Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E02311g5.440ON41741716390.0
KLTH0F15928g5.440ON4234108831e-115
Kwal_55.214085.440ON4364108761e-114
SAKL0G02662g5.440ON4792728611e-111
NCAS0H020805.440ON4352758261e-106
ACL167C5.440ON4392778191e-105
ZYRO0F10164g5.440ON4233958161e-105
Ecym_45115.440ON4614158081e-103
KAFR0D050505.440ON4192278011e-103
NDAI0C015905.440ON4702587971e-101
TDEL0D026105.440ON4402767891e-101
Smik_15.3005.440ON4632887727e-98
CAGL0K10230g5.440ON4462777654e-97
Suva_8.1755.440ON4532687594e-96
YOR123C (LEO1)5.440ON4642437571e-95
KNAG0B042105.440ON4632307256e-91
Skud_15.2855.440ON4873897191e-89
TPHA0E017305.440ON4693786804e-84
Kpol_1062.265.440ON4572276682e-82
TBLA0A064905.440ON4282856033e-73
KLTH0C02992g1.494ON53552695.7
NCAS0G023002.130ON42495678.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E02311g
         (417 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   635   0.0  
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   344   e-115
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   342   e-114
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   336   e-111
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   322   e-106
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   320   e-105
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   318   e-105
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   315   e-103
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   313   e-103
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   311   e-101
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   308   e-101
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   301   7e-98
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   299   4e-97
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   296   4e-96
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   296   1e-95
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   283   6e-91
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   281   1e-89
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   266   4e-84
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   261   2e-82
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   236   3e-73
KLTH0C02992g Chr3 complement(264520..266127) [1608 bp, 535 aa] {...    31   5.7  
NCAS0G02300 Chr7 (408571..409845) [1275 bp, 424 aa] {ON} Anc_2.1...    30   8.4  

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/417 (77%), Positives = 325/417 (77%)

Query: 1   MSDXXXXXXXXXXXXXXXXKVSDALDDLFGDESEEENQQQSLDEQQNDSDDSSAGTSHHR 60
           MSD                KVSDALDDLFGDESEEENQQQSLDEQQNDSDDSSAGTSHHR
Sbjct: 1   MSDRVEEEPERVNNEQIEEKVSDALDDLFGDESEEENQQQSLDEQQNDSDDSSAGTSHHR 60

Query: 61  VIDDEEDEEQAMYNRKFLXXXXXXXXXXXXXXXXXXXXXXIVKHVVPYKTANGADDKTIY 120
           VIDDEEDEEQAMYNRKFL                      IVKHVVPYKTANGADDKTIY
Sbjct: 61  VIDDEEDEEQAMYNRKFLGEDYEGQSEEEYEKKYKEVDVEIVKHVVPYKTANGADDKTIY 120

Query: 121 YAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERV 180
           YAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERV
Sbjct: 121 YAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERV 180

Query: 181 FKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMM 240
           FKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMM
Sbjct: 181 FKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMM 240

Query: 241 FVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEKKHDQIXXXXXXXX 300
           FVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEKKHDQI        
Sbjct: 241 FVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEKKHDQILRERRKKQ 300

Query: 301 XXXXXXXXNAGDSPEPQFNIQKNLSKRHNLDEYEYDDGFVAQXXXXXXXXXXXXXXXFXX 360
                   NAGDSPEPQFNIQKNLSKRHNLDEYEYDDGFVAQ               F  
Sbjct: 301 LKEKLELENAGDSPEPQFNIQKNLSKRHNLDEYEYDDGFVAQDDEEEDDEEEEEDEDFSG 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXNAKRLREVKQTGAQEYQEDAQAKKRKIAVLDDEDDE 417
                                NAKRLREVKQTGAQEYQEDAQAKKRKIAVLDDEDDE
Sbjct: 361 EDNDVGDEEESDGGDSEKEYENAKRLREVKQTGAQEYQEDAQAKKRKIAVLDDEDDE 417

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  344 bits (883), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 193/410 (47%), Positives = 250/410 (60%), Gaps = 36/410 (8%)

Query: 25  LDDLFGDESEEENQQQSLDEQQNDSDDSSAGTSHHRVIDDEEDEEQAMYNRKFLXXXXXX 84
           +DDLFGD+S++E       EQ+  S +S+         ++EED+EQAMYNRKF       
Sbjct: 33  MDDLFGDDSDQETGS-GPGEQEPHSPNSA---------NEEEDDEQAMYNRKFYGDKGED 82

Query: 85  XXXXXXXXXXXXXXXXIVKHVVPYKTANGADDKTIYYAKVPQFLTIDPVPFDPPSFQKKV 144
                           I+KH+VPY T     DKTIYY KVPQFLTIDP+PFDPP+FQ K+
Sbjct: 83  SNDEGSQEFREADID-IMKHIVPYSTEPSQGDKTIYYTKVPQFLTIDPIPFDPPAFQSKI 141

Query: 145 EDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGTFSLKVGDEY 204
           E+R ++ +S EDQ+ DRLIEENT+RWRYSRDK++RVFKESNA IV+WSDGT+SL++GDEY
Sbjct: 142 EERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKESNAHIVQWSDGTYSLRLGDEY 201

