Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E02355g5.442ON32432417200.0
SAKL0G02706g5.442ON33232913650.0
KLTH0F15884g5.442ON32932613230.0
Kwal_55.213995.442ON32932613070.0
YDR372C (VPS74)5.442ON34534313070.0
Smik_4.6385.442ON34634413050.0
KAFR0D050605.442ON32632412980.0
Suva_2.5445.442ON34634412990.0
Skud_4.6415.442ON34634412931e-180
NCAS0F034305.442ON33233012811e-178
ZYRO0F10208g5.442ON33232912761e-177
Ecym_45135.442ON33333312751e-177
CAGL0A02926g5.442ON32832712561e-174
KNAG0B042005.442ON34434212541e-174
TDEL0D025905.442ON33032812511e-174
ACL165C5.442ON33133112261e-170
NDAI0B057205.442ON36531512221e-169
TBLA0A064805.442ON33433212091e-167
Kpol_1016.25.442ON32832712081e-167
TPHA0J026105.442ON32932611331e-156
Kpol_1062.245.442ON2762769111e-123
TBLA0A027805.442ON3873048991e-119
NCAS0H020905.442ON3452846041e-75
TDEL0G017704.14ON310465741.2
AFR281C5.696ON66058712.3
Suva_7.2544.92ON70640702.8
Ecym_84104.14ON312362677.1
Kpol_2001.271.185ON520115668.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E02355g
         (324 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   667   0.0  
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   530   0.0  
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   514   0.0  
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   508   0.0  
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   508   0.0  
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   507   0.0  
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   504   0.0  
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   504   0.0  
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   502   e-180
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   498   e-178
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   496   e-177
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   495   e-177
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   488   e-174
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   487   e-174
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   486   e-174
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   476   e-170
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   475   e-169
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   470   e-167
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   469   e-167
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   441   e-156
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   355   e-123
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   350   e-119
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   237   1e-75
TDEL0G01770 Chr7 (349483..358797) [9315 bp, 3104 aa] {ON} Anc_4....    33   1.2  
AFR281C Chr6 complement(941608..943590) [1983 bp, 660 aa] {ON} S...    32   2.3  
Suva_7.254 Chr7 complement(437133..439253) [2121 bp, 706 aa] {ON...    32   2.8  
Ecym_8410 Chr8 (851627..860998) [9372 bp, 3123 aa] {ON} similar ...    30   7.1  
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    30   8.4  

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/324 (100%), Positives = 324/324 (100%)

Query: 1   MSLQRRRVNKGDTTESIPQIDNEHDHKIVYDEQEAKLRDNTSVPKLTLMEEVLLMGLKDK 60
           MSLQRRRVNKGDTTESIPQIDNEHDHKIVYDEQEAKLRDNTSVPKLTLMEEVLLMGLKDK
Sbjct: 1   MSLQRRRVNKGDTTESIPQIDNEHDHKIVYDEQEAKLRDNTSVPKLTLMEEVLLMGLKDK 60

Query: 61  QGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTGEVLL 120
           QGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTGEVLL
Sbjct: 61  QGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTGEVLL 120

Query: 121 DESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNF 180
           DESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNF
Sbjct: 121 DESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNF 180

Query: 181 FLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGAYG 240
           FLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGAYG
Sbjct: 181 FLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGAYG 240

Query: 241 ANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQELNNH 300
           ANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQELNNH
Sbjct: 241 ANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQELNNH 300

Query: 301 PGSDLQLEVVAGVFEVFSRMDTLL 324
           PGSDLQLEVVAGVFEVFSRMDTLL
Sbjct: 301 PGSDLQLEVVAGVFEVFSRMDTLL 324

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  530 bits (1365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/329 (77%), Positives = 288/329 (87%), Gaps = 7/329 (2%)

Query: 3   LQRRRVNKGDT-------TESIPQIDNEHDHKIVYDEQEAKLRDNTSVPKLTLMEEVLLM 55
           LQRRRVN+ ++       T S    +N  D K+ YD +EAKL++NT+VPKLTLMEEVLLM
Sbjct: 4   LQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEVLLM 63

Query: 56  GLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKT 115
           GLKDK+GYLSFWNDNISYALRGCILIELALR KIR +DDPARKR+DVS+RLIEVIDGSKT
Sbjct: 64  GLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDGSKT 123

Query: 116 GEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT 175
           GEVLLDE+L+L+KND P  I  WIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT
Sbjct: 124 GEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT 183

Query: 176 EMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLI 235
           EMKNFFLFDMATHPITDT+CKE+IKRR+LS+LVSRN EL YN YF ++++FK IRTLSLI
Sbjct: 184 EMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTLSLI 243

Query: 236 CGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQ 295
           CGAYGANVLENVLA+LDY+ RD  F+RADEILAQFSEFPF LDK T +G+SVNLNKE+  
Sbjct: 244 CGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKEVQA 303

Query: 296 ELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324
           E+  +PG DLQLEVVAGVFEVFSRMDTLL
Sbjct: 304 EIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/326 (75%), Positives = 285/326 (87%), Gaps = 4/326 (1%)

