Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E02267g5.438ON1031035354e-72
Ecym_45095.438ON1031033967e-51
CAGL0A02882g5.438ON1041033881e-49
SAKL0G02618g5.438ON1041043821e-48
ACL169W5.438ON1031033793e-48
Kwal_55.214145.438ON1191033665e-46
NCAS0F034105.438ON1061043491e-43
KLTH0F15972g5.438ON1031033463e-43
TDEL0D026305.438ON1021043463e-43
Kpol_1016.35.438ON971023281e-40
KNAG0C048805.438ON1041043263e-40
ZYRO0F10120g5.438ON1051013231e-39
NDAI0B057005.438ON1041043056e-37
Kpol_1016.3asingletonON971022724e-32
TPHA0C00950singletonON991022448e-28
KAFR0D02490singletonON107941798e-18
TBLA0C05870singletonON1001011701e-16
KAFR0D02400singletonON114881423e-12
KAFR0D02500singletonON112881321e-10
ZYRO0E08228gna 1ON62049632.2
KLTH0F15818gsingletonON9651594.5
KLLA0A08844g4.120ON62172604.9
NDAI0A020907.322ON120046605.2
KNAG0B027207.322ON120445606.8
CAGL0M04653g8.359ON95941589.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E02267g
         (103 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserv...   210   4e-72
Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar ...   157   7e-51
CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly ...   154   1e-49
SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserv...   151   1e-48
ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No h...   150   3e-48
Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {O...   145   5e-46
NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438     139   1e-43
KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa] ...   137   3e-43
TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON...   137   3e-43
Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON} co...   130   1e-40
KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON...   130   3e-40
ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserv...   129   1e-39
NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5....   122   6e-37
Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON} c...   109   4e-32
TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON}                 99   8e-28
KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}      74   8e-18
TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {...    70   1e-16
KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON}                59   3e-12
KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}      55   1e-10
ZYRO0E08228g Chr5 (645342..647204) [1863 bp, 620 aa] {ON} simila...    29   2.2  
KLTH0F15818g Chr6 complement(1287301..1287591) [291 bp, 96 aa] {...    27   4.5  
KLLA0A08844g Chr1 complement(774642..776507) [1866 bp, 621 aa] {...    28   4.9  
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    28   5.2  
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    28   6.8  
CAGL0M04653g Chr13 (505982..508861) [2880 bp, 959 aa] {ON} simil...    27   9.8  

>KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserved
           hypothetical protein
          Length = 103

 Score =  210 bits (535), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVDGKPANFAGSHLT 60
           MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVDGKPANFAGSHLT
Sbjct: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVDGKPANFAGSHLT 60

Query: 61  IVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103
           IVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ
Sbjct: 61  IVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103

>Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii ACL169W
          Length = 103

 Score =  157 bits (396), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 74/103 (71%), Positives = 85/103 (82%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVDGKPANFAGSHLT 60
           MVEW V VYDKPGSDRS  R  HL  IP LV+ GKIV AGAIYKD+VDGKP  FAGSHL 
Sbjct: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLI 60

Query: 61  IVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103
           +VAD+++EVVELLK D++AK  +WD+DN LI+PFGCAVRKEKQ
Sbjct: 61  LVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103

>CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly
           similar to KLLA0E02266g Kluyveromyces lactis
          Length = 104

 Score =  154 bits (388), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 74/103 (71%), Positives = 84/103 (81%), Gaps = 1/103 (0%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVD-GKPANFAGSHL 59
           MVEW VIVYDKPGSDRS CRPQHLAGIPPLVEAGK+V AGAIY +    G    FAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60

Query: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEK 102
            IVAD+K+E +EL+ NDVFAKN IWD++N +IY FGCAVR+ K
Sbjct: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103

>SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score =  151 bits (382), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 87/104 (83%), Gaps = 1/104 (0%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDV-VDGKPANFAGSHL 59
           MVEW V+VYDKP +DRS  RP HLAGIPPLVE GK+V AGAI+ ++  +GKP NFAGS L
Sbjct: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60

