 165
           L +RK  G++AN+RP + +           +   +  + V++RE   G Y G        
Sbjct: 94  LKIRKELGVYANLRPCQFVSETLLDLSPLKREIVQGTDFVIVRELVGGIYFGERQEAGDD 153

Query: 166 GVVQSIKLITQDASERVIRYAFEYA---------RAVDRSKVLVVHKSTIQRLADGLFVD 216
           GV    +  +    +R+ R A   A          ++D++ VL    S + R        
Sbjct: 154 GVAWDKESYSVPEIQRITRMAAFLALQHNPPLPVWSLDKANVLAT--SRLWRKT------ 205

Query: 217 VAKKLSSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXX-- 274
           V + + +E+P + +   L+D+  +  VQ+P   + VV+   N++GDI             
Sbjct: 206 VEETIKNEFPTLTINHHLIDSAAMTLVQNPTKLNGVVITT-NMFGDIISDEASVIPGSLG 264

Query: 275 ---XXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHAD 330
                      +    + ++E  HGSAPD+   + ANP A +LS+ MM    + LT+  +
Sbjct: 265 LLPSASLASLPDKNDALGLYEPCHGSAPDLPA-DHANPIATILSAAMMCKLSLNLTKEGN 323

Query: 331 KIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAV 364
            IE+AV  TI  DA  +TGDLGG  +T+   +AV
Sbjct: 324 AIEEAVKRTI--DAGIKTGDLGGKNTTTEVGNAV 355

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 123/276 (44%), Gaps = 36/276 (13%)

Query: 115 LTLRKTFGLFANVRPAK-------SIEGYKTTY-ENVNLVLIRENTEGEYSG-IEHVVAP 165
           L +RK   L+AN+RP          +   K  Y +  + V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGD 153

Query: 166 GVVQSIKLITQDASERVIRYAFEYA---------RAVDRSKVLVVHKSTIQRLADGLFVD 216
           GV    +  +    +R+ R A   A          ++D++ VL    S + R        
Sbjct: 154 GVAWDSEKYSVPEVQRITRMAAFLALQQNPPLPIWSLDKANVLA--SSRLWRKT------ 205

Query: 217 VAKKLSSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXX-- 274
           V + + +E+P + +Q +L+D+  +  V+ P   + +V+   N++GDI             
Sbjct: 206 VEETIKNEFPTLTVQHQLIDSAAMILVKSPTKLNGIVITS-NMFGDIISDEASVIPGSLG 264

Query: 275 ---XXXXXXXANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHAD 330
                      +      ++E  HGSAPD+  +NK NP A +LS+ MML   + L E  +
Sbjct: 265 LLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLVEEGN 323

Query: 331 KIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIE 366
            +E+AV   +  DA  RT DL G  STS   DAV++
Sbjct: 324 AVEEAVRRVL--DAGIRTADLRGENSTSEVGDAVVK 357

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 97/364 (26%), Positives = 161/364 (44%), Gaps = 51/364 (14%)

Query: 38  VSFIEGDGVGPEIS----KSVKAIFSAAKVPIEWES----CDVSPIFVNGLTTIPDPAVA 89
           +  + GD VG EI     K ++A+ S++   I++E        + I   G T +PD A+ 
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATG-TPLPDEALD 64

Query: 90  SINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSIEGYKTTY 140
           +   +   L G +  P  G G     + L L +RK   L+AN+RP    + S+ G     
Sbjct: 65  AAKNSDAVLLGAVGGPKWGTGDVRPEQGL-LKIRKELQLYANLRPCNFVSDSLLGLSPLK 123

Query: 141 ENV----NLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITQDASERVIRYAFEYA----- 190
           E +    +  ++RE   G Y G  +     G     +  T    +R+ R A   A     
Sbjct: 124 EEIAKGTDFTVVRELVGGIYFGDRKEDDGDGSAWDCEKYTIPEVQRITRMAAFLALQHDP 183

Query: 191 ----RAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKTVQHP 246
                ++D++ VL    S + R        V + + +E+P++++Q +L+D+  +  V+ P
Sbjct: 184 PLPIWSLDKANVLA--SSRLWRKT------VEETIKNEFPNLKVQHQLIDSAAMILVKSP 235

Query: 247 EAYDDVVVVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHTVSIFEAVHGSAPDI 301
              + +++   N++GDI                        +      ++E  HGSAPD+
Sbjct: 236 RQLNGIIITN-NMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDL 294

Query: 302 AGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSF 360
             + K NP A +LS+ MML   + L +    IE+AV   +  DA  RT DL GS STS  
Sbjct: 295 P-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVL--DAGIRTADLKGSNSTSEV 351

Query: 361 TDAV 364
            DAV
Sbjct: 352 GDAV 355

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 92/360 (25%), Positives = 154/360 (42%), Gaps = 50/360 (13%)