Query: 205 TDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSKAVARRDER 264
           TD+L+N+TE+TYL VSH++QELIQ V+GGE+TK+M+F+PTSTNSK H+ LSKAVAR++++
Sbjct: 202 TDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSKAVARKEQQ 261

Query: 265 GQHGPNTYITRTDPELEKRELEKKHDQIXXXXXXXXXXXXXXXXNAGDSPEPQF---NIQ 321
             HGPNTYI R DPELE++ELEKK  QI                   DSP P     +  
Sbjct: 262 EHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLREQQEREGM-DSPAPTSKPRSAS 320

Query: 322 KNLSKRHNLDEYEYDDGFVAQXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXXXXXXX 381
           +    +   DEYE DDGF+                                         
Sbjct: 321 RPGYSQTRYDEYE-DDGFMV------DDEENESDGGVGGDGNEDEEDLLDDEEEEDDDDL 373

Query: 382 NAKRLREVKQTGAQEYQ--------------EDAQAKKRKIAVLDDEDDE 417
           NA+RLR++K+ GA +Y               ED+  K+RK+AVLDDEDDE
Sbjct: 374 NAERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVLDDEDDE 423

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  342 bits (876), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 192/410 (46%), Positives = 246/410 (60%), Gaps = 36/410 (8%)

Query: 25  LDDLFGDESEEENQQQSLDEQQNDSDDSSAGTSHHRVIDDEEDEEQAMYNRKFLXXXXXX 84
           +DDLFGDES+             D +D           +++E++EQAMYNRKF       
Sbjct: 46  MDDLFGDESD----------NNIDQEDDGTQAREDGEGEEDEEDEQAMYNRKFYGDNAED 95

Query: 85  XXXXXXXXXXXXXXXXIVKHVVPYKTANGADDKTIYYAKVPQFLTIDPVPFDPPSFQKKV 144
                           +VKHVVPY T     DKTI+YAKVPQFLTIDP+PFDPP+FQ K+
Sbjct: 96  SNDEGSQREFREADVDVVKHVVPYSTVPSEGDKTIFYAKVPQFLTIDPIPFDPPAFQNKI 155

Query: 145 EDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGTFSLKVGDEY 204
           E R ++ SS EDQ+ DRLIEENT+RWRYSRD  ++VFKESNAQIV+WSDGTFSL++GDE+
Sbjct: 156 EQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNAQIVQWSDGTFSLRLGDEF 215

Query: 205 TDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSKAVARRDER 264
           TD+L+N+TE+TYLTVSH++QELIQ V+GGE+TK+M+F+PTSTNSK H+ LSKAVAR+++R
Sbjct: 216 TDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQRLSKAVARKEQR 275

Query: 265 GQHGPNTYITRTDPELEKRELEKKHDQIXXXXXXXXXXXXXXXXNAGDSPEPQFNIQKNL 324
             HGPNTYI R DPELE++ELEKK  QI                   DSP P    +   
Sbjct: 276 EHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLREQQEREGL-DSPAPAAKPKSTS 334

Query: 325 S---KRHNLDEYEYDDGFVAQXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXXXXXXX 381
           S    +   DEYE DDGF+                                         
Sbjct: 335 SLGYSQSRYDEYE-DDGFMVDDENNETGED-------DEGEDDEDDLLDDNNEEEEDDDL 386

Query: 382 NAKRLREVKQTGAQEYQ--------------EDAQAKKRKIAVLDDEDDE 417
           NA+RLR++K++GA +Y+              +D+  K+RK+AVLDDEDDE
Sbjct: 387 NAERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVLDDEDDE 436

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  336 bits (861), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/272 (59%), Positives = 207/272 (76%), Gaps = 6/272 (2%)

Query: 25  LDDLFGDESEEENQQQSLDEQQNDSDD---SSAGTSHHRVIDDEEDEEQAMYNRKFLXXX 81
           +DDLFGD+S+   + +   E++        S +  +H   +  EEDEEQAMYNRKF    
Sbjct: 86  MDDLFGDDSDNAGEGELEGEEKEGKSPNHLSKSEANHGSYL--EEDEEQAMYNRKFYGDD 143

Query: 82  XXXXXXXXXXXXX-XXXXXXIVKHVVPYKTANGADDKTIYYAKVPQFLTIDPVPFDPPSF 140
                               I KH+VPYKT + + DK +YYAKVPQFLTIDPVPFDPPSF
Sbjct: 144 VDNDSDAEDSQREFKEADVEIAKHIVPYKTTSNSQDKEVYYAKVPQFLTIDPVPFDPPSF 203

Query: 141 QKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGTFSLKV 200
           ++ VE R++++SSKEDQL DRLI+ENTIRWRYSRD  ++VFKESNAQI++WSDGTFSL++
Sbjct: 204 KRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVFKESNAQIIQWSDGTFSLRL 263

Query: 201 GDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSKAVAR 260
           GDE++D+L+N+T+NT+LTVSHE+QEL+QCVEGGEITK+MMF+PTST+SK+H+ LSKAV R
Sbjct: 264 GDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFIPTSTSSKIHQRLSKAVVR 323

Query: 261 RDERGQHGPNTYITRTDPELEKRELEKKHDQI 292
           R++R   GPNTYI R DPELE+RELEKK DQI
Sbjct: 324 REQREHLGPNTYIVRKDPELEQRELEKKQDQI 355

