Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E02333g5.441ON48048023030.0
Ecym_45125.441ON52749110621e-140
TBLA0A027905.441ON54754310031e-130
SAKL0G02684g5.441ON5394509961e-129
ACL166W5.441ON4904819841e-128
ZYRO0F10186g5.441ON5195049841e-128
Kpol_1062.255.441ON5335279711e-126
NDAI0B057105.441ON5635199621e-124
TDEL0D026005.441ON5235029541e-123
KNAG0C048705.441ON4584729401e-122
TPHA0E017205.441ON5374579331e-120
KAFR0E038105.441ON4904499041e-116
NCAS0F034205.441ON5255128841e-113
KLTH0F15906g5.441ON5155158641e-110
CAGL0A02904g5.441ON5014908551e-109
Kwal_55.214025.441ON5165228431e-107
Smik_4.6375.441ON5114858321e-105
YDR371W (CTS2)5.441ON5114858311e-105
Suva_2.5435.441ON5114848281e-105
Skud_4.6405.441ON5114878151e-103
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E02333g
         (480 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   891   0.0  
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   413   e-140
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   390   e-130
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   388   e-129
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   383   e-128
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   383   e-128
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   378   e-126
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   375   e-124
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   372   e-123
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   366   e-122
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   363   e-120
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   352   e-116
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   345   e-113
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   337   e-110
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   333   e-109
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   329   e-107
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   325   e-105
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   324   e-105
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   323   e-105
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   318   e-103

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/480 (90%), Positives = 434/480 (90%)

Query: 1   MFEGFKITKLHLKFWIIIIVLAFIVEMCIVPWLFLDKIKKGGSAGRRPPTEIDPDTRVPS 60
           MFEGFKITKLHLKFWIIIIVLAFIVEMCIVPWLFLDKIKKGGSAGRRPPTEIDPDTRVPS
Sbjct: 1   MFEGFKITKLHLKFWIIIIVLAFIVEMCIVPWLFLDKIKKGGSAGRRPPTEIDPDTRVPS 60

Query: 61  EGPDGFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFE 120
           EGPDGFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFE
Sbjct: 61  EGPDGFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFE 120

Query: 121 LPLSVGVKGCIKELQKIKLESKHEFKTILCLGGWSNREAYXXXXXXXXXXXXFIETAVDC 180
           LPLSVGVKGCIKELQKIKLESKHEFKTILCLGGWSNREAY            FIETAVDC
Sbjct: 121 LPLSVGVKGCIKELQKIKLESKHEFKTILCLGGWSNREAYKKIAKSEKKVKKFIETAVDC 180

Query: 181 MFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQLS 240
           MFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQLS
Sbjct: 181 MFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQLS 240

Query: 241 VATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGXXXXXXXXXX 300
           VATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQG          
Sbjct: 241 VATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGHSHRRSLSNR 300

Query: 301 XXXXXXXXDTAVKLMTDRHNISSRRIALGMAAYGRGFTNVETNDDNYLXXXXXXXXXXXX 360
                   DTAVKLMTDRHNISSRRIALGMAAYGRGFTNVETNDDNYL            
Sbjct: 301 ISNSSLSSDTAVKLMTDRHNISSRRIALGMAAYGRGFTNVETNDDNYLGKKYHGVGGGSE 360

Query: 361 XXXXIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSMDIKGKYIKKKNLNG 420
               IWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSMDIKGKYIKKKNLNG
Sbjct: 361 GEPGIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSMDIKGKYIKKKNLNG 420

Query: 421 GFWWESCGDSKDPRKSLVNAFSKEIGLSEGFVSLFKSDKVKQFHLQKYPKDYISSLFQKL 480
           GFWWESCGDSKDPRKSLVNAFSKEIGLSEGFVSLFKSDKVKQFHLQKYPKDYISSLFQKL
Sbjct: 421 GFWWESCGDSKDPRKSLVNAFSKEIGLSEGFVSLFKSDKVKQFHLQKYPKDYISSLFQKL 480

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  413 bits (1062), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 220/491 (44%), Positives = 302/491 (61%), Gaps = 24/491 (4%)

Query: 5   FKITKLHLKFWIIIIVLAFIVEMCIVPWLFLDKIKKGGSAGRRPP--TEIDPDTRVPSEG 62
           F IT   +  WI+++++A I+EM  +P L ++K KK  S   R    T   P  R    G
Sbjct: 4   FSITSYSI--WILVLLVAIILEMTFIPKLMIEKFKKPRSDIERTALSTITRPVDRNLQHG 61

Query: 63  PDGFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELP 122
              ++V  YY++WSPY  R H P DI   ++T+V YAFFVVD K+G V+ +DSWSD E+P
Sbjct: 62  --KYAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMP 119

Query: 123 -----LSVGVKGCIKELQKIKLESKHEFKTILCLGGWSNREAYXXXXXXXXXXXXFIETA 177
                +  GV G I EL  +KL+    F+  + +GGWSNREA+            F+ + 
Sbjct: 120 SHAPGIPQGVTGMIGELNYLKLQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNST 179

Query: 178 VDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHF 237
           +D MF YGFDGIDLDWEFP++D  EP +YLEM   +R  MD+LE +I+G  A   D+P F
Sbjct: 180 IDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWG--ANNTDYPKF 237

Query: 238 QLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGXXXXXXX 297
           +LSVATPAF++ L ILPI EM+K+V IWNMM YDFHG WS  TGYHSNLY          
Sbjct: 238 ELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELK 297

Query: 298 XXXXXXXX------XXXDTAVKLMTDRHNISSRRIALGMAAYGRGFTNVET-NDDNYLXX 350
                            D A+K+M +   + ++++ LGM AYGRGFTNV+T +DD+ L  
Sbjct: 298 KRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTKDDDDLLNK 357

Query: 351 XXXXXXXXXXXXXXIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSMDIKG 410
                         IWLYNQLP+  + E+FD   VSAYCFD   +TFVGYDN+QSM++K 
Sbjct: 358 KYSGVGGGSEGEPGIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKS 417

Query: 411 KYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEIGLSEGFV-SLFKSDKVKQFHLQKY 468
            Y+K+K+L+GGF+WESCGD+  DP+++LV AFS+E  LSE  + ++FK  +   ++L+  
Sbjct: 418 DYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQE--LSEMRIPTIFKDPRAIAYYLKHR 475

Query: 469 PKDYISSLFQK 479
            K ++ SLF +
Sbjct: 476 QKGFLYSLFSQ 486

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  390 bits (1003), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 214/543 (39%), Positives = 305/543 (56%), Gaps = 85/543 (15%)