Query: 3   LQRRRVNKGDTTESI-PQIDNEHD---HKIVYDEQEAKLRDNTSVPKLTLMEEVLLMGLK 58
           LQRRRVNK ++  S  P +++E D    ++ YD +EAKLRD+T+ PKL LMEEVLLMGLK
Sbjct: 4   LQRRRVNKSESISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLMGLK 63

Query: 59  DKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTGEV 118
           DK+GYLSFWNDNISYALRGCILIELALRGKI+ ++DPARKR+DVSERL+EVI+ +KTGEV
Sbjct: 64  DKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKTGEV 123

Query: 119 LLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMK 178
           LLDE+L+LMKND P +I  WIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGVLRTEMK
Sbjct: 124 LLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRTEMK 183

Query: 179 NFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGA 238
           NFFLFDM THPITDT+CKE+IKRRILS+LVSRN +L YN YFP  V FK IRTLSLICGA
Sbjct: 184 NFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLICGA 243

Query: 239 YGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQELN 298
           YGANVLENVL++LDYE RD  F+RADEILAQFS+FPF LDKQT TG+SVNLNKE+ +E+ 
Sbjct: 244 YGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQEEVV 303

Query: 299 NHPGSDLQLEVVAGVFEVFSRMDTLL 324
           ++  + LQLE VAGVFEVFSRMDTLL
Sbjct: 304 SNQDASLQLECVAGVFEVFSRMDTLL 329

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  508 bits (1307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/326 (74%), Positives = 283/326 (86%), Gaps = 4/326 (1%)

Query: 3   LQRRRVNKGDTT-ESIPQIDNEHD---HKIVYDEQEAKLRDNTSVPKLTLMEEVLLMGLK 58
           LQRRRVNK ++  +S P I  E +    ++ YD +EA L+DN ++PKL LMEEVLLMGLK
Sbjct: 4   LQRRRVNKSESNYDSEPVISEEAEGESKRVAYDPEEAMLKDNATIPKLNLMEEVLLMGLK 63

Query: 59  DKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTGEV 118
           DK+GYLSFWNDNISYALRGCILIELALRGKI+ V+D ARKR+DVSERL+EVI+ +KTGEV
Sbjct: 64  DKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATKTGEV 123

Query: 119 LLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMK 178
           LLDE+L+LMKND P +I  WIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGVLRTEMK
Sbjct: 124 LLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRTEMK 183

Query: 179 NFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGA 238
           NFFLFDM THPITDT+CKE+IKRRILS+LVSRN +L YN YFP  VSFK +RTLSLICGA
Sbjct: 184 NFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLICGA 243

Query: 239 YGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQELN 298
           YGANVLENVL +LDYE RD  F+RADEILAQFS+FPF LDKQT TG+SVN+NKE+ +E++
Sbjct: 244 YGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQEEID 303

Query: 299 NHPGSDLQLEVVAGVFEVFSRMDTLL 324
            +  + L+LEVVAGVFEVFSRMDTLL
Sbjct: 304 ANSDALLRLEVVAGVFEVFSRMDTLL 329

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  508 bits (1307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/343 (71%), Positives = 285/343 (83%), Gaps = 20/343 (5%)

Query: 2   SLQRRRVNKGDTTES--------------IPQI------DNEHDHKIVYDEQEAKLRDNT 41
           +LQRRRVN+ D+ ++              I  I      DN  + KI YD +E+KLRDN 
Sbjct: 3   TLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRDNI 62

Query: 42  SVPKLTLMEEVLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYD 101
           ++P LTLMEEVLLMGL+D++GYLSFWND+ISYALRGCI+IELALRGKIR +DD ARKR+D
Sbjct: 63  NIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFD 122

Query: 102 VSERLIEVIDGSKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRE 161
           +SERLIEVID SKTGEVLLDE+L LMKND P SI  WIDLLSGETWNLLKINYQLKQVRE
Sbjct: 123 LSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQVRE 182

Query: 162 RLAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFP 221
           RLAKGLVDKGVLRTEMKNFFLFDMATHPI D +CKE+IKRR+LS+LVSRN EL+YN YFP
Sbjct: 183 RLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFP 242

Query: 222 QDVSFKYIRTLSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQT 281
           +  SFK IRTL+LICG+YGANVLENVL TL+YE RD   +RA+EI+AQFS++PF L+K+T
Sbjct: 243 ETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEKET 302

Query: 282 STGVSVNLNKEISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324
             GVSVNLNKE+ +E+ N+PG DLQLEV+AGVFEVFSRMD LL
Sbjct: 303 ELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  507 bits (1305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/344 (70%), Positives = 285/344 (82%), Gaps = 21/344 (6%)

Query: 2   SLQRRRVNK---GDTTESIPQI------------------DNEHDHKIVYDEQEAKLRDN 40
           +LQRRRVN+   GDT+   P                    DN  + KI YD +E+KLRDN
Sbjct: 3   TLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLRDN 62

Query: 41  TSVPKLTLMEEVLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRY 100
            ++P LTLMEEVLLMGL+D++GYLSFWND+ISYALRGCI+IELALRGKIR +DD ARKR+
Sbjct: 63  INIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRF 122

Query: 101 DVSERLIEVIDGSKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVR 160
           D+SERLIEVIDGSKTGEVLLDE+L LMKND P +I  WIDLLSGETWNLLKINYQLKQVR
Sbjct: 123 DLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVR 182

Query: 161 ERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYF 220
           ERLAKGLVDKGVLRTEMKNFFLFDMATHPI D +CKE+IKRR+LS+LVSRN EL+YN YF
Sbjct: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242

Query: 221 PQDVSFKYIRTLSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQ 280
           P+  SFK IRTL+LICG+YGANVLENVL TL+YE RD   +RA+EI+AQFS+FPF L+K+
Sbjct: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLEKE 302

Query: 281 TSTGVSVNLNKEISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324
           T  G+SVNLNKE+ +E+ ++PG +LQLEV+AGVFEVFSRMD LL
Sbjct: 303 TELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  504 bits (1298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/324 (73%), Positives = 275/324 (84%), Gaps = 1/324 (0%)

Query: 2   SLQRRRVNKGDT-TESIPQIDNEHDHKIVYDEQEAKLRDNTSVPKLTLMEEVLLMGLKDK 60
           +LQRRR N+ D+  +    +    D K+ YD +EAKLRDN S+PKLTLMEEVLLMGL+D+
Sbjct: 3   TLQRRRKNRSDSNADDSENVSESQDRKVAYDPEEAKLRDNVSIPKLTLMEEVLLMGLRDR 62

Query: 61  QGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTGEVLL 120
           +GYLSFWNDNISYALRGCILIELALR KIR +DD ARKR+DVSERL+EVIDGSKTGEVLL
Sbjct: 63  EGYLSFWNDNISYALRGCILIELALRNKIRILDDSARKRFDVSERLVEVIDGSKTGEVLL 122

Query: 121 DESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNF 180
           DE+L LMKND P +I  WIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNF
Sbjct: 123 DEALQLMKNDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNF 182

Query: 181 FLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGAYG 240
           FLFDMATHP+TDT+CKE+IKRRILS LVSRN EL YN+YF +  SFKYIR ++L+C +YG
Sbjct: 183 FLFDMATHPVTDTSCKEAIKRRILSALVSRNMELNYNSYFAETTSFKYIRIVALVCCSYG 242

Query: 241 ANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQELNNH 300
           ANVLENVL++LDYE RD   +RA+EILAQF+++PF L K T  G+SVNLNKE+  E+N +
Sbjct: 243 ANVLENVLSSLDYEKRDRAISRAEEILAQFAQYPFDLSKNTELGISVNLNKEVENEVNEN 302

Query: 301 PGSDLQLEVVAGVFEVFSRMDTLL 324
           P   LQLEV+AGV EVFSRMD LL
Sbjct: 303 PQFTLQLEVIAGVIEVFSRMDMLL 326

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  504 bits (1299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/344 (70%), Positives = 282/344 (81%), Gaps = 21/344 (6%)

Query: 2   SLQRRRVNKGDT--TESIPQIDNEHD-------------------HKIVYDEQEAKLRDN 40
           +LQRRRVN+ D+  T S+    N H+                    KI YD +E+KLRDN
Sbjct: 3   TLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLRDN 62

Query: 41  TSVPKLTLMEEVLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRY 100
             +P LTLMEEVLLMGL+D++GYLSFWND+ISYALRGCILIELALRGKIR +DD ARKR+
Sbjct: 63  IKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARKRF 122

Query: 101 DVSERLIEVIDGSKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVR 160
           D+SERL+EVIDGSKTGEVLLDE+L LMKND P +I  WIDLLSGETWNLLKINYQLKQVR
Sbjct: 123 DLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVR 182

Query: 161 ERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYF 220
           ERLAKGLVDKGVLRTEMKNFFLFDMATHPI D +CKE+IKRR+LS+LVSRN EL+YN YF
Sbjct: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242

Query: 221 PQDVSFKYIRTLSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQ 280
           P+  SFK IRTL+LICG+YGANVLENVL TL+YE RD   +RA+EI++ FS++PF L+K 
Sbjct: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLEKD 302

Query: 281 TSTGVSVNLNKEISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324
           T  GVSVNLNKE+ +E+ N+PG DLQLEV+AGVFEVFSRMD LL
Sbjct: 303 TDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  502 bits (1293), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 241/344 (70%), Positives = 282/344 (81%), Gaps = 21/344 (6%)

Query: 2   SLQRRRVNKGDTTES---------------------IPQIDNEHDHKIVYDEQEAKLRDN 40
           +LQRRRVN+ D+ ++                     I   D+  + KI YD +E+KLRDN
Sbjct: 3   TLQRRRVNRADSGDTSSMQSMSNNDNSKGDKIANIGIDDDDSGANKKIAYDPEESKLRDN 62

Query: 41  TSVPKLTLMEEVLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRY 100
             +P LTLMEEVLLMGL+D++GYLSFWND+ISYALRGCILIELALRGKIR +DD ARKR+
Sbjct: 63  IKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARKRF 122

Query: 101 DVSERLIEVIDGSKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVR 160
           D+SERL+EV+DGSKTGEVLLDE+L LMKND P +I  WIDLLSGETWNLLKINYQLKQVR
Sbjct: 123 DLSERLVEVVDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVR 182