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 32/44 (72%), Gaps = 8/44 (18%)

Query: 382 NAKRLREVKQTGAQEYQE--------DAQAKKRKIAVLDDEDDE 417
           NA+RLR++K+ GA +Y++        ++  K+RKIAVLDDE+++
Sbjct: 435 NAERLRQLKREGAAQYEQKDEESGSEESSHKRRKIAVLDDEEED 478

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  322 bits (826), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 162/275 (58%), Positives = 202/275 (73%), Gaps = 11/275 (4%)

Query: 22  SDALDDLFGDESEEENQQQSLDEQQNDSDDSSAGTSHHRVIDDEEDEEQAMYNRKFLXXX 81
           +D +DDLFGDE EEE++ +S+DEQ  D D    G+   R    + DEE+AMY RKF    
Sbjct: 42  ADGMDDLFGDE-EEEDENKSVDEQSEDDD---IGSRPRRT---DIDEEEAMYTRKFYGDD 94

Query: 82  XXXXXXXXXXXXX---XXXXXXIVKHVVPYKTAN-GADDKTIYYAKVPQFLTIDPVPFDP 137
                                 +++H+VPYKT++   D+ T+YYAKVP FLTI+PVPFDP
Sbjct: 95  DYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDETTVYYAKVPPFLTINPVPFDP 154

Query: 138 PSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGTFS 197
            +F+  V DR+S YSSKEDQLGDRLI+ENT+RWRYSRD ++RVFKESNAQIV+WSDG+FS
Sbjct: 155 IAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFKESNAQIVQWSDGSFS 214

Query: 198 LKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSKA 257
           LK+GDEYTDILVN T NT+L VSH++QEL+QC  GGEITK++MF+PTSTNSK+H+ LSKA
Sbjct: 215 LKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFIPTSTNSKIHQQLSKA 274

Query: 258 VARRDERGQHGPNTYITRTDPELEKRELEKKHDQI 292
           V RR++R   GP T I   DPE+EKRELEKK  QI
Sbjct: 275 VTRRNQREHLGPGTMIINRDPEVEKRELEKKQGQI 309

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  320 bits (819), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 160/277 (57%), Positives = 197/277 (71%), Gaps = 14/277 (5%)

Query: 26  DDLFGDESEEENQQQSLDEQQNDSDDS----SAGTSHHRVIDDEEDEEQAMYNRKFLX-- 79
           +DLFG++S+      + +     S+DS    S GT H   +  E++EEQ MYNRKF    
Sbjct: 36  NDLFGEDSDVSGSDDADEADDGASEDSGSRRSRGTGHG--LGAEDNEEQEMYNRKFYGDD 93

Query: 80  -XXXXXXXXXXXXXXXXXXXXXIVKHVVPY---KTANGADDKTIYYAKVPQFLTIDPVPF 135
                                 +VKHVVP    K   G   + +YY KVPQFLTIDPVPF
Sbjct: 94  LQQASDLSDEDEAREIKEADLELVKHVVPLLYNKPLEGK--RLLYYTKVPQFLTIDPVPF 151

Query: 136 DPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGT 195
           DPPSFQ ++E R++++SSKEDQLGD LI+ENTIRWRYSR  D+RVFKESNAQ++EWSDGT
Sbjct: 152 DPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRVFKESNAQVIEWSDGT 211

Query: 196 FSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILS 255
            SLK+GDEYTDIL N  ENTYLTVSHE+QE++QCVEGG I+ SM+F+PTSTNSK+HK L+
Sbjct: 212 LSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLFIPTSTNSKIHKRLT 271

Query: 256 KAVARRDERGQHGPNTYITRTDPELEKRELEKKHDQI 292
           KA+ARR+ R   GP+TYI R DPELEKREL+KKHDQ+
Sbjct: 272 KAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQV 308

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  318 bits (816), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 170/395 (43%), Positives = 236/395 (59%), Gaps = 13/395 (3%)

Query: 23  DALDDLFGDESEEENQQQSLDEQQNDSDDSSAGTSHHRVIDDEEDEEQAMYNRKFLXXXX 82
           D ++DLFG++  E+ + +     ++++D+      H + +DDEE EE AMY RKF     
Sbjct: 42  DEMEDLFGEDEGEDEEDEKRKGSEDENDEGEVTLRHRQEMDDEEAEEHAMYTRKFYGEDV 101

Query: 83  XXXXXXXXXXXXXXXXXXIVKHVVPYKTANGADDKTIYYAKVPQFLTIDPVPFDPPSFQK 142
                             +V+H+VPY+   G D   +YYAK+P+FLTIDPVPFDPPSF+ 
Sbjct: 102 DRVSDEEEAQEFREEDVELVRHIVPYRATQGTDKPVLYYAKIPEFLTIDPVPFDPPSFEA 161

Query: 143 KVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGTFSLKVGD 202
            V++R+   +SKEDQLGDRLI+ENT+RWRYSRD +++VFKESNAQIV+WSDGTFSLK+GD
Sbjct: 162 SVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIVQWSDGTFSLKLGD 221

Query: 203 EYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSKAVARRD 262
           EYTDIL N+T+NT+  VSH++QEL+QC EGGE+TK++MF+PTST+S++H+ L+KAV RRD
Sbjct: 222 EYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSRMHQKLTKAVMRRD 281

Query: 263 ERGQHGPNTYITRTDPELEKRELEKKHDQIXXXXXXXXXXXXXXXXNAGDSPEPQFNIQK 322
            +   GP TYI + DPELE+ ELEKK  Q+                 +GD P+ +  I  
Sbjct: 282 HKQAAGPGTYIVQKDPELERGELEKKQQQVVRERRRRQVKEMESREASGD-PDRRAAISA 340

Query: 323 NLSKRHNLDEYEYDDGFVAQXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXXXXXXXN 382
                 N+   EY+                                              
Sbjct: 341 EAEPMGNIRRNEYE---------QDDFLVDDDDEEEYASGSGEEGEEEEEEDEGNVSDEG 391

Query: 383 AKRLREVKQTGAQEYQEDAQAKKRKIAVLDDEDDE 417
           A+RLR +K+ GA  Y+E    K+R++AV+DDE+DE
Sbjct: 392 AERLRRLKREGANNYEE---RKRRRVAVIDDEEDE 423

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  315 bits (808), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/415 (44%), Positives = 243/415 (58%), Gaps = 46/415 (11%)

Query: 40  QSLDEQQNDSDDSSAGTSHHRV---IDDEEDEEQAMYNRKFLX---XXXXXXXXXXXXXX 93
           QS+ E+    D++S GTS       + DEEDE Q MYNRKF                   
Sbjct: 55  QSVIERGETDDENSGGTSVKPTGLGLSDEEDE-QEMYNRKFYGDDLKKTSYESDVEEERE 113

Query: 94  XXXXXXXIVKHVVPYKTANGAD-DKTIYYAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYS 152
                  I+KHVVPY T N ++ D ++YYAKVPQFLTIDP+PFDPP FQ ++E R+ ++S
Sbjct: 114 IKEANVQIMKHVVPYYTTNASEKDSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFS 173

Query: 153 SKEDQLGDRLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGTFSLKVGDEYTDILVNNT 212
           SKEDQLGDRLI+ENTIRWRYSR  +++VFKESNAQI++WSDGTFSLK+GDE++DIL+N+ 
Sbjct: 174 SKEDQLGDRLIDENTIRWRYSRGANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDI 233

Query: 213 ENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSKAVARRDERGQHGPNTY 272
           ENTY+TVSHE++EL+QCVEGGEI KSM+F+PTSTNSK H+ LS A+ARR+ R   GP+TY
Sbjct: 234 ENTYMTVSHEQEELMQCVEGGEIKKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTY 293

Query: 273 ITRTDPELEKRELEKKHDQIXXXXXXXXXXXXXXXXNA--GDSPEPQFNIQKN------- 323
           I R DPELEK+ELEKKHDQ+                NA  G      F  +K        
Sbjct: 294 IVRMDPELEKKELEKKHDQVIRERRKRQLKEQMDRENAEGGIVETGYFGFKKGNGRSMMA 353

Query: 324 -LSKRHNLDEYEYDDGFVAQXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXXXXXXXN 382
            +  +H+ DEY+ +DGF+                 +                       N
Sbjct: 354 EMYGKHHQDEYDDEDGFI-------DDSEEEESGSYDEENAAGSLMDEESDGEDDEDDLN 406

Query: 383 AKRLREVKQTGAQEYQ---------------------EDAQAKKRKIAVLDDEDD 416
           A+RL+++K  GA  YQ                     + +  K+RK+AVLD +D+
Sbjct: 407 AERLKQLKIEGAARYQHGSTTTTSPSDLDTKQDPENNDGSAPKRRKVAVLDSDDE 461

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  313 bits (801), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 146/227 (64%), Positives = 178/227 (78%), Gaps = 1/227 (0%)

Query: 67  DEEQAMYNRKFLXXXXXXXXXXXXXXXXXXXXXXIVKHVVPYKT-ANGADDKTIYYAKVP 125
           DEE+AMYNRKF                       +V+HVVPYKT     DDKTIYY KVP
Sbjct: 66  DEEEAMYNRKFYGEEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIYYTKVP 125

Query: 126 QFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESN 185
            FL+IDP+PFDPPSF+ KV++R S +SS EDQLGDRLI+ENTIRWRYSRD ++RVFKESN
Sbjct: 126 AFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKESN 185

Query: 186 AQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTS 245
           AQIV+WSDG++SLK+G EYTDILVN T+NT+LTVSH++QEL+QCV+GG+I K+++F+PTS
Sbjct: 186 AQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPTS 245

Query: 246 TNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEKKHDQI 292
           TNSK+H+ LSKA+ARRD+R   GP T I   DPE+EKRELEKK  QI
Sbjct: 246 TNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEKKQTQI 292

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  311 bits (797), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 152/258 (58%), Positives = 194/258 (75%), Gaps = 9/258 (3%)

Query: 25  LDDLFGDESEEENQQQSLDEQQN----DSDDSSAGTSHHRVIDDEEDEEQAMYNRKFLXX 80
           +DDLFGD+ +E+ +Q+  D+++     + DD SA     R  +D +DEE AMY RKF   
Sbjct: 75  MDDLFGDDEDEDKEQRGSDDEEEGFIVEEDDESA----QRRPEDMDDEE-AMYTRKFYGD 129