Query: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103
           TIVADSK+E + ++KNDVFAK  IWD++N LI+PFGCAVRKEK+
Sbjct: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104

>ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No
           homolog in Saccharomyces cerevisiae
          Length = 103

 Score =  150 bits (379), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 86/103 (83%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVDGKPANFAGSHLT 60
           MVEW  I+YDKPG DRS  R +HLA IP LVE GK+V AGAIYK+VVDG+P+ FAGS LT
Sbjct: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVDGRPSQFAGSQLT 60

Query: 61  IVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103
           +VADS++E + ++++D FAK+ +WDV+N ++YPFGCAVRKEKQ
Sbjct: 61  LVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103

>Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {ON}
           [contig 130] FULL
          Length = 119

 Score =  145 bits (366), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 71/103 (68%), Positives = 84/103 (81%), Gaps = 1/103 (0%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVV-DGKPANFAGSHL 59
           MVEW VIVYDK GSDRS  RP HL GIP LVE GK+V AGAIY+DV  +GK +NFAGSHL
Sbjct: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75

Query: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEK 102
            IVAD+K+E +E++K DVFAK  IWD++N +IYPFGCAVR+ K
Sbjct: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118

>NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438
          Length = 106

 Score =  139 bits (349), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (76%), Gaps = 1/104 (0%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKD-VVDGKPANFAGSHL 59
           MVEW VIVYDKPGSDRSA RPQHLA IP LVE GK+V AGAIY +   +G+   FAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60

Query: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103
            I+AD+K+E + ++ ND+FAK  IWD DN +IY FGCAVR+ K 
Sbjct: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKS 104

>KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa]
           {ON} conserved hypothetical protein
          Length = 103

 Score =  137 bits (346), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 81/103 (78%), Gaps = 1/103 (0%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVV-DGKPANFAGSHL 59
           MVEW VIV+DK GSDRSACRP HL G+    E G +V AGAIY +V  DGKP NFAGSHL
Sbjct: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60

Query: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEK 102
            I A++K++ ++++KND+FAK  IWD++N +IYPFGCAVR+ K
Sbjct: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103

>TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON}
           Anc_5.438
          Length = 102

 Score =  137 bits (346), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (77%), Gaps = 3/104 (2%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKD-VVDGKPANFAGSHL 59
           MVEWVVIVYDK   DRSA RP HLAGIPPLVE GK+V AGAIY +    G    FAGSHL
Sbjct: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58

Query: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103
            IVAD+K+E +E++K D+FAK  +WD+DN +IY FGCAVRKEK+
Sbjct: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102

>Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON}
           complement(6319..6612) [294 nt, 98 aa]
          Length = 97

 Score =  130 bits (328), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 66/102 (64%), Positives = 79/102 (77%), Gaps = 5/102 (4%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVDGKPANFAGSHLT 60
           MVEW VI+ DK GSDRS  RPQHLAGIPPLVE GK+  AGAIY D  DG   +FAGSHL 
Sbjct: 1   MVEWCVIINDKKGSDRSELRPQHLAGIPPLVEQGKLKCAGAIYND--DG---SFAGSHLQ 55

Query: 61  IVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEK 102
           IVAD+K++ +E++K DVFA   IWD+D+ +IY FGCAVR+ K
Sbjct: 56  IVADTKEQALEVVKGDVFATGGIWDLDSIIIYKFGCAVRQPK 97

>KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON}
           Anc_5.438
          Length = 104

 Score =  130 bits (326), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 62/104 (59%), Positives = 77/104 (74%), Gaps = 1/104 (0%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKD-VVDGKPANFAGSHL 59
           MVEW  +VYDKPGSDRS  RP+HLA IP LV+ GK+V AGAIY +    G    FAGSHL
Sbjct: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60