Query: 14  FWIIIIVLAFI-----VEMCIVPWLFLDKIKKGGSAGRRPPTEIDPDTRVPSE------- 61
           +W   I+L FI      EMC    LF  K ++      +PPT+I+P   V +E       
Sbjct: 8   YWRATIILTFIAITLITEMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNT 67

Query: 62  -----GPDGFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSW 116
                 P G++   YYSNWSPY+ R H P DI  S+++HVYY+FF+V+  +G V+  D W
Sbjct: 68  NLTVANPQGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKW 127

Query: 117 SDFEL----PLSVGV------------------------KGCIKE---------LQKIKL 139
           SD E+    PLS+ +                        KGCI E         L  I  
Sbjct: 128 SDIEMDLYKPLSIKLGKLKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINT 187

Query: 140 ESKHEFKTILCLGGWSNREAYXXXXXXXXXXXXFIETAVDCMFRYGFDGIDLDWEFPEED 199
           E+   FK I+ +GGWSNR+++            F+ +A++ MF YGFDGIDLDWEFP+ +
Sbjct: 188 ENSKNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNN 247

Query: 200 SNEPIVYLEMMRGIREGMDQLERQIFGS---PAEEKDHPHFQLSVATPAFAEKLNILPIS 256
           + EP VYL++M+ +R+GM++LE +I+ +   P EE+ H  FQLSVA+PAF EKL++LPI 
Sbjct: 248 TQEPAVYLKIMQQLRQGMNELEEEIYKNSAVPVEERKH--FQLSVASPAFEEKLSVLPIK 305

Query: 257 EMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGXXXXXXXXXXXXXXXXXXDTAVKLMT 316
           EM+K +D WNMM YD++GEWS+ TGYHSNLY                     D+A+K M 
Sbjct: 306 EMNKVLDYWNMMTYDYNGEWSEKTGYHSNLY-------DGSKVKHDEEVLNADSAIKYMI 358

Query: 317 DRHNISSRRIALGMAAYGRGFTNVETN----------------DDNYLXXXXXXXXXXXX 360
           +   +   ++ LG+A YGRG+TNV  N                D+ ++            
Sbjct: 359 ETQGVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESE 418

Query: 361 XXXXIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSMDIKGKYIKKKNLNG 420
               +W+YNQLPI GS EQFD   VSAYC+D K+ T V YDNV+SM++KG+Y+K K L G
Sbjct: 419 GEPGMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAG 478

Query: 421 GFWWESCGDSKD-PRKSLVNAFSKEIG-LSEGFVSLFKSDKVKQFHLQKYPKD-YISSLF 477
           GF WESCGD  D P++SL+ AF+ E+G + +   S+F+ +K  +F+L+++  + Y+S   
Sbjct: 479 GFMWESCGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAI 538

Query: 478 QKL 480
            KL
Sbjct: 539 AKL 541

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  388 bits (996), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 202/450 (44%), Positives = 270/450 (60%), Gaps = 43/450 (9%)

Query: 69  ATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELPL----- 123
             YY+NWSPY  RNH P D+   ++T+V+Y+FFVVD KSG VKSSD WSDF++ L     
Sbjct: 92  GVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYKKFY 151

Query: 124 ---------------------SVGVKGCIKELQKIKLES----------KHEFKTILCLG 152
                                 +   GCI EL  +K  S             FK  + +G
Sbjct: 152 PQFKAALLSSSSSSTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKVSMSVG 211

Query: 153 GWSNREAYXXXXXXXXXXXXFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRG 212
           GWSNR+A+            FI T V+ MF+YGFDG+D+DWEFP+ D  EP +YL M+R 
Sbjct: 212 GWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYLTMIRR 271

Query: 213 IREGMDQLERQIFGSPAEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDF 272
           +RE +D LER IF    +E    HF L+VA PAF EKL +LP+ +M  YVD WN+M YD+
Sbjct: 272 LREALDDLERDIF---QDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAYDY 328

Query: 273 HGEWSDVTGYHSNLYLQGXXXXXXXXXXXXXXXXXXDTAVKLMTDRHNISSRRIALGMAA 332
           HGEWS++TGYHSNLY +                   D+AVK +     I+SR++ LGMAA
Sbjct: 329 HGEWSELTGYHSNLYSEDSNHVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVVLGMAA 388

Query: 333 YGRGFTNVET--NDDNYLXXXXXXXXXXXXXXXXIWLYNQLPIDGSKEQFDSNAVSAYCF 390
           YGRGFT V+T  N  +Y+                +WLYNQLP+ G+ E FD  +VSAY F
Sbjct: 389 YGRGFTRVKTTANSGSYIGKPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPRSVSAYSF 448

Query: 391 DPKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEIG-LS 448
           DPKS+TFVGYDNV SM  K +Y+K  NL GGFWWESCGD+ KD +KSL+NAF+ ++G L+
Sbjct: 449 DPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGSLA 508

Query: 449 EGFVSLFKSDKVKQFHLQKYPKDYISSLFQ 478
           +   S++ S  V +++L+ YP+ ++S +F+
Sbjct: 509 KQQPSIYTSAHVIRYYLKNYPQGFLSRVFK 538

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  383 bits (984), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 202/481 (41%), Positives = 288/481 (59%), Gaps = 23/481 (4%)

Query: 15  WIIIIVLAFIVEMCIVPWLFLDKIKKGGSAGRRPPTEIDPDTR-VP-SEGPDG-FSVATY 71
           WI+I+V A ++EM  +P L  +K+ +     R  P E+  +TR VP +  PDG ++V  Y
Sbjct: 12  WILILVAAIVLEMTFLPKLIKEKLSR---RIRPKPLEVHEETRPVPDAPYPDGEYTVGVY 68

Query: 72  YSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELPLSV-----G 126
           YS+WSPY  R H P +I   ++THVYYAFFVVD K+G + S D WSD ++P+++     G
Sbjct: 69  YSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPMNLTGMPRG 128

Query: 127 VKGCIKELQKIKLESKHEFKTILCLGGWSNREAYXXXXXXXXXXXXFIETAVDCMFRYGF 186
           + G I EL  +K     +FK ++ +GGWSNRE +            FI++A+D MF YGF
Sbjct: 129 LNGAIGELNYLKTRPGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGF 188

Query: 187 DGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQLSVATPAF 246
           DGIDLDWEFP++D  EP +YLEM   +R  MD+LE  I+G     +  P F LS+A PAF
Sbjct: 189 DGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTE--PRFHLSMAAPAF 246

Query: 247 AEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGXXXXXXXXXXXXXXXX 306
            + L I P+ EM+KY+ +WNMM YD+HG WS+ TGYHSNLY                   
Sbjct: 247 PQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDKRRYEDM 306