Query: 81  XXXXXXXXXXXXXXXXXXXXIVKHVVPYKTANGADDKTIYYAKVPQFLTIDPVPFDPPSF 140
                               I++H+VPYKT++   D TIYYAKVP FLTIDP+PFDP SF
Sbjct: 130 TDKYSDNEEDAHDFKEANVEIIRHMVPYKTSSDQADTTIYYAKVPPFLTIDPIPFDPVSF 189

Query: 141 QKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGTFSLKV 200
           + KV+DR++ YSS+EDQLGDRLI+ENTIRWRYSRD+++RVFKESNAQIV+WSDG+FSLK+
Sbjct: 190 ETKVKDRLADYSSREDQLGDRLIDENTIRWRYSRDQNQRVFKESNAQIVQWSDGSFSLKL 249

Query: 201 GDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSKAVAR 260
           GDEYTDILVN+T+NT+LTVSH++QEL+QC  GGEITK+MMF+PTSTNSK+H+ LSKAV R
Sbjct: 250 GDEYTDILVNDTDNTFLTVSHDQQELMQCYNGGEITKTMMFIPTSTNSKIHQQLSKAVTR 309

Query: 261 RDERGQHGPNTYITRTDP 278
           R++R   GP T I   DP
Sbjct: 310 RNQRQNLGPGTMIIEKDP 327

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 8/43 (18%)

Query: 383 AKRLREVKQTGAQEY-------QEDAQAKKRKIAVL-DDEDDE 417
           AKRL+E+K+ GAQEY        E+  +K+RK+AVL DDE+DE
Sbjct: 428 AKRLKEIKKGGAQEYADREESDMEEGSSKRRKVAVLSDDEEDE 470

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  308 bits (789), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 159/276 (57%), Positives = 201/276 (72%), Gaps = 9/276 (3%)

Query: 23  DALDDLFGDESEEENQQQSLDEQQNDSDDSSAGTSHHRV---IDDEEDEEQAMYNRKFLX 79
           D +DDLFGDE +  ++    DE++  S +S    S  R    +DDEE +E AMY RKF  
Sbjct: 38  DEMDDLFGDEGQASDR--GSDEEEGGSSNSDEEESSRRGEMQMDDEEAQEHAMYTRKFYG 95

Query: 80  XXXXXXXXXXXXXXX-XXXXXXIVKHVVPYKTAN-GADDK-TIYYAKVPQFLTIDPVPFD 136
                                 +V+H+VPYKT   GAD+K TIYYAKVP+FLTIDPVPFD
Sbjct: 96  EDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYYAKVPEFLTIDPVPFD 155

Query: 137 PPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGTF 196
           PPSF+ KV++R++  SS+EDQLGDRLI+ENTIRWRYSRD++++V+KESNAQIV+WSDG  
Sbjct: 156 PPSFESKVKERLNS-SSREDQLGDRLIDENTIRWRYSRDENQQVYKESNAQIVQWSDGGL 214

Query: 197 SLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSK 256
           SLK+G EYTDILVN+T+NT+  VSH+EQEL+QC +GGE+TKS+MF+PTSTNSK+H+ L+K
Sbjct: 215 SLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIPTSTNSKMHQKLTK 274

Query: 257 AVARRDERGQHGPNTYITRTDPELEKRELEKKHDQI 292
           AV RRD+R   GP  Y    DPELEK ELEKK  Q+
Sbjct: 275 AVIRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQV 310

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  301 bits (772), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 158/288 (54%), Positives = 195/288 (67%), Gaps = 20/288 (6%)

Query: 25  LDDLFGDE-------------SEEENQQQSLDEQQNDSDDSSAG-TSHHR---VIDDEED 67
           LDDLFGD+              ++   + + +E   DSD+ S    S HR    +DD+E 
Sbjct: 48  LDDLFGDDDDDDNDDDNDDNDGKKSGIENNNNESGGDSDEESVNHRSRHRESLGLDDDEA 107

Query: 68  EEQAMYNRKFLXXXXXXXXXXXXXXXX-XXXXXXIVKHVVPYK--TANGADDKTIYYAKV 124
           EEQAMY RKF                        +V+H++P K      A    I+YA++
Sbjct: 108 EEQAMYTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYARI 167

Query: 125 PQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKES 184
           P FLTIDPVPFDPPSF+ KV +R S  +SKEDQL DRLI+ENT+RWRYSRDKD+ VFKES
Sbjct: 168 PNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFKES 227

Query: 185 NAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPT 244
           N QIV+WSDGT+SLKVG+E TDILVN+T NT+LTVSH++QELIQC EGGEI K++MF+PT
Sbjct: 228 NTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPT 287

Query: 245 STNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEKKHDQI 292
           STNSK+H+ LSKAV RR++R   GP TYI   DPE+EKRELEKK  QI
Sbjct: 288 STNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKKQSQI 335

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  299 bits (765), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 192/277 (69%), Gaps = 6/277 (2%)

Query: 69  EQAMYNRKFLXXXXXXXXXXXXXXXXXXXXXXIVKHVVPYKT--ANGADDKTIYYAKVPQ 126
           EQ MY RKF                       +++H++PYKT   N   D+ I+YAKVP 
Sbjct: 108 EQEMYTRKFYGEDAVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDE-IFYAKVPA 166