Query: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103
            IVAD+K+E +E++  DVFAK  IWD+ N ++Y FGCAVR+ K+
Sbjct: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104

>ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserved
           hypothetical protein
          Length = 105

 Score =  129 bits (323), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 81/101 (80%), Gaps = 3/101 (2%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKD-VVDGKPANFAGSHL 59
           MVEWVVI +DK  +DRSA R +HLAGIPP VE+GK+V AGAIY +    G+P  FAGSHL
Sbjct: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58

Query: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRK 100
            +VAD+K+E +E++K+D+FAK  +WD+DN ++Y FGCA+R+
Sbjct: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQ 99

>NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5.438
          Length = 104

 Score =  122 bits (305), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 62/104 (59%), Positives = 75/104 (72%), Gaps = 1/104 (0%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKD-VVDGKPANFAGSHL 59
           MVEW VI+ DK GSDRSA   QH AGIP LVE GK+V  GAIY +   +G     AGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60

Query: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103
            +VAD+K+EV+EL+K D+FAK  IWDVDNA+IY F  A+R  K+
Sbjct: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104

>Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON}
           complement(7088..7381) [294 nt, 98 aa]
          Length = 97

 Score =  109 bits (272), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 55/102 (53%), Positives = 70/102 (68%), Gaps = 5/102 (4%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVDGKPANFAGSHLT 60
           M EW +I+ DK GS+RS    QH AGI PLVE G +   GAIY D  DG   + AGSHL 
Sbjct: 1   MSEWCIIINDKKGSNRSELLSQHFAGISPLVEQGILTCGGAIYND--DG---SVAGSHLQ 55

Query: 61  IVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEK 102
           IVAD+K++ +E++K DVFA   IWD+D+ +IY F CAVR+ K
Sbjct: 56  IVADTKEQALEVVKGDVFATGGIWDLDSIVIYKFACAVRQPK 97

>TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON} 
          Length = 99

 Score = 98.6 bits (244), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 73/102 (71%), Gaps = 7/102 (6%)

Query: 1   MVEWVVIVYDKPGSD--RSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVDGKPANFAGSH 58
           M E+VV++ D  G++  R    P+H   IPPLV+AG +V  GA++ +  +G P    GSH
Sbjct: 1   MSEYVVVIKDHAGAEKLREQHGPEHFGNIPPLVDAGIVVCGGAMFNE--EGSPV---GSH 55

Query: 59  LTIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRK 100
           + IVADS+++V+E+LK DVFA+ ++WD+++A+IY F CAVRK
Sbjct: 56  IQIVADSREQVLEMLKKDVFARENVWDLESAIIYKFDCAVRK 97

>KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}
          
          Length = 107

 Score = 73.6 bits (179), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 60/94 (63%), Gaps = 5/94 (5%)

Query: 1  MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVDGKPANFAGSHLT 60
          M EW+V V DKP +DR+    +HLA +P L E   +V AGA+  D  +GK     GS   
Sbjct: 1  MPEWIVNVQDKPEADRAPYNDRHLAALPGLFEKKVLVSAGALIGD--NGKE---VGSSFQ 55

Query: 61 IVADSKDEVVELLKNDVFAKNDIWDVDNALIYPF 94
          +VA+SK++ + ++KND+FAK  ++++D+ + Y F
Sbjct: 56 VVAESKEDAINVIKNDIFAKEGVYNLDSFVCYRF 89

>TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {ON}
           
          Length = 100

 Score = 70.1 bits (170), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVDGKPANFAGSHLT 60
           M EW V + D P SDR+    +H+  +P L+ AG +   GA+  D       N  GSH  
Sbjct: 1   MTEWYVTIKDIPNSDRTPVLKEHMDRLPILINAGVLSCGGALLDD-----NGNMIGSHFE 55