Query: 307 XXDT--------AVKLMTDRHNISSRRIALGMAAYGRGFTNVETNDDNYLXXXXXXXXXX 358
             D         A+ +MT++  +S R+IALGMAAYGRGFTNV  + +  +          
Sbjct: 307 GIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRGDGEQLIGQKYSGVGGG 366

Query: 359 XXXXXXIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSMDIKGKYIKKKNL 418
                 +WLYNQLP+    E+FD+  VSAY +DP ++T V YDNV SM IK +Y+K K L
Sbjct: 367 SEGEPGMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKL 426

Query: 419 NGGFWWESCGDS-KDPRKSLVNAFSKEIGLSEGFVSLFKSDKVKQFHLQKYPKDYISSLF 477
            G F WESCGD+ KD  ++LV AF++ +  +    + +K  K+ Q++L+  P+ ++  ++
Sbjct: 427 AGAFLWESCGDNFKDKDRNLVEAFTENMKGARK-ATAYKDSKLIQYYLRTRPEGFLVPMY 485

Query: 478 Q 478
           +
Sbjct: 486 R 486

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  383 bits (984), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 207/504 (41%), Positives = 296/504 (58%), Gaps = 50/504 (9%)

Query: 16  IIIIVLAFIVEMCIVPWLF--------LDKIKKGGSAGRRPPTEIDPDTRVPSEGPDGFS 67
           +  I+ + ++EMC    +F        LD + + G    +     D  T +   G +G++
Sbjct: 15  LAFIIASIVIEMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFK--DHHTVI---GDEGYT 69

Query: 68  VATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELPL---- 123
              YYS+WSPY  R H P DI  S+++H+YYAFF++D  +G +KSSD WSDF++ L    
Sbjct: 70  SGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPL 129

Query: 124 ----------------SVGV--KGCIKELQKIK------LESKHEFKTILCLGGWSNREA 159
                           S+GV  KGC+ EL  ++       +    FK ++ +GGWSNR+ 
Sbjct: 130 AVKLNQLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQ 189

Query: 160 YXXXXXXXXXXXXFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQ 219
           +            FI + V+ MF+YGFDGIDLDWEFP+ D  EP +YLE+ R +R   D+
Sbjct: 190 WPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDE 249

Query: 220 LERQIFGSPAEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDV 279
           LE  IF   A E +HP FQLS+ATPAF +KLN+LPI E+ +Y+D+WNMM YD+HGEWS V
Sbjct: 250 LEEVIF---AGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPV 306

Query: 280 TGYHSNLYLQGXXXXXXXXXXXXXXXXXXD--TAVKLMTDRHNISSRRIALGMAAYGRGF 337
           TGYH NLY                     D  +A+  M +R  + SR+I LGMAAYGRGF
Sbjct: 307 TGYHCNLYDGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGF 366

Query: 338 TNVE--TNDDNYLXXXXXXXXXXXXXXXXIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSR 395
           T+V+  +ND  ++                +WLYNQLPI GSKE++D   VS +CFD K++
Sbjct: 367 THVKASSNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTK 426

Query: 396 TFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDSK-DPRKSLVNAFSKEI-GLSEGFVS 453
           TFVGYDNV+S+ +K  Y+K+  L GGFWWESCGD+  DP++SL+NAF+  I  +++   S
Sbjct: 427 TFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENS 486

Query: 454 LFKSDKVKQFHLQKYPKDYISSLF 477
           ++   +  +++L+K+ +D   S F
Sbjct: 487 VYHKPEALRYYLEKFGQDEFLSPF 510

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  378 bits (971), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 210/527 (39%), Positives = 304/527 (57%), Gaps = 54/527 (10%)

Query: 7   ITKLHLKFWIIIIVLAFIVEMCIVPWLFLDKIKKGGSAGRRPPTEIDPDTRV-----PSE 61
           + +++ K+W+ + +L  I+ + +  +L+  K  K GS        I+    V     P+ 
Sbjct: 1   MIRVNQKWWVALALLFVIISIMVESFLY-QKFLKHGSKEESIEDSINESQIVYGKSFPNN 59

Query: 62  GPDGFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFEL 121
              G+ V  YYSNWSPY  R H P D+  S+LTHVYYAFFVVD+K+GA+ +SD+WSDFE+
Sbjct: 60  PDSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEM 119

Query: 122 ----PLSVGVK------------------GCIKEL------QKIKLESKHEFKTILCLGG 153
               PL++ +K                  GCI EL      Q     +  +FK I+ +GG
Sbjct: 120 DCYKPLAMKLKKLQLDHFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGG 179

Query: 154 WSNREAYXXXXXXXXXXXXFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGI 213
           WSNREA+            F+ + ++ MF YGFDGI+LDWEFP++D  EP +YLE+++ +
Sbjct: 180 WSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKL 239

Query: 214 REGMDQLERQIFGSP--AEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYD 271
           +   ++LE++IF +         P F LS+A PAF EKL+IL + EM  YVD+WNMM YD
Sbjct: 240 KWKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYD 299

Query: 272 FHGEWSDVTGYHSNLY-------------LQGXXXXXXXXXXXXXXXXXXDTAVKLMTDR 318
           +HGEWS+ TGYHSNLY              +                   D A+  +  +
Sbjct: 300 YHGEWSEKTGYHSNLYSPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNGDYAINYVIKK 359

Query: 319 HNISSRRIALGMAAYGRGFT--NVETNDDNYLXXXXXXXXXXXXXXXXIWLYNQLPIDGS 376
           ++I+ ++I LGMAAYGRGFT  N  + D  ++                +WLYNQLPI  S
Sbjct: 360 YHINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNS 419

Query: 377 KEQFDSNAVSAYCFDPKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDS-KDPRK 435
            E+FD + VSA+C+D KS+TFVGYDN  SM +K +Y+K+ NL GGFWWESCGD  K+P K
Sbjct: 420 LEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEK 479

Query: 436 SLVNAFSKEIG-LSEGFVSLFKSDKVKQFHLQ-KYPKDYISSLFQKL 480
           SL+NAF+ EIG ++E   ++F + +V +++L+ K    ++S+   KL
Sbjct: 480 SLLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFIMKL 526

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  375 bits (962), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 210/519 (40%), Positives = 286/519 (55%), Gaps = 81/519 (15%)

Query: 5   FKITKLHLKFWIIIIVLAFIVEMCIVPWLFL----------------------------D 36
           ++ T L ++F I++ ++ FI++MC+    F                             D
Sbjct: 3   YRRTILRIRFLILLAIICFILQMCLTKLFFNSNKEKIVTDHYKNNNNNNNNNNNNNNNDD 62

Query: 37  KIKKGGSAGRRPPTEIDPDTRVPSEGP--DGFSVATYYSNWSPYNARNHKPADIPTSQLT 94
             KKG       P E D     P  G   + F    YYS+WSPY  R H P DI  +++T
Sbjct: 63  GNKKGQHHSHLFPQENDI-VNYPKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKIT 121