Query: 161 ERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYF 220
           ERLAKGLVDKGVLRTEMKNFFLFDMATHPI D +CKE+IKRR+LS+LVSRN EL+YN YF
Sbjct: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242

Query: 221 PQDVSFKYIRTLSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQ 280
           P+  SFK IRTL+LICG+YGANVLENVL TL+YE RD    RA+EI+AQFS++PF L+K+
Sbjct: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQFSQYPFDLEKE 302

Query: 281 TSTGVSVNLNKEISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324
           T  GVSVNLNKE+ +E+ N+ G DLQLEV+AGVFEVFSRMD LL
Sbjct: 303 TELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMDMLL 346

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  498 bits (1281), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 237/330 (71%), Positives = 284/330 (86%), Gaps = 7/330 (2%)

Query: 2   SLQRRRVNKGD----TTESIPQI--DNEHDHKIVYDEQEAKLRD-NTSVPKLTLMEEVLL 54
           +LQRRRVNK D    T    P +  D+++D+K+ YD +EA++R+    VP LTLMEEVLL
Sbjct: 3   TLQRRRVNKDDSDNETGSVTPNVERDSDNDNKVAYDPEEARMRNVGGQVPVLTLMEEVLL 62

Query: 55  MGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSK 114
           MGL+DK+GYLSFWNDNISYALRGCILIELALRGKI+ +DD ARKR+++SERL++VIDG+K
Sbjct: 63  MGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVIDGTK 122

Query: 115 TGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 174
           TGEVLLDE+L LMKND P SI  WIDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLR
Sbjct: 123 TGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLR 182

Query: 175 TEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSL 234
           TEMKNFFLFDMATHP+TD++CKE+IKRR+LSILVSRN EL+YN YFP+   FK IRT++L
Sbjct: 183 TEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRTIAL 242

Query: 235 ICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEIS 294
           ICGAYGANVLEN+L +LD+E+ D   ARADE++AQFS+FPF L+  T+ G+SVNLN+E+ 
Sbjct: 243 ICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNREVQ 302

Query: 295 QELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324
           QEL + PG DLQLEV+AGV EVFSRMDTLL
Sbjct: 303 QELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  496 bits (1276), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 243/329 (73%), Positives = 270/329 (82%), Gaps = 7/329 (2%)

Query: 3   LQRRRVNKGDT-------TESIPQIDNEHDHKIVYDEQEAKLRDNTSVPKLTLMEEVLLM 55
           LQRRRVN+ D+       T  +   ++    K+ YD +E KL DN  VPKLTLMEEVLL+
Sbjct: 4   LQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKLTLMEEVLLL 63

Query: 56  GLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKT 115
           GL+DK+GYLSFWNDNISYALRGCI+IELALRGKIR VDD ARKR+DVSERLIEV D SKT
Sbjct: 64  GLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDSSKT 123

Query: 116 GEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT 175
           GEVLLDE+L LMK D P SI  WIDLLSGETWN LKINYQLKQVRERLAKGLVDKGVLRT
Sbjct: 124 GEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGVLRT 183

Query: 176 EMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLI 235
           EMKNFFLFDMATHP+TDT+CKE+IKRRILS+LV RN EL YN YF + VSFK IRT++LI
Sbjct: 184 EMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTIALI 243

Query: 236 CGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQ 295
           CGAY ANVLENVL +L YE RD    RADEIL QFSE+PF LD QT +G+S+NLNKE+ Q
Sbjct: 244 CGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKEVGQ 303

Query: 296 ELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324
           EL  HP S LQLEV+AGVFEVFSRMD LL
Sbjct: 304 ELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  495 bits (1275), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 237/333 (71%), Positives = 281/333 (84%), Gaps = 9/333 (2%)

Query: 1   MSLQRRRVNK---GDTTESIPQI------DNEHDHKIVYDEQEAKLRDNTSVPKLTLMEE 51
           MSLQRRRVNK   G T+  + Q       D++  HK+ YD ++ KLR+NT  P LTLMEE
Sbjct: 1   MSLQRRRVNKAEVGGTSVELTQRKHGEDEDDKGSHKVAYDPEDQKLRENTKEPTLTLMEE 60

Query: 52  VLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVID 111
           VLLMGLKDK+GYLSFWND+ISY+LRGCILIELALRGKIR V+D ARKR+D+SERL+EVI+
Sbjct: 61  VLLMGLKDKEGYLSFWNDSISYSLRGCILIELALRGKIRVVEDAARKRFDLSERLVEVIE 120

Query: 112 GSKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKG 171
            SKTGE LLDE+LSLMK++ P SIV WIDLLSGETWNLLKI+YQLKQVRERLAKGLVDKG
Sbjct: 121 TSKTGEALLDETLSLMKSNEPLSIVNWIDLLSGETWNLLKISYQLKQVRERLAKGLVDKG 180

Query: 172 VLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRT 231
           VLRTEMKNFFLFDMATHP+ D++CKESIKRR+LS+LV RN  L Y  YFP+ V+FKY+RT
Sbjct: 181 VLRTEMKNFFLFDMATHPVADSSCKESIKRRMLSVLVPRNVSLDYTEYFPESVAFKYLRT 240