Query: 127 FLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESNA 186
           FLTIDPVPFDP +F+  V++R+SK +SKEDQLGDRLI+ENTIRWRYSRD ++ VFKESNA
Sbjct: 167 FLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNA 226

Query: 187 QIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTST 246
           QIV+WSDG+FSLK+GDEYTDI+VN+T+NT+LTVSH++QEL+QC +GGEITK+MMF+PTST
Sbjct: 227 QIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTST 286

Query: 247 NSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEKKHDQIXXXXXXXXXXXXXX 306
           NSK+H+ LSKAV+RR+ R   GP +YI + DPE+EK+ELEK   QI              
Sbjct: 287 NSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIRERRKRQQKEIET 346

Query: 307 XXNA--GDSPEPQFNIQKNLSKRHNLDEYEYDDGFVA 341
             NA  G +   +F      S+    +EYE DDGF+ 
Sbjct: 347 RENAENGFAETGEFKRGNTPSRSSRQNEYE-DDGFLV 382

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  296 bits (759), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 187/268 (69%), Gaps = 8/268 (2%)

Query: 32  ESEEENQQQSLDEQQNDSDDSSAGTSHHR---VIDDEEDEEQAMYNRKFLXXXXXXXXXX 88
           E E  N+    D   N  ++S+    HHR    +DD+E EEQAMY RKF           
Sbjct: 67  EKESGNENIKSDNSGNSDEESANHRDHHRESLGLDDDEAEEQAMYTRKFYGEDANDFSDQ 126

Query: 89  XXXXXX-XXXXXXIVKHVVPYKTAN---GADDKTIYYAKVPQFLTIDPVPFDPPSFQKKV 144
                        +V+H++P K AN    A    I+YA++P FLTIDP+PFDPPSF+ KV
Sbjct: 127 DEATHTFKEENVELVRHIIPSK-ANVNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKV 185

Query: 145 EDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGTFSLKVGDEY 204
            +R +   SKEDQL DRLI+ENT+RWRYSRD D+ VFKESN QIV+WSDG++SLKVG+EY
Sbjct: 186 NERANNSISKEDQLDDRLIDENTVRWRYSRDNDQHVFKESNTQIVQWSDGSYSLKVGEEY 245

Query: 205 TDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSKAVARRDER 264
           TDILVN+T NT+LTVSH++QEL+QC EGGEI K++MF+PTST+SK+H+ LSKAV R+++R
Sbjct: 246 TDILVNDTSNTFLTVSHDQQELMQCYEGGEIKKTLMFIPTSTSSKIHQKLSKAVVRKNQR 305

Query: 265 GQHGPNTYITRTDPELEKRELEKKHDQI 292
              GP TYI   DPE+EKRELEKK  QI
Sbjct: 306 QNQGPGTYIINMDPEVEKRELEKKQSQI 333

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 28/39 (71%), Gaps = 6/39 (15%)

Query: 385 RLREVKQTGAQEYQEDA------QAKKRKIAVLDDEDDE 417
           RLR +K+ GA  Y+E+       ++K+R++AV++D++DE
Sbjct: 414 RLRNLKREGAAMYKEEGGDDDSNESKRRRVAVIEDDEDE 452

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  296 bits (757), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 144/243 (59%), Positives = 178/243 (73%), Gaps = 8/243 (3%)

Query: 57  SHHR---VIDDEEDEEQAMYNRKFLXXXXXXXXXXXXXXXX-XXXXXXIVKHVVPYKTAN 112
           S HR    +DD+E EEQAMY RKF                        +V+H++P K AN
Sbjct: 100 SRHRESLGLDDDEAEEQAMYTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSK-AN 158

Query: 113 ---GADDKTIYYAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIR 169
               A    I+YA++P FLTIDP+PFDPPSF+ KV +R S  +S+EDQL DRLI+ENT+R
Sbjct: 159 VNETASHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVR 218

Query: 170 WRYSRDKDERVFKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQC 229
           WRYSRDKD+ VFKESN QIV+WSDGT+SLKVG+E TDILVN+T NT+LTVSH++QELIQC
Sbjct: 219 WRYSRDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQC 278

Query: 230 VEGGEITKSMMFVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEKKH 289
            EGGEI K++MF+PTSTNSK+H+ LSKAV RR++R   GP TYI   DPE+EK+ELE+K 
Sbjct: 279 YEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELERKQ 338

Query: 290 DQI 292
            QI
Sbjct: 339 SQI 341

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  283 bits (725), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 135/230 (58%), Positives = 169/230 (73%), Gaps = 6/230 (2%)

Query: 67  DEEQAMYNRKFLXXXXXXXXXXXXXXXXXXXXXXIVKHVVPYKT----ANGADDKTIYYA 122
           DEE+ MYNRKF                       +VKH+VPYK     A G +D  IY A
Sbjct: 97  DEEEEMYNRKFYGEDVDMSDTEQAEHEFKEANVELVKHIVPYKLVPDDAIGTND--IYVA 154

Query: 123 KVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFK 182
           KVP FL IDP PFDP SF+ KV DR+    SKED+LGDRLI+ENT+RWRYSRD ++ VFK
Sbjct: 155 KVPPFLMIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRDTNQSVFK 214