Query: 95  HVYYAFFVVDAKSGAVKSSDSWSDFEL----PLSVGVK---------------------- 128
           HVYY+FF+V+  +G V  SD WSD ++    PLS+ +                       
Sbjct: 122 HVYYSFFLVNGATGDVTCSDEWSDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIE 181

Query: 129 --------GCIKELQKIKLESKHEFKTILCLGGWSNREAYXXXXXXXXXXXXFIETAVDC 180
                   GC+ EL    L+    FK I+ +GGWSNRE +            FIE++V+ 
Sbjct: 182 KMKKQLPLGCVGEL--FYLKKFQNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQ 239

Query: 181 MFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFG----SPAE---EKD 233
           MF+YGFDGIDLDWEFPE+D  EP  YLE+++ +R+ MD+LE  IF     SP +   +  
Sbjct: 240 MFKYGFDGIDLDWEFPEDDGFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPHDYDHDYH 299

Query: 234 HPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGXXX 293
           HP F+LSVATPAF EKLNILPI EM+KY+D WNMM YD++G+WS+ TGYH NLY  G   
Sbjct: 300 HPKFELSVATPAFIEKLNILPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNG 359

Query: 294 XXXXXXXXXXXXXX----XDTAVKLMTDRHNISSRRIALGMAAYGRGFTNVETN--DDNY 347
                              + A+  M   +N+SSR++ LG+AAYGRGFT V+ N  D+ +
Sbjct: 360 TINAQYKHEHTSSNKGLNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELF 419

Query: 348 LXXXXXXXXXXXXXXXXIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSMD 407
           +                +WLYNQLPI  SKE FD N VSA+C+DPK++TFVGYDNV +M 
Sbjct: 420 INKKFDGVGGASAGEPGMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMK 479

Query: 408 IKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEI 445
           +K KY++ ++L GGFWWESCGD  K P +SL+NAF+ ++
Sbjct: 480 VKAKYVQDRHLAGGFWWESCGDDHKHPERSLLNAFTNQL 518

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 203/502 (40%), Positives = 290/502 (57%), Gaps = 43/502 (8%)

Query: 16  IIIIVLAFI-VEMCIVPWLFLDKI-KKGGSAGRRPPTEIDPDTRVPSEGPDGFSVATYYS 73
           III++LA I VEMC    +F     +K     +  P +    T   +  P  +    YYS
Sbjct: 12  IIIVILASIAVEMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNPGTVEPGQYLSGLYYS 71

Query: 74  NWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFEL----PLSVGVK- 128
           NWSPY+ R H P DI  S+++H+YYAFF+VD  +GA+K  D WSD  +    P+++ +  
Sbjct: 72  NWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKLNK 131

Query: 129 ------------------GCIKELQKIKL------ESKHEFKTILCLGGWSNREAYXXXX 164
                             GC+ EL  ++        +  +FK I+C+GGWSNRE +    
Sbjct: 132 LNPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWSNREEFPKMV 191

Query: 165 XXXXXXXXFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQI 224
                   FI++ ++ MF+YGFDGIDLDWEFPE+D  EP +YL++ + ++E M++LE  I
Sbjct: 192 RNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAI 251

Query: 225 FGSPAEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHS 284
           FG      +HP FQLS+ATPAF+EKL+ILPI+EM KY+DIWNMM YD+HGEWS+ TGYH 
Sbjct: 252 FGP---NMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHC 308

Query: 285 NLYLQGXXXXXXXXXXXXXXXXXXD-----TAVKLMTDRHNISSRRIALGMAAYGRGFTN 339
           NLY                     +     +A++ M +   ++S +I LGMAAYGRGFTN
Sbjct: 309 NLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGFTN 368

Query: 340 V--ETNDDNYLXXXXXXXXXXXXXXXXIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTF 397
           V  ++ D  ++                +WLYNQLPI G+ E FD + VS +C+   S+TF
Sbjct: 369 VVAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTF 428

Query: 398 VGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDSK-DPRKSLVNAFSKEIGLSEGFVSL-F 455
           VGYD+V+S+  K +Y+++KNL GGFWWESCGD   +  +SL+NAF+ EI     F  L +
Sbjct: 429 VGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFVSKFDDLMY 488

Query: 456 KSDKVKQFHLQKYPKDYISSLF 477
           +   V ++++ K+  D   S F
Sbjct: 489 RQTPVLRYYVNKFGNDAFLSPF 510

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  366 bits (940), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 194/472 (41%), Positives = 277/472 (58%), Gaps = 29/472 (6%)

Query: 16  IIIIVLAFIVEMCIVPWLFLDKIKKGGSAGRRPPTEIDPDTRVPSEGPDGFSVATYYSNW 75
           I I  ++ +    I+   F   + K      +PP +       P      +    YYS+W
Sbjct: 7   ITIAAVSLVSVTVILTMCFTQLLHKKTEHHHQPPAQ------CPQNVNQKYVSGVYYSDW 60

Query: 76  SPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELPL--SVGVKGCIKE 133
           SPY  R H P +I TS++TH+YY+FF+VDA S A+K  DSWSD E+P+  +  +KGCI  
Sbjct: 61  SPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPMGKNTVLKGCIGA 120

Query: 134 LQKIKLESKHEFKTILCLGGWSNREAYXXXXXXXXXXXXFIETAVDCMFRYGFDGIDLDW 193
           L  ++ E K  FK I+ +GGWSN++A+              ++ V+ MF+YGFDGIDLDW
Sbjct: 121 LNSLRDE-KPGFKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDW 179

Query: 194 EFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQLSVATPAFAEKLNIL 253
           E+P++D  EP +YLE+MR IR+ M++LE  I+G          F LSVATPAF +KL   
Sbjct: 180 EYPKDDGKEPRIYLELMRKIRQHMNELEIAIWGDKKRR-----FHLSVATPAFYDKLETF 234

Query: 254 PISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGXXXXXXXXXXXXXXXXXXDTAVK 313
           PI EM +Y+D WNMM YD++GEWS  TG+HSNLY                     D A++
Sbjct: 235 PIKEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLY--------DGTNKFSEHSLCADGAIR 286

Query: 314 LMTDRHNISSRRIALGMAAYGRGFTNVETND----DNYLXXXXXXXXXXXXXXXXIWLYN 369
            MT++  I+SR++ LGMA YGRGFTNV+  D       +                +WLYN
Sbjct: 287 YMTNKIGINSRKVVLGMALYGRGFTNVKEGDPKKTSGLINRKFKGVGGESEGEPGMWLYN 346