Query: 232 LSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNK 291
           ++LICGAYGANVLENVL++LDYE R+ GF+RA+EIL QFS++PF LDK   TG+SVNL  
Sbjct: 241 IALICGAYGANVLENVLSSLDYEKRERGFSRAEEILTQFSQYPFALDKDVETGISVNLYN 300

Query: 292 EISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324
           ++ +E+  +PG+ LQLEVVAGVFEVFSRMD  L
Sbjct: 301 QVKEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  488 bits (1256), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 233/327 (71%), Positives = 280/327 (85%), Gaps = 5/327 (1%)

Query: 2   SLQRRRVNKGDTTESIPQIDNEHDH----KIVYDEQEAKLRDNTSVPKLTLMEEVLLMGL 57
           +LQRRRVNK +   +  + D E D     KI YD +E+KL++++  P LTLMEEVLLMGL
Sbjct: 3   TLQRRRVNKSENASNGIE-DREDDGTSSGKIAYDPEESKLQNDSKQPTLTLMEEVLLMGL 61

Query: 58  KDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTGE 117
           +D++GYLSFWND+ISYALRGCILIELALR KIR +D PAR R+D+SERLIEVID SKTGE
Sbjct: 62  RDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSKTGE 121

Query: 118 VLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEM 177
           VLLDE+L LM ND P SI  WIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEM
Sbjct: 122 VLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEM 181

Query: 178 KNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICG 237
           KNFFLFDMATHP++D++CKE+IKRRILS+LVSRN E++YN+YFP+  +FK IRT+SLI G
Sbjct: 182 KNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSLIAG 241

Query: 238 AYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQEL 297
           AYGANVLENV+++L+Y+ RD    RA+EILAQFS++PF L K++  G+SVNLNKE+ +EL
Sbjct: 242 AYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQEEL 301

Query: 298 NNHPGSDLQLEVVAGVFEVFSRMDTLL 324
            ++PGSDL+LEV+AGVFEVFSRMD LL
Sbjct: 302 ESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  487 bits (1254), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/342 (67%), Positives = 279/342 (81%), Gaps = 19/342 (5%)

Query: 2   SLQRRRVNKGDTTE----------SIPQIDNEHDH---------KIVYDEQEAKLRDNTS 42
           +LQRRRVN+ D+ E          + P   N+ +          K+ YD +EAKLRDN +
Sbjct: 3   TLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDNYT 62

Query: 43  VPKLTLMEEVLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDV 102
           VPKLTLMEEVLLMGL+D++GYLSFWNDNISYALRGCI+IELALR KIR +DD ARKR+D+
Sbjct: 63  VPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRFDI 122

Query: 103 SERLIEVIDGSKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRER 162
           SERL+EV+DGSKTGEVLLDE+L LMKND P +I  WIDLLSGETWNL+KINYQLKQVRER
Sbjct: 123 SERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVRER 182

Query: 163 LAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQ 222
           LAKGLVDKGVLRTEMKNFFLFDMATHP+TD++CKE+IKRRILS +VSRN EL++N+YFP+
Sbjct: 183 LAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYFPE 242

Query: 223 DVSFKYIRTLSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTS 282
             SFKYIRT++L+C  YGA+VLENVL++LDYE RD   +RA+E+L +F ++PF L+KQ  
Sbjct: 243 STSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQGD 302

Query: 283 TGVSVNLNKEISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324
           +G+S NLNKE  +E++  P S L LEVVAGV EVFSRMD LL
Sbjct: 303 SGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  486 bits (1251), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 232/328 (70%), Positives = 275/328 (83%), Gaps = 5/328 (1%)

Query: 2   SLQRRRVNKGDTTESIPQIDNEHDH-----KIVYDEQEAKLRDNTSVPKLTLMEEVLLMG 56
           +LQRRRVN+ D+ +      +E +      ++ YD +EAK+ +N   PKLTLMEEVLL+G
Sbjct: 3   NLQRRRVNRVDSGDESSLQASEFNETTTSKRVAYDPEEAKITENVKNPKLTLMEEVLLLG 62

Query: 57  LKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTG 116
           L+DK+GYLSFWNDNISYALRGCI+IELALRGKIR +DD ARKR+DVSERLIEV+D SKTG
Sbjct: 63  LRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDASKTG 122

Query: 117 EVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTE 176
           EVLLDE+L LMK D P +I  WIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTE
Sbjct: 123 EVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTE 182

Query: 177 MKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLIC 236
           MKNFFLFDMATHP+TDT+CKE++KRR+LS+LVSRN EL+YN YFP   SFK IRT++LIC
Sbjct: 183 MKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIALIC 242

Query: 237 GAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQE 296
           G+Y ANVLENVL +LDYE RD   +RADEIL Q++++PF LDK T +G+S+NLNKE+ +E
Sbjct: 243 GSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVKEE 302

Query: 297 LNNHPGSDLQLEVVAGVFEVFSRMDTLL 324
           L+ +    LQLEVVAGVFEVFSRMD LL
Sbjct: 303 LSQNKDCPLQLEVVAGVFEVFSRMDMLL 330

