Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E02289g5.439ON1261266576e-90
SAKL0G02640g5.439ON1261266031e-81
NDAI0C015805.439ON1261265891e-79
CAGL0I01078g5.439ON1261265873e-79
NCAS0H020705.439ON1261265865e-79
ACL168C5.439ON1261265752e-77
Skud_15.2845.439ON1261265742e-77
Smik_15.2995.439ON1261265743e-77
YOR122C (PFY1)5.439ON1261265743e-77
TDEL0D026205.439ON1261265743e-77
KAFR0D050405.439ON1261265719e-77
KNAG0B042205.439ON1261265692e-76
Ecym_45105.439ON1261265674e-76
Suva_8.1745.439ON1261265665e-76
Kpol_1062.275.439ON1261265648e-76
TPHA0E017405.439ON1261265552e-74
KLTH0F15950g5.439ON1261265492e-73
TBLA0A065005.439ON1191265292e-70
ZYRO0F10142g5.439ON1261265274e-70
Kwal_55.214135.439ON58582638e-31
ZYRO0F02574g8.17ON63058680.95
TDEL0C012308.94ON85262643.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E02289g
         (126 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381...   257   6e-90
SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381...   236   1e-81
NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 ...   231   1e-79
CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {...   230   3e-79
NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 ...   230   5e-79
ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 ...   226   2e-77
Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381...   225   2e-77
Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381...   225   3e-77
YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,...   225   3e-77
TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa...   225   3e-77
KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 ...   224   9e-77
KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa...   223   2e-76
Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [38...   223   4e-76
Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 b...   222   5e-76
Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa] ...   221   8e-76
TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa...   218   2e-74
KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 1...   216   2e-73
TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 11...   208   2e-70
ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381...   207   4e-70
Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C ...   105   8e-31
ZYRO0F02574g Chr6 (204383..206275) [1893 bp, 630 aa] {ON} simila...    31   0.95 
TDEL0C01230 Chr3 (210206..212764) [2559 bp, 852 aa] {ON} Anc_8.9...    29   3.0  

>KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  257 bits (657), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY
Sbjct: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  236 bits (603), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 109/126 (86%), Positives = 120/126 (95%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNLL TGK+DK++IYSRAGDA+WA+SGGL LQPAEISEIA+GFDNP+GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LH+Q QKFMLI+ADDRSIYGRH+AEG+V VRTKQTILI HYPPGVQAGEATKIVEQL DY
Sbjct: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  231 bits (589), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 118/126 (93%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNLLATGK+DK+VIYSRAGD+VWA+SGG QLQ  EISEI +GFDNP+GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSRAGDSVWATSGGFQLQANEISEICQGFDNPAGLQSNG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LH+QGQKFML++ADDRSIYGRH+AEG+V VRTKQT+L+ HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {ON}
           highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122c PFY1 profilin
          Length = 126

 Score =  230 bits (587), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (93%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNLLATGK+DK+VIYS+AGDAVWA+SGGL LQ  EISEI +GFDNP+GLQSNG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LH+QGQKFML++ADDRSIYGRH+AEG+V VRTKQT+LI HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  230 bits (586), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 119/126 (94%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQA TDNLLATGK+D++V+YSRAGD+VWA+SGGLQLQP EI+EIARGFDNP+GLQSNG
Sbjct: 1   MSWQACTDNLLATGKVDRAVLYSRAGDSVWATSGGLQLQPNEIAEIARGFDNPAGLQSNG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LHVQGQKFML++ADD+SIYGRH+AEGIV VRT QTILI HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHVQGQKFMLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV+Y
Sbjct: 121 LISVKY 126

>ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YOR122C (PFY1); 1-intron
          Length = 126

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNLLATGK+DK+ IYSRAGD +WASSGGL L+P+EI EI++GFDN +GLQ+NG
Sbjct: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LH+QGQKFML++AD+RSIYGRHEAEG+V VRTKQTILI HYP GVQAGEATKIVEQL DY
Sbjct: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  225 bits (574), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNL+ TGK+DK+VIYSRAGDA+WA+SGGL LQP EISE+ +GFDNP+GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAIWATSGGLSLQPNEISEVVQGFDNPAGLQSNG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LH+QGQKFML++ADDRSIYGRH+AEG++ VRTKQT++I HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIISHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  225 bits (574), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNL+ TGK+DK+VIYSRAGDAVWA+SGGL LQP EI EI +GFDNP+GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LH+QGQKFML++ADDRSIYGRH+AEG+V VRTKQT++I HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,
           126 aa] {ON}  PFY1Profilin, binds actin,
           phosphatidylinositol 4,5-bisphosphate, and polyproline
           regions; involved in cytoskeleton organization; required
           for normal timing of actin polymerization in response to
           thermal stress
          Length = 126

 Score =  225 bits (574), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNL+ TGK+DK+VIYSRAGDAVWA+SGGL LQP EI EI +GFDNP+GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LH+QGQKFML++ADDRSIYGRH+AEG+V VRTKQT++I HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  225 bits (574), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNLL TGK+DK+VIYSRAGD++WASSGGL LQ  EI EIA+GFD+P GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LH+QGQKFML++ADDRSIYGRH+AEG+V VRTKQTILI HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  224 bits (571), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNLLAT K+D++VIYSRAGDA WA+SGG+ LQP EI+EIA+GFDN +GLQSNG
Sbjct: 1   MSWQAYTDNLLATNKVDRAVIYSRAGDAAWATSGGMALQPNEIAEIAQGFDNAAGLQSNG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LH+QGQKFML++ADDRSIYGRH+AEG+V VRTKQTI+I HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  223 bits (569), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNLL TGK+DK+VIYSRAGD+VWA+SGGL LQP EIS I  GFDN +GLQSNG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LHVQGQKFM ++ADDRSIYGRH+AEG++ VRTKQTIL+ HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [381
           bp, 126 aa] {ON} similar to Ashbya gossypii ACL168C
           1-intron
          Length = 126