Query: 370 QLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGD 429
           QLPI G++E FD    SAYCFDPK++T VGYDNV S   K +Y++  NL GGFWWESCG+
Sbjct: 347 QLPIRGTQEVFDEQYGSAYCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGN 406

Query: 430 SKDP-RKSLVNAFSKEI-GLSEGFVSLFKSDKVKQFHLQKYPKD-YISSLFQ 478
             D  ++SLV+ F+++I  L     +L++  K+++ +LQ + K  ++++ F+
Sbjct: 407 KWDNVQQSLVHVFNEDIERLDRNETNLYQDPKLREHYLQIFAKSGFLAATFK 458

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  363 bits (933), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 198/457 (43%), Positives = 268/457 (58%), Gaps = 42/457 (9%)

Query: 66  FSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFE----- 120
           +S+  YYSNWSPY+ R   P DI TS+++HVYY+F +VD   G +KSSD+WSDF+     
Sbjct: 78  YSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYK 137

Query: 121 -LPLSVGV------------------KGCIKE---LQKIKLE----SKHEFKTILCLGGW 154
            L LS+G                    GCI E   L+  ++        +FK  + +GGW
Sbjct: 138 PLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSVGGW 197

Query: 155 SNREAYXXXXXXXXXXXXFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIR 214
           SNREA+            FI + +D MF YGFDGIDLDWEFPE+D  EP++YL++++ ++
Sbjct: 198 SNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRLK 257

Query: 215 EGMDQLERQIFGSP-AEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFH 273
             M +LE  I+    +    +PHF+LS+A PAF EKL ILP+ +M K+VD WNMM YD+ 
Sbjct: 258 MKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDYS 317

Query: 274 GEWSDVTGYHSNLYLQGXXXXXXXXXXXXXXXXXX--DTAVKLMTDRHNISSRRIALGMA 331
           GEWSDVTGYHSNL+                       D AVK M D   ISSR+I LGMA
Sbjct: 318 GEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKIILGMA 377

Query: 332 AYGRGFTNVETNDDN--YLXXXXXXXXXXXXXXXXIWLYNQLPIDGSKEQFDSNAVSAYC 389
           AYGRGF+ V  +  N                    +WLYN+LPI GSKE+FD  +VSAYC
Sbjct: 378 AYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEFDKESVSAYC 437

Query: 390 FDPKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEIGLS 448
           +DPKS+ FV YDN QSM IK KY++  NL GGF WE+CG+   +P+ SL+N+F+ ++   
Sbjct: 438 YDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFTFDMNNI 497

Query: 449 EGFVSLFKSDKVKQFHLQKYPKD-----YISSLFQKL 480
           +   S+F + KV +++L KY K      YI S+  ++
Sbjct: 498 DKQKSMFSNRKVLEYYLMKYGKQGFLSGYILSVLNRM 534

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  352 bits (904), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 197/449 (43%), Positives = 256/449 (57%), Gaps = 30/449 (6%)

Query: 55  DTRVPSEGPDGFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSD 114
           D R+       FS   YYSNWS Y  R H P +I    ++HVYYAFF+VD K+G + S D
Sbjct: 47  DERMHESRNRSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGD 106

Query: 115 SWSDFELPLSVG---VKGCIKELQKIKLESKHEFKTILCLGGWSNREAYXXXXXXXXXXX 171
            W+DF+ P+      VKG + EL  +K+  K+  K I+C+GGWSNREA+           
Sbjct: 107 KWADFQRPILKNNKLVKGNVGELFDLKM--KNRVKCIMCIGGWSNREAWHIFSTDPSKIE 164

Query: 172 XFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEE 231
            F E AV  MF YGFDGIDLDWE+PE+D  EP +YLE+MR I+  M++LE +IF   +  
Sbjct: 165 SFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSAT 224

Query: 232 KDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGX 291
               +F+LSVATPAF +KL I P+ EM   +D WNMM YD++GEWS+ TGYHSNLY    
Sbjct: 225 TS--YFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLYDGSK 282

Query: 292 XXXXXXXXXXXXXXXXX----DTAVKLMTDRHNISSRRIALGMAAYGRGFTNVET----- 342
                                D AVK M ++  I   +I LGMAAYGRGFTNV+      
Sbjct: 283 GSTTIESVLRHGMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTNVDVPTPRP 341

Query: 343 -NDDNYLXXXXXXXXXXXXXXXXIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYD 401
                Y+                +W Y+QLPI G+ EQFD   VS YCF+P + TFVGYD
Sbjct: 342 NESPRYIGRTFDGVGGASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYD 401

Query: 402 NVQSMDIKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEIGLSE----------- 449
            + S+ +K +YIK K++ GGFWWESCGD+ K+P +SLVNA+ KE+G              
Sbjct: 402 TIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGRDNIKKPESIYKNL 461

Query: 450 GFVSLFKSDKVKQFHLQKYPKDYISSLFQ 478
             VS +K     +  L KY K+Y  + FQ
Sbjct: 462 HCVSHYKQSFHGKGFLSKYLKEYEKNEFQ 490

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  345 bits (884), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 203/512 (39%), Positives = 279/512 (54%), Gaps = 52/512 (10%)

Query: 14  FWIIIIVLAFIVEMCIVPWLFLDK-----IKKGGSAGRRP-PTEID-PDTRVPSEGPDGF 66
           F + I+VL  +++MC+    F  K     I+     G  P   EID    +  S G  G+
Sbjct: 17  FALAIVVL--VLQMCLHKLYFKQKATQDLIQSHFRNGTIPNRQEIDYLMNQTNSNGEKGY 74

Query: 67  SVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFEL----P 122
               YYS+WSPY  R H P DI  ++++H+YYAFF+VD K+G +  SD WSD ++    P
Sbjct: 75  LSGLYYSSWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKP 134

Query: 123 LSVGVK---------------------GCIKELQKIK----LESKHEFKTILCLGGWSNR 157
           LSV +                      GCI EL  +K    +      K IL +GGWSNR
Sbjct: 135 LSVKLHNLNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNR 194

Query: 158 EAYXXXXXXXXXXXXFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGM 217
           + +            FI++AV+ MFRYGFDGIDLDWEFP++D  EP  YLEM+  +R  M
Sbjct: 195 DRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKM 254

Query: 218 DQLERQIFGSPAEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWS 277
           D LE +IFG   E KDHP FQLSVATPAF  KL+ILPI +M +YVD WNMM YD++G WS
Sbjct: 255 DDLELEIFG---ETKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWS 311

Query: 278 DVTGYHSNLYL---QGXXXXXXXXXXXXXXXXXXDTAVKLMTDRHNISSRRIALGMAAYG 334
           + TGYH NL+                        + A+  M    N+ S ++ LGMAAYG
Sbjct: 312 EATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYG 371