Query: 41  IEGDGVGPEIS-------KSVKAIFSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINK 93
           + GD VG EI+       K++  + S+ K   +      + I   G   +PD ++ +  K
Sbjct: 10  LPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATG-EPLPDASLEAAKK 68

Query: 94  NLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGYKTTY- 140
               L G +  P  G G     + L L +RK   L+AN+RP          +   K  + 
Sbjct: 69  ADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKAEHA 127

Query: 141 ENVNLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITQDASERVIRYAFEYA--------- 190
              + V++RE   G Y G  +     GV    +  +    +R+ R A   A         
Sbjct: 128 RGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQHNPPLPV 187

Query: 191 RAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKTVQHPEAYD 250
            ++D++ VL    S + R        V + + +E+P + +Q +L+D+  +  V++P   +
Sbjct: 188 WSLDKANVLA--SSRLWRKT------VEETIKNEFPTLTVQHQLIDSAAMIMVKNPTQLN 239

Query: 251 DVVVVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHTVSIFEAVHGSAPDIAGQN 305
            V++   N++GDI                        +      ++E  HGSAPD+  + 
Sbjct: 240 GVIITN-NMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLE-KG 297

Query: 306 KANPTALLLSSVMMLN-HMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAV 364
           K NP A +LS+ MML   + + E    +E+AV   +  D+  RTGDL GS ST    DAV
Sbjct: 298 KVNPIATILSAAMMLELSLDMFEEGTAVEEAVRRVL--DSGIRTGDLRGSNSTQEVGDAV 355

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 95/368 (25%), Positives = 156/368 (42%), Gaps = 49/368 (13%)

Query: 32  KTGKYTVSFIEGDGVGPEISKSVKAIFSAAKVPIEWESCDVSPIFVNGLTT------IPD 85
           +T K+ V  + GD VG EI++    + +A        + D     + G         +PD
Sbjct: 85  QTTKHIV-VLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPD 143

Query: 86  PAVASINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SI 133
            A+ +  K    L G +  P  G G     + L L +RK   L+AN+RP          +
Sbjct: 144 EALEASKKADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDL 202

Query: 134 EGYK-TTYENVNLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITQDASERVIRYAFEYA- 190
              K    +  ++ ++RE   G Y G  +     GV    +  +    +R+ R A   A 
Sbjct: 203 SPLKPEIVKGTDICIVRELVGGIYFGERKEDEGDGVAWDSEKYSVSEVQRITRMAGFLAL 262

Query: 191 --------RAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKT 242
                    ++D++ VL    S + R        V + + +E+P + +Q +L+D+  +  
Sbjct: 263 QHNPPLPVWSLDKANVLA--SSRLWRKT------VEETIKNEFPTLTVQHQLIDSAAMIL 314

Query: 243 VQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHTVSIFEAVHGS 297
           V++P   + VV+   N++GDI                        +      ++E  HGS
Sbjct: 315 VKNPTHLNGVVI-ANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGS 373

Query: 298 APDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSAS 356
           APD+  + K NP A +LS  MML   + +TE    +EKAV   +  D+  RT DL GS S
Sbjct: 374 APDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVL--DSGVRTADLRGSNS 430

Query: 357 TSSFTDAV 364
           TS   DA+
Sbjct: 431 TSEVGDAI 438

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 90/365 (24%), Positives = 151/365 (41%), Gaps = 51/365 (13%)

Query: 37  TVSFIEGDGVGPEISKSVKAIFSA--------AKVPIEWESCDVSPIFVNGLTTIPDPAV 88
            +  + GD VG E+++    I  A         K   E+     + I   G   +PD ++
Sbjct: 6   NIVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATG-NPLPDESL 64

Query: 89  ASINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGY 136
            +  +    L G +  P  G G     + L L +RK   L+AN+RP          +   
Sbjct: 65  EASKRADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 137 KTTY-ENVNLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITQDASERVIRYAFEYAR--- 191
           K  Y +  +  ++RE   G Y G  +     GV    +  +    +R+ R A   A    
Sbjct: 124 KEKYAKGTDFTVVRELVGGIYFGKRKEDDGDGVAWDSEQYSVPEVQRITRMAAFLAMQHN 183

Query: 192 ------AVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKTVQH 245
                 ++D++ VL    S + R        V + + +E+P +++  +L+D+  +  V++
Sbjct: 184 PPLPIWSLDKANVLA--SSRLWRKT------VEETIQNEFPSLKVSHQLIDSAAMILVKN 235

Query: 246 PEAYDDVVVVCPNLYGDIXXXXXXX-----XXXXXXXXXXXANIGHTVSIFEAVHGSAPD 300
           P   + +++   N++GDI                        +      ++E  HGSAPD
Sbjct: 236 PTQLNGIIITN-NMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLYEPCHGSAPD 294

Query: 301 IAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSS 359
           +  + K NP   +LS  MML   + L E    +E+AV   +  D   RT DLGGS STS 
Sbjct: 295 LP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAVRRVL--DNNIRTADLGGSNSTSD 351