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  476 bits (1226), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 231/331 (69%), Positives = 272/331 (82%), Gaps = 7/331 (2%)

Query: 1   MSLQRRRVNKGDTTE-----SIPQIDNEHD--HKIVYDEQEAKLRDNTSVPKLTLMEEVL 53
           MSLQRRRVNK    E     S+ + D E    HK+ YD +E KLR+NT  P LTLMEEVL
Sbjct: 1   MSLQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVL 60

Query: 54  LMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGS 113
           LMGLKDK+GYLSF N+NISYALRGCILIELALRG+I+ VDD  R+R+D SERLIEV+DGS
Sbjct: 61  LMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGS 120

Query: 114 KTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVL 173
           KTGE LLDE+L+LMK   P +IV W+DLLSGETWN LKINYQL+QVRERLAKGLVDKGVL
Sbjct: 121 KTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVL 180

Query: 174 RTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLS 233
           RTEMKNFFLFDM THP+ DT+CKESIKRRILS+LV RN EL Y   FP+ V+FKY+RT++
Sbjct: 181 RTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIA 240

Query: 234 LICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEI 293
           LIC A+GANVLE VL+TLDYE RD GF+RA+E+L QFS++PF LDK   TG+SVNLN+ +
Sbjct: 241 LICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLV 300

Query: 294 SQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324
            +EL+ +PG+ L LEVVAGV +V+SRMD LL
Sbjct: 301 QEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  475 bits (1222), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 231/315 (73%), Positives = 263/315 (83%), Gaps = 17/315 (5%)

Query: 27  KIVYDEQEAKL-----------------RDNTSVPKLTLMEEVLLMGLKDKQGYLSFWND 69
           KI YD +EAKL                  +N   P LTLMEEVLLMGL+DK+GYLSFWND
Sbjct: 51  KIAYDPEEAKLLNNNNINNNNSGSNSRGGNNAVTPTLTLMEEVLLMGLRDKEGYLSFWND 110

Query: 70  NISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTGEVLLDESLSLMKN 129
           NISYALRGCILIELALRGKIR +DD ARKR+D+SERLIEV DGSKTGEVLLDE+L LMKN
Sbjct: 111 NISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKN 170

Query: 130 DPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 189
           D P +I  WIDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP
Sbjct: 171 DEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP 230

Query: 190 ITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGAYGANVLENVLA 249
           +TD++CKE+IKRR+LS+LVSRN E  YN YFPQ+  FK IRT++LICGAYGANVLENVL+
Sbjct: 231 VTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLS 290

Query: 250 TLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQELNNHPGSDLQLEV 309
           +LDYE  D   ARADE++AQFS+FPF L+K T+T VSVNLN+ + QEL+ +PG DLQLEV
Sbjct: 291 SLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEV 350

Query: 310 VAGVFEVFSRMDTLL 324
           +AGV EVFSRMDTLL
Sbjct: 351 IAGVIEVFSRMDTLL 365

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  470 bits (1209), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 221/332 (66%), Positives = 272/332 (81%), Gaps = 9/332 (2%)

Query: 2   SLQRRR---------VNKGDTTESIPQIDNEHDHKIVYDEQEAKLRDNTSVPKLTLMEEV 52
           +LQRRR          +  D+ ++ P        ++ YD +E K+R+N SVP+LTLMEEV
Sbjct: 3   TLQRRRKQARSDSVGSSGTDSNDNEPTNRQAESRRVAYDPEEDKIRNNMSVPQLTLMEEV 62

Query: 53  LLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDG 112
           +L+GL+DK+GYLSFWNDNISYALRGCI+IELALRGKIR +DDPARKR+++SERL+EV+D 
Sbjct: 63  VLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRILDDPARKRFELSERLVEVVDS 122

Query: 113 SKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 172
           SKTGEVLLDE+L +M+ND P +I  W+DLLSGETWN+ KINYQLKQVRER++KGLVDKGV
Sbjct: 123 SKTGEVLLDEALQIMRNDEPLAISNWVDLLSGETWNVFKINYQLKQVRERISKGLVDKGV 182

Query: 173 LRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTL 232
           LRTEMKNFFLFDMATHP+TD++CKE+IKRRILSILV+R AE TYN YFP+  SFKYIRT+
Sbjct: 183 LRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTAEFTYNDYFPETTSFKYIRTI 242

Query: 233 SLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKE 292
           SLIC AYGANVLENVL +L+Y+ RD G  RA+E+L QFS++PF L+KQT  G S+NLN  
Sbjct: 243 SLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQYPFDLEKQTEFGTSINLNAL 302

Query: 293 ISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324
           + +E+   P + L LEVVAGVFEVFS+MD LL
Sbjct: 303 VKEEIEADPKNALFLEVVAGVFEVFSKMDLLL 334

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  469 bits (1208), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 224/327 (68%), Positives = 268/327 (81%), Gaps = 5/327 (1%)