Query: 335 RGFTNVETN---DDNYLXXXXXXXXXXXXXXXXIWLYNQLPIDGSKEQFDSNAVSAYCFD 391
           R F +V++    D                    +WLYNQLP+ G+ E +D N  +A+C+D
Sbjct: 372 REFKHVKSRQGVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYD 431

Query: 392 PKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDSK-DPRKSLVNAFSKEIGLSEG 450
            KS TF+GYDNV S+ +K +Y++ + L GGFWWESCGD   + R+SL+  FS E+     
Sbjct: 432 KKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRK 491

Query: 451 FVS---LFKSDKVKQFHLQKYPKD-YISSLFQ 478
           F     +F+  +   ++L +Y  D ++S + Q
Sbjct: 492 FSDQDLIFRRKECIAYYLNRYGTDGFLSGILQ 523

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  337 bits (864), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/515 (39%), Positives = 269/515 (52%), Gaps = 59/515 (11%)

Query: 13  KFWIIIIVLAFIVEMCIVPWL--------FLDKIKKGGSAGRRPPTEIDPDTRVPSEGPD 64
           KF + I V   I+E      +        F +     G +G    T  D  T + ++   
Sbjct: 10  KFLVAICVTGIILEAIYTGRIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSADNES 69

Query: 65  GFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELPL- 123
           GF    YYSNWSPY AR H P DI   +LTHVYYAF VV++++G  + SD WSD ++ L 
Sbjct: 70  GFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLY 129

Query: 124 ----------------SVGVK-----GCIKELQKIKLES----------KHEFKTILCLG 152
                             G K     GCI EL  +K  +           + FKTI+ +G
Sbjct: 130 KQMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVG 189

Query: 153 GWSNREAYXXXXXXXXXXXXFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRG 212
           GWSNREA+            F+++ V  MF YGFDGID+DWEFP+ D+ EP VYL+M++ 
Sbjct: 190 GWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKA 249

Query: 213 IREGMDQLERQIFGSPAEEKDHP-HFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYD 271
           +RE +D LE QIFGS    KDH  HF L+ A  A  E L  LP+ E  +YVD WN+M YD
Sbjct: 250 LRERLDTLESQIFGS----KDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYD 305

Query: 272 FHGEWSDVTGYHSNLYLQGXXXXXXXXXXXXXXXXXXDTAVKLMTDRHNISSRRIALGMA 331
           F G WS  T Y SNLY                     D AV+ +TD+  ++S++I LGM 
Sbjct: 306 FSGAWSAQTAYQSNLYTPA-----KTNKRSTNGRGSADKAVRFLTDKSKLASKKIVLGMP 360

Query: 332 AYGRGFTNVETND---DNYLXXXXXXXXXXXXXXXXIWLYNQLPIDGSKEQFDSNAVSAY 388
           AYGRGF  VE +    +N +                I LY QLP+ G  E FD NAVSAY
Sbjct: 361 AYGRGFKGVEVSHKSIENVIGKPFQDVSGSSEGEEGISLYKQLPLKGGMEFFDHNAVSAY 420

Query: 389 CF----DPKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDSKDPRKSLVNAFSKE 444
           C     + K    + YDNV SM  K  Y++K +L GGFWWESCG+     KSLV AF+KE
Sbjct: 421 CVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKG-KSLVGAFTKE 479

Query: 445 IG-LSEGFVSLFKSDKVKQFHLQKYPKDYISSLFQ 478
           I  L++   +++   +V Q +L+ +P  +++S FQ
Sbjct: 480 IKCLNKTEPTIYSLPEVVQHYLKLHPGGFLASTFQ 514

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  333 bits (855), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 184/490 (37%), Positives = 271/490 (55%), Gaps = 47/490 (9%)

Query: 12  LKFWIIIIVLAFIVEMCIVPWLFLDKIKKGGSAG--RRPPTEIDPDTRVPSEGPDGFSVA 69
           L  +I+I++ + I++M +   +F  K+K+   +   R P +++  +T         +   
Sbjct: 9   LGTFIVILITSLILQMSLHYKIF-QKLKRRSQSDDYRMPESDVLSNT--------SYIAG 59

Query: 70  TYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELPLSVGVK- 128
            YYSNWSPY  R H P DI   +++H+YYAF ++D ++G + SSD WSD +L L+   + 
Sbjct: 60  LYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLNLAKQCRE 119

Query: 129 ---------------------GCIKELQKIKLE----SKHEFKTILCLGGWSNREAYXXX 163
                                GCI EL  ++       K   K I+ +GGWSNRE++   
Sbjct: 120 YMFKRFTGDELKAVTNIRAPPGCIGELNYLRYIYSKIKKRNVKLIMSVGGWSNRESFPIM 179

Query: 164 XXXXXXXXXFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQ 223
                    FI + ++ M  YGFDGIDLDWEFPE+DS EP  YL M R ++  + +LE  
Sbjct: 180 VRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDDSYEPDAYLRMARELKLQLQKLEAN 239

Query: 224 IFGSPAEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYH 283
           I G  + +     FQLS+ATPAF +KL+ILPI ++ KY+D+WN+M YD++GEWS+ TG H
Sbjct: 240 ILGDHSNKT----FQLSMATPAFKDKLSILPIHKLDKYIDLWNLMTYDYYGEWSERTGLH 295

Query: 284 SNLYLQGXXXXXXXXXXXXXXXXXXDTAVKLMTDRHNISSRRIALGMAAYGRGFTNVE-- 341
           +NLY +                   D A+  M +R  I  R++ LGMAAYGRGFTNV+  
Sbjct: 296 ANLYNE-KGKLLHLHRHDEDAGLSGDAAINYMVNRCKIDPRKVILGMAAYGRGFTNVDMK 354

Query: 342 -TNDDNYLXXXXXXXXXXXXXXXXIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGY 400
            TN  N                  +WLYNQLPI GS E++D   V AYC+D ++ T VGY
Sbjct: 355 STNPHNPYGLKFSGVGGASEGEPGMWLYNQLPIPGSNEKYDYRHVGAYCYDDRTHTLVGY 414

Query: 401 DNVQSMDIKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEI-GLSEGFVSLFKSD 458
           DN  S+  K  YI   +L G FWWESCGD+ K+P++SL+N + + I  +     +++ + 
Sbjct: 415 DNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIRVIRNVKNNKETIYSTT 474

Query: 459 KVKQFHLQKY 468
           K+  ++L+ Y
Sbjct: 475 KLHDYYLENY 484

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  329 bits (843), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/522 (38%), Positives = 274/522 (52%), Gaps = 53/522 (10%)