Query: 360 FTDAV 364
             DAV
Sbjct: 352 IGDAV 356

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 91/364 (25%), Positives = 157/364 (43%), Gaps = 49/364 (13%)

Query: 37  TVSFIEGDGVGPEISKSVKAIFSAA------KVPIEWESCDVSPIFVNGL-TTIPDPAVA 89
           T+  + GD VG EI++    + +A       KV  +++   +    ++     +PD A+ 
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 90  SINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGYK 137
           +  K    L G +  P  G G     + L L +RK   L+AN+RP          +   K
Sbjct: 66  ASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLK 124

Query: 138 TTY-ENVNLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITQDASERVIRYAFEYA----- 190
                  + V++RE   G Y G  +     GV    +  +    +R+ R A   A     
Sbjct: 125 PEIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFMALQHNP 184

Query: 191 ----RAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVLKTVQHP 246
                ++D++ VL    S + R        V + + +E+P + +Q +L+D+  +  V++P
Sbjct: 185 PLPIWSLDKANVLA--SSRLWRKT------VEETIKNEFPQLTVQHQLIDSAAMILVKNP 236

Query: 247 EAYDDVVVVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHTVSIFEAVHGSAPDI 301
              + +++   N++GDI                        +      ++E  HGSAPD+
Sbjct: 237 THLNGIIITN-NMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDL 295

Query: 302 AGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSF 360
             + K NP A +LS+ MML   + L E  + IE+AV   +  D+  RT DL G+ ST+  
Sbjct: 296 P-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVL--DSGIRTADLKGTNSTTEV 352

Query: 361 TDAV 364
            DAV
Sbjct: 353 GDAV 356

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 139/315 (44%), Gaps = 42/315 (13%)

Query: 83  IPDPAVASINKNLIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK------ 131
           +PD ++ +  K+   L G +  P  G G     + L L +RK   L+AN+RP        
Sbjct: 58  LPDASLEAAKKSDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESL 116

Query: 132 -SIEGYK-TTYENVNLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITQDASERVIRYAFE 188
             +   K       + V++RE   G Y G  +     GV    +  +    +R+ R A  
Sbjct: 117 LDLSPLKPECARGTDFVVVRELVGGIYFGERKEDTGDGVAWDSEQYSVPEVQRITRMAAF 176

Query: 189 YA---------RAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTV 239
            A          ++D++ VL    S + R        V + + +E+P + +Q +L+D+  
Sbjct: 177 LALQHSPPLPVWSLDKANVLA--SSRLWRKT------VEETIKNEFPTLTVQHQLIDSAA 228

Query: 240 LKTVQHPEAYDDVVVVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHTVSIFEAV 294
           +  V++P   + V++   N++GDI                        +      ++E  
Sbjct: 229 MILVKNPTQLNGVIITN-NMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPC 287

Query: 295 HGSAPDIAGQNKANPTALLLSSVMMLN-HMGLTEHADKIEKAVLTTIASDAKNRTGDLGG 353
           HGSAPD+  + K NP A +LS+ MML   + + E    +E+AV   +  D+  RT DL G
Sbjct: 288 HGSAPDLP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVL--DSGVRTADLKG 344

Query: 354 SASTSSFTDAVIERL 368
           +++TS   +AV++ L
Sbjct: 345 TSTTSEVGEAVVKAL 359

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 53.5 bits (127), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%), Gaps = 1/51 (1%)

Query: 318 MMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368
           +MLNH+GL E A +I KAV  TIA + K+ T D+GGS+ST+ FT+ +I +L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIA-EGKHTTRDIGGSSSTTDFTNEIINKL 50

>NDAI0K02240 Chr11 (504932..507265) [2334 bp, 777 aa] {ON} Anc_6.344
           YNR033W
          Length = 777

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 13/109 (11%)

Query: 65  IEW--ESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKTFG 122
           ++W  ++C++ PI      T+      ++ K    LK P     G+    L+L     + 
Sbjct: 577 LKWNKDTCELRPI----KGTVKKTEDMTLEKATSILKTP--KEFGENLMILDLIRNDLYE 630

Query: 123 LFANVRPAK--SIEGYKTTYENVNLVLIRENTEGEYSGIE---HVVAPG 166
           L  +VR  +  S+E Y T Y+ V+++      E +YSGI+   H + PG
Sbjct: 631 LLPDVRVEEFMSVEEYATVYQLVSVIKAYGLNESKYSGIDILKHSLPPG 679

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,629,718
Number of extensions: 1281111
Number of successful extensions: 4029
Number of sequences better than 10.0: 89
Number of HSP's gapped: 3797
Number of HSP's successfully gapped: 89
Length of query: 368
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 257
Effective length of database: 40,753,473
Effective search space: 10473642561
Effective search space used: 10473642561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)