Query: 2   SLQRRRVNK--GDTTESIPQIDNEHDH--KIVYDEQEAKLRDNTSVPKLTLMEEVLLMGL 57
           SLQRRR+N+   DT ES    D E     KI YD +EAKL+D+ +VP LTLMEEV+L+GL
Sbjct: 3   SLQRRRLNRINSDTAES-SNDDEERSKSTKIAYDPEEAKLKDDVTVPTLTLMEEVVLLGL 61

Query: 58  KDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTGE 117
            DK GYLSFWNDNISY LRGCI+IELALR KIR +DDPARKR+D+SERL+EV+DGSKTGE
Sbjct: 62  GDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARKRFDLSERLVEVVDGSKTGE 121

Query: 118 VLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEM 177
           VLLDE+L LMKND P SI  WIDLLSGETWN  KINYQLKQVRER++KGLVDKGVLRTEM
Sbjct: 122 VLLDEALQLMKNDEPLSIANWIDLLSGETWNFFKINYQLKQVRERISKGLVDKGVLRTEM 181

Query: 178 KNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICG 237
           KNFFLFDMATHP+TDT+CKE+IKRRILS LVSR  EL YN YFP+   +K IRT++LIC 
Sbjct: 182 KNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNEYFPETTQYKVIRTIALICS 241

Query: 238 AYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQEL 297
           +Y ANVLENVL++L+YE RD   AR++ IL++F+++PF LDK +   VS+NL+K +  E+
Sbjct: 242 SYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLDKASDIKVSINLSKLVEDEI 301

Query: 298 NNHPGSDLQLEVVAGVFEVFSRMDTLL 324
             +PGS LQLE VAGVF+VFS+MD +L
Sbjct: 302 AQNPGSALQLEAVAGVFDVFSKMDMIL 328

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  441 bits (1133), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 208/326 (63%), Positives = 255/326 (78%), Gaps = 4/326 (1%)

Query: 3   LQRRRVNKGDTTESIPQIDNEHDH----KIVYDEQEAKLRDNTSVPKLTLMEEVLLMGLK 58
           +QRRR+N+    +     DN+       K+ +D +EAK++D+ SVPKLTLMEEV+L+GL 
Sbjct: 4   VQRRRINRISNEDESDHSDNDQSRSNVSKVAFDPEEAKIKDDVSVPKLTLMEEVVLLGLG 63

Query: 59  DKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTGEV 118
           D +GYLSFWNDNISY LRGCILIELALRGKIR +DD ARK +D+SERLIEVID SKTGEV
Sbjct: 64  DSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSARKSFDLSERLIEVIDASKTGEV 123

Query: 119 LLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMK 178
           LLDE+L LMKND P SIV WIDLLSGETWN  K+NYQLKQVRERL+KGLVDKGVLRTEMK
Sbjct: 124 LLDETLQLMKNDEPQSIVSWIDLLSGETWNFFKVNYQLKQVRERLSKGLVDKGVLRTEMK 183

Query: 179 NFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGA 238
           NFFLFDMATHP+ D++CKES+KRRI+S LV R   L YN YFP+  +FK IRT+SLI  A
Sbjct: 184 NFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYNEYFPESTTFKVIRTVSLIITA 243

Query: 239 YGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQELN 298
           Y ANVLENVL TL+YE RD   +RA+ +L  F  +PF L  +    +S+NLN+ +  E+ 
Sbjct: 244 YSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKLVNEPDNRISINLNQLVEDEIK 303

Query: 299 NHPGSDLQLEVVAGVFEVFSRMDTLL 324
            +P + LQLEV+AGVF+VF++MD ++
Sbjct: 304 ANPKTALQLEVLAGVFDVFAKMDVII 329

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  355 bits (911), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 162/276 (58%), Positives = 217/276 (78%)

Query: 49  MEEVLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIE 108
           MEEV+L+G++DK+GYLSFWN+N+S+ LRGCILIELA RG I+ +DDP+RKR+D+S+RLIE
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60

Query: 109 VIDGSKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLV 168
           V++  KTGE LLDE+L +MK++   SI  WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120

Query: 169 DKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKY 228
           DKG+LRTEMKNFFLFDMATHP+ D  CKE IK+RILS+L+ + A +  + YFP+ V  + 
Sbjct: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180

Query: 229 IRTLSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVN 288
           +RT++LI  AY  +VLENV + LDY+ +D  F R  EIL Q S +PF  D ++ST ++ N
Sbjct: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240

Query: 289 LNKEISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324
           LN+ +  EL+     +L+LE +AGVFEVF +MD+++
Sbjct: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  350 bits (899), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 222/304 (73%), Gaps = 1/304 (0%)

Query: 22  NEHDHKIVYDEQEAKLRDNTSVPKLTLMEEVLLMGLKDKQGYLSFWNDNISYALRGCILI 81
           N   H   +D +E+   +   +P L LMEE++L+GLKDKQGYLSFWNDNISY LRGCILI
Sbjct: 84  NGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILI 143

Query: 82  ELALRGKIRCVDDPARKRYDVSERLIEVI-DGSKTGEVLLDESLSLMKNDPPTSIVGWID 140
           ELALR KI+ +DDP R  YDVS R+IEV+   +KTG  LLDE+L++M  + P SI+ WID
Sbjct: 144 ELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWID 203