Query: 1   MFEGFKIT-KLHLKFWIIIIVLAFIVEMCIVPWLFLDKIKKGGSAGRRP----PTEIDPD 55
           M  G  I  K  + F ++II+L  +    IV  + +   +   +A  R      T  D D
Sbjct: 1   MLPGLVIARKFLVLFCVVIIILEGVYTNKIVKSIRIKAFQGLYNAIARSEKMQSTVKDKD 60

Query: 56  TRVPSEGPDGFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDS 115
             +      G +   YYSNWSPY AR H P DI   +LT V+Y+F VV+ ++G  + SD 
Sbjct: 61  NSLLISSERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDE 120

Query: 116 WSDFELPL---------SVGVK-------------GCIKELQKIKL----------ESKH 143
           WSD ++ L          V +K             GCI EL  +K           E   
Sbjct: 121 WSDVQMDLYKQMFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPEDVK 180

Query: 144 EFKTILCLGGWSNREAYXXXXXXXXXXXXFIETAVDCMFRYGFDGIDLDWEFPEEDSNEP 203
            FKTI+ +GGWSNREA+            FI + VD MF+YGFDGID+DWEFP+ DS EP
Sbjct: 181 NFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEP 240

Query: 204 IVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVD 263
             YL+MMR +R+ +D LE  IFG+   EK   HF L+ A  A    L  LP+ E+ +YVD
Sbjct: 241 KAYLDMMRSLRKKLDDLESDIFGT---EKHTQHFLLTSAISADPSCLEYLPLGEIDRYVD 297

Query: 264 IWNMMCYDFHGEWSDVTGYHSNLYLQGXXXXXXXXXXXXXXXXXXDTAVKLMTDRHNISS 323
            WN+M YDF G WS  T Y SNLY +                   DTAV+L+ ++H + +
Sbjct: 298 QWNLMAYDFSGAWSRHTAYQSNLYSRS----SLGKRSENSEGGSADTAVRLLLNKHKLPA 353

Query: 324 RRIALGMAAYGRGFTNVET---NDDNYLXXXXXXXXXXXXXXXXIWLYNQLPIDGSKEQF 380
           ++I LGM AYGRGF  V     ++ N +                I LYNQLP+ G +E F
Sbjct: 354 KKIVLGMPAYGRGFKGVSVPHHSEHNVIGQSFQQVSGLSEGESGISLYNQLPLKGGQEWF 413

Query: 381 DSNAVSAYCFDPKSRT----FVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDSK-DPRK 435
           D +AVSAY     S       V YDNVQSM IK +Y+ K NL GGFWWESCG++  D  +
Sbjct: 414 DQDAVSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSR 473

Query: 436 SLVNAFSKEIG-LSEGFVSLFKSDKVKQFHLQKYPKDYISSL 476
           SL  AF++EI  L++   +++   +V +++ +KYP  +++S+
Sbjct: 474 SLTRAFTQEIKYLNKTVPTIYALPQVGEYYHKKYPDGFLASI 515

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  325 bits (832), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 182/485 (37%), Positives = 266/485 (54%), Gaps = 63/485 (12%)

Query: 26  EMCIVPWLFLD----KIKKGGSAGRRPPTEIDPDTRVPSEGPDGFSVATYYSNWSPYNAR 81
           EMC+   +F +    KI+   + G      +D  T+ P+   +GF    YYSNWSPY  R
Sbjct: 30  EMCLYKKIFKNQRSNKIRDSFNNGGHKVPNMD-QTQGPNVDGEGFVSGVYYSNWSPYKPR 88

Query: 82  NHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFEL----PLSVGVK--------- 128
            H P DI  +Q++HVYYAFF ++ ++G ++S+D+WSD E+    PL++            
Sbjct: 89  FHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSELIDGNSSN 148

Query: 129 --------GCIKELQKIKLE-SKHEFKTILCLGGWSNREAYXXXXXXXXXXXXFIETAVD 179
                   GCI EL  +K   S  +FK I+ +GGWS+ E +            F++++V+
Sbjct: 149 DIQKILPLGCIGELFYLKHSCSGKKFKVIMSIGGWSDSENFKVIIKNENLLQAFVDSSVE 208

Query: 180 CMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQL 239
            MF+ GFDGIDLDWEFPE + +EP  YL+++R +R  ++ LE QIFG   E+    HFQL
Sbjct: 209 TMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIFGEGVED----HFQL 264

Query: 240 SVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGXXXXXXXXX 299
           S+A PAF +KL  LPI E+ +Y+D WNMM YD++G WS+ TGYHSNL+ +          
Sbjct: 265 SIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSE---------- 314

Query: 300 XXXXXXXXXDTAVKLMTDRHNISSRRIALGMAAYGRGF------------TNVETNDDNY 347
                    + A+  M D+  I+SR++ LGMAAYGR F              +  N    
Sbjct: 315 ----TELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQPFTQNTILINQSFK 370

Query: 348 LXXXXXXXXXXXXXXXXIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSMD 407
                            IW Y  LP  G+ E++D   VSAYCFD K+  F+ YDN +S+ 
Sbjct: 371 GVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSIFISYDNTKSVK 430

Query: 408 IKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEIGLSEGFV---SLFKSDKVKQF 463
            K +Y+    L GGFWWESCG++  +  +SL++AF++  GL        S+F++++V  F
Sbjct: 431 TKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNE--GLRSNVSTKPSMFENERVVNF 488

Query: 464 HLQKY 468
           +L KY
Sbjct: 489 YLNKY 493

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  324 bits (831), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/485 (38%), Positives = 269/485 (55%), Gaps = 63/485 (12%)

Query: 26  EMCIVPWLFL----DKIKKG-GSAGRRPPTEI-DPDTRVPSEGPDGFSVATYYSNWSPYN 79
           EMC+   +F     D I+    + G R P+ + +  T +  E    F    YYSNWSPY 
Sbjct: 30  EMCLYNKIFKNQRSDDIRDNFNNGGHRVPSNVQNHGTHIRDEA---FISGVYYSNWSPYK 86

Query: 80  ARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELPL--SVGVK--------- 128
            R H P DI   Q++H+YYAFF +++++G ++++DSWSD E+ L  S+ +K         
Sbjct: 87  PRFHFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLYKSLAIKNSELIKESS 146

Query: 129 ----------GCIKELQKIKLE-SKHEFKTILCLGGWSNREAYXXXXXXXXXXXXFIETA 177
                     GCI EL  +K   S  +FK I+ +GGWS+ E +            F++++
Sbjct: 147 NNSVQNILPLGCIGELFYLKNTCSDKKFKVIMSIGGWSDSENFKIIIKDDKLLQNFVDSS 206

Query: 178 VDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHF 237
           V+ MFR GFDGIDLDWEFP  + +EP  YL+++R +R  ++ LE QIFG   E+    HF
Sbjct: 207 VETMFRLGFDGIDLDWEFPGNNESEPRGYLKLVRMLRLKLNSLESQIFGKRTED----HF 262