 Score =  223 bits (567), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNL+ATGK+DK++IYSRAGD +WASSGG+ L+  EISEI++GFDN  GLQSNG
Sbjct: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LH+Q QKFML++ADDRSIYGRHEAEGI+ VRTKQTILI HYP GVQAGEATKIVEQL DY
Sbjct: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 bp,
           126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  222 bits (566), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNL+ TGK+DK+VI+SRAGDA+WA+SGGL LQP EI EI +GFDNP GLQSNG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIFSRAGDAIWATSGGLSLQPNEIGEIVQGFDNPGGLQSNG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LH+QGQKFML++ADDRSIYGRH+AEG++ VRTKQT++I HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa]
           {ON} (61009..61021,61207..61574) [381 nt, 127 aa]
          Length = 126

 Score =  221 bits (564), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 104/126 (82%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNLLATGKIDK+V+YSRAGDAVWASSGGL L   EIS IA+GFD+PS LQSNG
Sbjct: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LH+QGQKFM+++ADDRSIYGRH+AEG+V VRTKQTIL+ HYP  VQAGEATKIVEQL DY
Sbjct: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  218 bits (555), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 99/126 (78%), Positives = 113/126 (89%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNLLATGK+DK+ +YSRAGDA WA+SGGL L   E +EIA+GFD+PSGLQ+ G
Sbjct: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LH+QGQKFML++ADDRSIYGRH+AEG+V VRTKQTI+I HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 126
           aa] {ON} highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122C PFY1 Profilin actin- and
           phosphatidylinositol 4 5-bisphosphate-binding protein
           plays a role in cytoskeleton organization required for
           normal timing of actin polymerization in response to
           thermal stress localizes to plasma membrane and cytosol
          Length = 126

 Score =  216 bits (549), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 113/126 (89%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYTDNLL TGKIDK+ IYSRAGD++WA+SGGL L   EI EIA+GF+NPSGLQS G
Sbjct: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LH+QGQKFMLI+ADDRSIYGRH+AEG++ VRTKQTIL+ HYP GVQAGEATKIVEQL DY
Sbjct: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV Y
Sbjct: 121 LISVSY 126

>TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 119
           aa] {ON} Anc_5.439 YOR122C
          Length = 119

 Score =  208 bits (529), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 110/126 (87%), Gaps = 7/126 (5%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQA       TGK+DK+VIYSRAGD+VWASSGGLQL   EI+EIARGFDNPSGLQSNG
Sbjct: 1   MSWQA-------TGKVDKAVIYSRAGDSVWASSGGLQLGANEIAEIARGFDNPSGLQSNG 53

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           LHVQ QKFML++ADDRSIYGRH+AEGIV VRTKQTI+I HYPP VQAGEATKIVEQL DY
Sbjct: 54  LHVQSQKFMLLRADDRSIYGRHDAEGIVCVRTKQTIVIAHYPPTVQAGEATKIVEQLADY 113

Query: 121 LISVQY 126
           LI VQY
Sbjct: 114 LIGVQY 119

>ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  207 bits (527), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (84%)

Query: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60
           MSWQAYT+NLL TGKIDK+ IYSRAGD++WASSGGL   P EI +IA GFD PSGLQS G
Sbjct: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60

Query: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120
           L VQGQKFML++ADDRSIY RH+AEG+  VRTKQTI++ HYPP VQAGEATKIVEQL DY
Sbjct: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI  QY
Sbjct: 121 LIGAQY 126

>Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C
           (PFY1) - profilin (actin-binding protein) [contig 130]
           FULL
          Length = 58

 Score =  105 bits (263), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%)

Query: 69  MLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDYLISVQY 126
           MLI+ADDRSIYGRH+AEG+V VRTKQTIL+ HYP GVQAGEATKIVEQL DYLISV Y
Sbjct: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58

>ZYRO0F02574g Chr6 (204383..206275) [1893 bp, 630 aa] {ON} similar
           to uniprot|P43561 Saccharomyces cerevisiae YFL041W
          Length = 630

 Score = 30.8 bits (68), Expect = 0.95,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 27/58 (46%)

Query: 36  LQLQPAEISEIARGFDNPSGLQSNGLHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTK 93
           LQLQ        +G+D P  +   GL    ++F L   D+R +Y  ++ +    VR K
Sbjct: 294 LQLQWTHQVAYDKGYDWPKTIDVGGLENAAEEFYLQPLDNRELYDDYDVQITFDVRMK 351

>TDEL0C01230 Chr3 (210206..212764) [2559 bp, 852 aa] {ON} Anc_8.94
           YFR002W
          Length = 852

 Score = 29.3 bits (64), Expect = 3.0,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 10/62 (16%)

Query: 68  FMLIK---ADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDYLISV 124
           FMLIK   +DD  +Y R+  E        Q I++  Y P   A    +I+   G Y ++V
Sbjct: 440 FMLIKKDESDDDPVYERYSLEDF------QNIIVS-YGPATSANHYLQILIMSGLYELAV 492

Query: 125 QY 126
           QY
Sbjct: 493 QY 494

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,676,921
Number of extensions: 435416
Number of successful extensions: 827
Number of sequences better than 10.0: 24
Number of HSP's gapped: 827
Number of HSP's successfully gapped: 24
Length of query: 126
Length of database: 53,481,399
Length adjustment: 95
Effective length of query: 31
Effective length of database: 42,588,129
Effective search space: 1320231999
Effective search space used: 1320231999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)