Query: 183 ESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFV 242
           ESN QIV+WSDG++SLK+G+EYTDIL+N+T+NT+LTVSH++QEL+QCVEGG + K++MF+
Sbjct: 215 ESNTQIVQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLVNKTLMFI 274

Query: 243 PTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEKKHDQI 292
           PTST+SK+H+ LSKAVARR+     GP TYI   DPE+EK+ELE+K  QI
Sbjct: 275 PTSTSSKIHQKLSKAVARRNVMQSAGPGTYIVSVDPEIEKKELERKQGQI 324

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  281 bits (719), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 176/389 (45%), Positives = 226/389 (58%), Gaps = 33/389 (8%)

Query: 48  DSDDSSAG-TSHHR---VIDDEEDEEQAMYNRKFLXXXXXXXXXXXXXXXX-XXXXXXIV 102
           DSDD      S HR    +DD+E EEQAMY RKF                        IV
Sbjct: 112 DSDDEGVDHRSRHRESLGLDDDEAEEQAMYTRKFYGEDANDYSDQDEAAHTFKEENIEIV 171

Query: 103 KHVVPYKTAN---GADDKTIYYAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLG 159
           +H++P K AN    A    I+YA++P FLTID VPFDPPSF+ KV +R    +SKEDQL 
Sbjct: 172 RHIIPNK-ANVNETASHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLD 230

Query: 160 DRLIEENTIRWRYSRDKDERVFKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTV 219
           DRLI+ENT+RWRYSRDKD+ VFKESN QIV+WSDG++SLKVG+E TDILVN+T NT+LTV
Sbjct: 231 DRLIDENTVRWRYSRDKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTV 290

Query: 220 SHEEQELIQCVEGGEITKSMMFVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPE 279
           SH++QELIQC EGGEI K++MF+PTSTNSK+H+ LSKAV RR++R   GP TYI   DPE
Sbjct: 291 SHDQQELIQCYEGGEIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPE 350

Query: 280 LEKRELEKKHDQIXXXXXXXXXXXXXXXXNAGDSPEPQFNIQKN-----LSKRHNLDEYE 334
           +EK+ELEKK  Q+                +   + E  F  Q +     +S+R+   EYE
Sbjct: 351 VEKKELEKKQSQVLRDRRRRQLKEREKQESPDAAFETGFRKQSSPTSYGISRRN---EYE 407

Query: 335 YDDGFVAQXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXXXXXXXNAKRLREVKQTGA 394
            DD  V                                         NA RLR +K+ GA
Sbjct: 408 EDDFLV----------DDDEEEEAGFDDGDDEEEEEEEEEEEEADQENAARLRNLKREGA 457

Query: 395 QEYQEDA------QAKKRKIAVLDDEDDE 417
             Y+E+       + K+R++AV++D++DE
Sbjct: 458 AMYKEEEKDDDSNETKRRRVAVIEDDEDE 486

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  266 bits (680), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 164/378 (43%), Positives = 217/378 (57%), Gaps = 34/378 (8%)

Query: 62  IDDEEDEEQAMYNRKFLXXXXXXXXXXXXXXXX-XXXXXXIVKHVVPYKTA-----NGAD 115
           +D++EDEE AMY RKF                        +V+H+VPYK       N  D
Sbjct: 104 MDEDEDEEHAMYTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKD 163

Query: 116 DKT----IYYAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWR 171
           D T     YYA++P FLTIDPVPFDPP F+ +V++R+   ++ +D++GDRLI+ENTIRWR
Sbjct: 164 DATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWR 223

Query: 172 YSRDKDERVFKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVE 231
           YSRD ++ VFKESNAQI++WSDG++SLK+GD+YTD+LVN+  NT+LTVSH++QEL+QCV+
Sbjct: 224 YSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVD 283

Query: 232 GGEITKSMMFVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEKKHDQ 291
           GGEI+KS MFVP STNS++H+ LSKA+ARRD+     P + I   DPE+EK+ELEKK  Q
Sbjct: 284 GGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKELEKKQSQ 343

Query: 292 IXXXXXXXXXXXXXXXXNAGDSPE-PQFNIQKNLS-----------KRHNLDEYEYDDGF 339
           I                 A DSP   Q N   + S           +R   DEYE DD F
Sbjct: 344 IFRDRRKRKQREIETEQEALDSPGFSQGNYGSSSSRKRGQTPSYDPRRERADEYEEDD-F 402

Query: 340 VAQXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXXXXXXXNAKRLREVKQTGAQEYQE 399
           +                                         N +RL+  K     E +E
Sbjct: 403 IVDDEGEEDD---------DVEDDVEDEEDEDEEEEEEEEERNLERLKNSKTQNDFEVEE 453

Query: 400 DAQAKKRKIAVLDDEDDE 417
           D  +K+RK+AV+DDEDDE
Sbjct: 454 D--SKRRKVAVIDDEDDE 469

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  261 bits (668), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 163/227 (71%), Gaps = 3/227 (1%)

Query: 55  GTSHHRVIDDEEDEEQAMYNRKFLXXXXXXXXXXXXXXXXXXXXXXIV-KHVVPYKTANG 113
           G      +D++EDEEQAMY RKF                       ++ +HVVP K  + 
Sbjct: 78  GRRRRNYVDEDEDEEQAMYTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSE 137