Query: 238 QLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGXXXXXXX 297
           QLS+A PAF +KL  LPI+E+ +YVD WNMM YD++G WS+ TGYHSNL+ +        
Sbjct: 263 QLSIAAPAFKDKLFYLPITEIDQYVDYWNMMTYDYYGSWSETTGYHSNLFSE-------- 314

Query: 298 XXXXXXXXXXXDTAVKLMTDRHNISSRRIALGMAAYGRGF----TNVETNDDNYLXXXX- 352
                      + A+  M DR  ++SR++ LGMAAYGR F       E  + N +     
Sbjct: 315 ------TELNGNFAMHYMIDRFGVNSRKLVLGMAAYGRSFHIKDNKFEPFNQNTVLINKI 368

Query: 353 -------XXXXXXXXXXXXIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQS 405
                              IW Y  LP  G+ EQ+D   VSAYCFD K+  F+ YDN +S
Sbjct: 369 FKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPKYVSAYCFDEKNSIFISYDNTKS 428

Query: 406 MDIKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEIGLS-EGFVSLFKSDKVKQF 463
           +  K +Y+   NL GGFWWESCG++  +  +SL+NAF++ +  +     S+F+  +VK++
Sbjct: 429 VKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAFNEGLHFNVSSKPSIFQDVRVKKY 488

Query: 464 HLQKY 468
           +L KY
Sbjct: 489 YLNKY 493

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  323 bits (828), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 182/484 (37%), Positives = 259/484 (53%), Gaps = 60/484 (12%)

Query: 26  EMCIVPWLFLDK----IKKGGSAGRRPPTEIDPDTRVPSEGPDGFSVATYYSNWSPYNAR 81
           EMC+   LF ++    I+     GR     +  + + PS   DG+    YYSNWSPY  R
Sbjct: 30  EMCLYNKLFKNQRSEDIRDNFQNGRHQVPNMVQNQK-PSGDDDGYVSGVYYSNWSPYKPR 88

Query: 82  NHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFEL----PLSVGVK--------- 128
            H P DI   Q++HVYYAFF +D K+G + S+DSWSD E+    PL++            
Sbjct: 89  FHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDD 148

Query: 129 ---------GCIKELQKIKLE-SKHEFKTILCLGGWSNREAYXXXXXXXXXXXXFIETAV 178
                    GCI EL  +K   S  +FK+I+ +GGWS+ E +            F++++V
Sbjct: 149 NNMQSILPLGCIGELFYLKNACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSV 208

Query: 179 DCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQ 238
           + MF+ GFDGID+DWEFPE +  EP  YL+++R +R  ++ LE QIFG   ++    HF+
Sbjct: 209 ETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGSTKD----HFE 264

Query: 239 LSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGXXXXXXXX 298
           LS+A PAF +KL  LPI+E+ +Y+D WNMM YD++G WS+ TGYHSNL+ +         
Sbjct: 265 LSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLFSE--------- 315

Query: 299 XXXXXXXXXXDTAVKLMTDRHNISSRRIALGMAAYGRGF------------TNVETNDDN 346
                     + A+  M     ++ R++ LGMAAYGR F              V  N   
Sbjct: 316 -----TELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFTKNTVLINQQF 370

Query: 347 YLXXXXXXXXXXXXXXXXIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSM 406
                             IW Y  LP  G+ EQ+D   VSAYCFD K+  F+GYDN +S+
Sbjct: 371 KGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSIFIGYDNTESI 430

Query: 407 DIKGKYIKKKNLNGGFWWESCG-DSKDPRKSLVNAFSKEIGLS-EGFVSLFKSDKVKQFH 464
             K  Y+    L GGFWWESCG D  D  +SL+NAF++ +  +     S+F+  +V +++
Sbjct: 431 KTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSMFQDKRVMKYY 490

Query: 465 LQKY 468
           L KY
Sbjct: 491 LSKY 494

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  318 bits (815), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/487 (37%), Positives = 264/487 (54%), Gaps = 61/487 (12%)

Query: 26  EMCIVPWLFL----DKIKKG-GSAGRRPPTEIDPDTRVPSEGPDGFSVATYYSNWSPYNA 80
           EMC+   +F     D I+    + G + P+ +    + P +G  G+    YYSNWSPY  
Sbjct: 30  EMCLYNKIFKSQRSDDIRDNFRNGGDQVPSMVQ--NQKPHDGGKGYVSGVYYSNWSPYTP 87

Query: 81  RNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFEL----PLSVGVK-------- 128
           R H P DI   Q++HVYYAFF +++K+G ++S+DSWSD E+    PL++           
Sbjct: 88  RFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQLVENNLN 147

Query: 129 ---------GCIKELQKIKLE-SKHEFKTILCLGGWSNREAYXXXXXXXXXXXXFIETAV 178
                    GC+ EL  +K   S+ +FK I+ +GGWS+ E +            F++++V
Sbjct: 148 DSVQNILPLGCVGELFYLKNACSEKKFKVIMSIGGWSDSENFKTIVGDDKLLQNFVDSSV 207

Query: 179 DCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQ 238
           + MF+ GFDGID+DWEFPE +  EP  YL++++ +R  ++ LE QIFG   E+    HFQ
Sbjct: 208 ETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFGESIED----HFQ 263

Query: 239 LSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGXXXXXXXX 298
           +S+A PAF +KL  LPISE+ +Y+D WNMM YD++G WS+ TGYHSNL+ +         
Sbjct: 264 ISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSE--------- 314

Query: 299 XXXXXXXXXXDTAVKLMTDRHNISSRRIALGMAAYGRGF------------TNVETNDDN 346
                     + A+  M D  ++ S ++ LGMAAYGR F              V  N   
Sbjct: 315 -----TELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQNTVLINQHF 369

Query: 347 YLXXXXXXXXXXXXXXXXIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSM 406
                             IW Y  LP  G+ EQ+D   VSAYCFD K+  F+ YDN +S 
Sbjct: 370 KGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIFISYDNTKSA 429

Query: 407 DIKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEIGLS-EGFVSLFKSDKVKQFH 464
             K +Y+    L GGFWWESCG++  +  +SL+NAF++ I  +     S+F+  +V +F+
Sbjct: 430 KTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMFQDMRVIKFY 489

Query: 465 LQKYPKD 471
           L KY  D
Sbjct: 490 LNKYGDD 496

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,755,572
Number of extensions: 2080561
Number of successful extensions: 4681
Number of sequences better than 10.0: 23
Number of HSP's gapped: 4663
Number of HSP's successfully gapped: 29
Length of query: 480
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 367
Effective length of database: 40,524,141
Effective search space: 14872359747
Effective search space used: 14872359747
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)