Query: 141 LLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIK 200
           LLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KES+K
Sbjct: 204 LLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVK 263

Query: 201 RRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGAYGANVLENVLATLDYEVRDTGF 260
           +RI SILV +++ L YN YFP++V+FK IR+L LIC AYGA+VL++ L T++Y+  D  F
Sbjct: 264 QRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAF 323

Query: 261 ARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQELNNHPGSDLQLEVVAGVFEVFSRM 320
            +A+++    S+FP  LD++  +GV V++ K++  EL  H G  L LEVVAGV +V  RM
Sbjct: 324 KKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRM 383

Query: 321 DTLL 324
           D+LL
Sbjct: 384 DSLL 387

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  237 bits (604), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 127/284 (44%), Positives = 185/284 (65%), Gaps = 9/284 (3%)

Query: 44  PKLTLMEEVLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVS 103
           P+LTLM+E+ L+ LKDK+GY+S W+  +SY LR C++IELALRGKI+ V +  +K+ D++
Sbjct: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAE-GKKKKDLA 121

Query: 104 --ERLIEVIDGSKTGEVLLDESLSLMKNDPPT-SIVGWIDLLSGETWNLLKINYQLKQVR 160
             E  IEVIDGS TG+ LLD++L LMK +    S+  WI LLSGE+ N LK +YQL  VR
Sbjct: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181

Query: 161 ERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYF 220
           +R+ + LV+ G+L  + K      + THPI D  CK +I+ R+  IL +   +L    YF
Sbjct: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241

Query: 221 PQDVSFKYIRTLSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQ 280
           P  VS++ +RT+ L C AYGA++L+      + E    G  RA  +L+ FS+FPF L++ 
Sbjct: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTENETV-IGKGRARVLLSLFSKFPFELNQ- 299

Query: 281 TSTGVSVNLNKEISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324
               V  +LN+++S+EL+ HP    QLEVVAG  +V + +DT+L
Sbjct: 300 ---AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>TDEL0G01770 Chr7 (349483..358797) [9315 bp, 3104 aa] {ON} Anc_4.14
            YLL040C
          Length = 3104

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%)

Query: 187  THPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGAYGANVLEN 246
            T   +DT  ++S+ RRI+++     AELTY T+ P +    Y   L    G+   + +E 
Sbjct: 1084 TDETSDTLPRDSVFRRIITMSDKELAELTYETFDPANNPHDYDSALKYTTGSMHVSFVEQ 1143

Query: 247  VLATL 251
             +  L
Sbjct: 1144 SINKL 1148

>AFR281C Chr6 complement(941608..943590) [1983 bp, 660 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL144W
           (TID3)
          Length = 660

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 131 PPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATH 188
           P T + G  D+LS    NLLK+N   K++ ER++    +   L  E++ + + ++  H
Sbjct: 490 PSTILEGCTDILSSIKPNLLKVN---KEIDERISALQTENNQLEKELRGYEILELVRH 544

>Suva_7.254 Chr7 complement(437133..439253) [2121 bp, 706 aa] {ON}
           YGL026C (REAL)
          Length = 706

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 91  CVDDPARKRYDVSERLIE-VIDGSKTGEVLLDESLSLMKN 129
           C D P  KRYDV++  +E ++DG+K   +  DE  +  K+
Sbjct: 242 CGDAPEGKRYDVAKEYVEGILDGAKHKVLSKDEFFAFQKD 281

>Ecym_8410 Chr8 (851627..860998) [9372 bp, 3123 aa] {ON} similar to
            Ashbya gossypii ACL064C
          Length = 3123

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%)

Query: 187  THPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICGAYGANVLEN 246
            T  I++    +SI R+++S+      EL Y T+ P +   +Y   L    G+   NV+E+
Sbjct: 1090 TEKISEDLPPDSIFRQLISMHGDELVELVYETFDPTNNPHEYTSKLDYKTGSMTVNVVEH 1149

Query: 247  VL 248
             L
Sbjct: 1150 SL 1151

>Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON}
           (79675..81237) [1563 nt, 521 aa]
          Length = 520

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 50/115 (43%), Gaps = 12/115 (10%)

Query: 172 VLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRT 231
           V R  M+N F+ +M    I D     SIK  + SI  ++  + + +TY   D ++++   
Sbjct: 312 VRRANMQNVFINEMDRLMINDPLDMSSIKHSLYSIPYTKRQKTSQSTYTFNDQNYRFTER 371

Query: 232 LSLICGAYG-----ANVLENVLATL-----DYEVRDTGFARADE--ILAQFSEFP 274
           L     + G      +V E+   T+     D+ +R     R ++  I+ +   FP
Sbjct: 372 LPRQENSEGPFGEIPSVFESSTGTMENHRSDFNLRGRPETRENDNIIIPEMMHFP 426

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,477,004
Number of extensions: 1495334
Number of successful extensions: 4504
Number of sequences better than 10.0: 35
Number of HSP's gapped: 4609
Number of HSP's successfully gapped: 35
Length of query: 324
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 214
Effective length of database: 40,868,139
Effective search space: 8745781746
Effective search space used: 8745781746
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)