Query: 114 ADDK--TIYYAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWR 171
            +D   TIYYAKVP FLTIDP+PFDPP+F+  V +R++   SKE+QL DRLI++NTIRWR
Sbjct: 138 ENDADTTIYYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWR 197

Query: 172 YSRDKDERVFKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVE 231
           YSRD ++RVFKESNA IV+WSDG++SLK+GDEYTDIL+N+T+NT+LTVSH++QEL+QCV 
Sbjct: 198 YSRDDNQRVFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVH 257

Query: 232 GGEITKSMMFVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDP 278
           GGEI+KS++FVP ST SK+H+ LSKA+ RR+     GP + I   DP
Sbjct: 258 GGEISKSLLFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDP 304

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 28/40 (70%), Gaps = 6/40 (15%)

Query: 383 AKRLREVKQTGAQEYQEDAQA-----KKRKIAVL-DDEDD 416
           A+RLRE+K+ G   Y +D ++     K+RK+AV+ DDEDD
Sbjct: 418 AERLRELKRQGTAAYNDDEKSGSESPKRRKVAVIEDDEDD 457

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  236 bits (603), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 130/285 (45%), Positives = 186/285 (65%), Gaps = 17/285 (5%)

Query: 25  LDDLFGDESEEE----NQQQSLDEQQNDSD----DSSAGTSHHRVIDDEEDEEQ--AMYN 74
           +DDLFGD+ +EE    N Q  +D+  +D D    +     +     D+  D+EQ  AMY 
Sbjct: 1   MDDLFGDDEDEEAGDKNTQNEIDDDDDDDDDDDDEGFVRKNRRSEYDENSDDEQDKAMYE 60

Query: 75  RKFLXXXX-XXXXXXXXXXXXXXXXXXIVKHVVPYKT--ANGADDK--TIYYAKVPQFLT 129
           +KF                        +V+H+VPYKT  +N   DK   +YYAKVP FL 
Sbjct: 61  KKFYGEDGFNRSDDDDNEYEYKESDIELVRHIVPYKTRPSNKELDKHRELYYAKVPPFLM 120

Query: 130 IDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDE--RVFKESNAQ 187
           +DPVPFD  +F+  V++R+    +++ Q+ DRL +ENTIRWRYSRD ++  +VFK+SNAQ
Sbjct: 121 VDPVPFDSTNFESAVKERIKNSLNEDTQITDRLRDENTIRWRYSRDSNDNDKVFKQSNAQ 180

Query: 188 IVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTN 247
           I++WSDG++SLK+G++YTDIL N T+N +LTVSH++QEL+QC  GGEITK++MF+P+ST 
Sbjct: 181 IIQWSDGSYSLKLGNDYTDILTNETDNIFLTVSHDQQELMQCYNGGEITKTLMFIPSSTK 240

Query: 248 SKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEKKHDQI 292
           SK+H+ L+ AV  RD++   GP   +  TDPE+EK+ LEKK  Q+
Sbjct: 241 SKIHQRLTAAVQNRDKKTTSGPGMMLINTDPEIEKKLLEKKQWQM 285

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 13/46 (28%)

Query: 385 RLREVKQTGAQEYQEDAQA-------------KKRKIAVLDDEDDE 417
           RLR  K+ G QE  ++  A             K+RKIAV+DDEDDE
Sbjct: 383 RLRNAKRQGYQEDDDERDARNEEEQSSSSEVTKRRKIAVIDDEDDE 428

>KLTH0C02992g Chr3 complement(264520..266127) [1608 bp, 535 aa] {ON}
           similar to uniprot|P47113 Saccharomyces cerevisiae
           YJR053W BFA1 Component of the GTPase-activating Bfa1p-
           Bub2p complex involved in multiple cell cycle checkpoint
           pathways that control exit from mitosis
          Length = 535

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 121 YAKVPQFLTIDPVPFDPPSFQKKVEDRV--SKYSSKEDQLGDRLIEENTIRW 170
           +A++P +  I PV F  PS +KK+  +   S+++   DQ G R     T R+
Sbjct: 409 FAEIPDY--IPPVSFSEPSLKKKLPTKRSQSQFAPSRDQCGGRYPSSATTRY 458

>NCAS0G02300 Chr7 (408571..409845) [1275 bp, 424 aa] {ON} Anc_2.130
           YNL136W
          Length = 424

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 9/95 (9%)

Query: 196 FSLKVGDEYTDILVNNTENTYLTVSHEEQE---LIQCVEG-----GEITKSMMFVPTSTN 247
           F+L  G EY ++++ N +   ++    EQE    ++ ++G     G I  +     TS  
Sbjct: 150 FALPWG-EYGELILANAKKGAISEGDNEQENEQELKIIQGTPKLEGSIETTAELPTTSEG 208

Query: 248 SKVHKILSKAVARRDERGQHGPNTYITRTDPELEK 282
            +  K LS+ V+  DE+     +T + RT P + K
Sbjct: 209 KETTKELSEVVSTSDEKSSTTSSTELKRTGPRIRK 243

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.129    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,599,425
Number of extensions: 1699028
Number of successful extensions: 18719
Number of sequences better than 10.0: 235
Number of HSP's gapped: 18479
Number of HSP's successfully gapped: 288
Length of query: 417
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 305
Effective length of database: 40,638,807
Effective search space: 12394836135
Effective search space used: 12394836135
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)