Query: 61  IVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKE 101
           +  ++K+E ++L+  D F K  +WD+++  I  F C  R+E
Sbjct: 56  LKVETKEEAMKLINEDPFVKGGVWDMNSIQIRKFYCVHREE 96

>KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON} 
          Length = 114

 Score = 59.3 bits (142), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 52/88 (59%), Gaps = 5/88 (5%)

Query: 1  MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVDGKPANFAGSHLT 60
          M EW+V V D    DR+   P+H+  +P LV+ G IV AGA+     +GK     G    
Sbjct: 1  MPEWLVKVKDNKDVDRAPYYPEHMRDLPSLVDGGIIVVAGAL--TTPEGKE---IGGMFI 55

Query: 61 IVADSKDEVVELLKNDVFAKNDIWDVDN 88
          + A +K+E +E++K DVFA+  I+++D+
Sbjct: 56 VTAKTKEEAIEIVKRDVFARKGIFNMDS 83

>KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}
          
          Length = 112

 Score = 55.5 bits (132), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 50/88 (56%), Gaps = 5/88 (5%)

Query: 1  MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVDGKPANFAGSHLT 60
          M EW+V + D  G+DR+   P+H+  +  L +   +V AGA+     +GK     G  L 
Sbjct: 1  MPEWLVKIEDIEGADRTPYYPEHMQNLKNLFDEKILVGAGAL--TTPEGKE---TGGILI 55

Query: 61 IVADSKDEVVELLKNDVFAKNDIWDVDN 88
          I A +K+E +E++K DVFA+  I+ +D 
Sbjct: 56 IAAKTKEEAIEVVKRDVFARKGIFKMDT 83

>ZYRO0E08228g Chr5 (645342..647204) [1863 bp, 620 aa] {ON} similar
           to uniprot|P39709 Saccharomyces cerevisiae YAL067C SEO1
           Putative permease member of the allantoate transporter
           subfamily of the major facilitator superfamily mutation
           confers resistance to ethionine sulfoxide
          Length = 620

 Score = 28.9 bits (63), Expect = 2.2,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 5/49 (10%)

Query: 26  GIPPLVEAGKIVHAGAIYKDVVD--GKPANFAGSHLTIVADSKDEVVEL 72
           G+PP  E  ++   G IY D  +    PA   G H+ IV D  D+++ +
Sbjct: 575 GVPPKEERQQL---GNIYHDDQERSSSPAEAEGEHVHIVGDKGDKIINI 620

>KLTH0F15818g Chr6 complement(1287301..1287591) [291 bp, 96 aa]
          {ON} no similarity
          Length = 96

 Score = 27.3 bits (59), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 25/51 (49%)

Query: 29 PLVEAGKIVHAGAIYKDVVDGKPANFAGSHLTIVADSKDEVVELLKNDVFA 79
          P V+  K+ H   IYK++       +   H  I+ + + EV ++LK   F+
Sbjct: 19 PKVKVVKLSHKNEIYKEIFPYDFVRYYNRHYIIINEGEVEVKDMLKPYSFS 69

>KLLA0A08844g Chr1 complement(774642..776507) [1866 bp, 621 aa] {ON}
           similar to uniprot|P22336 Saccharomyces cerevisiae
           YAR007C RFA1 Subunit of heterotrimeric Replication
           Factor A (RF-A) which is a highly conserved
           single-stranded DNA binding protein involved in DNA
           replication repair and recombination
          Length = 621

 Score = 27.7 bits (60), Expect = 4.9,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 13/72 (18%)

Query: 40  GAIYKDVVDGKPANFAGSHLTIVADSKDEVVELLKND--------VFAKNDIWDVDNALI 91
           G IY+ V   K    A  +L ++ D K  V  LL+N            + D++ V NA  
Sbjct: 25  GGIYQVVQTKKTETNAKKNLILINDGKYHVKALLRNKAAEAAQQAELERGDVFKVLNA-- 82

Query: 92  YPFGCAVRKEKQ 103
               CAV KEK+
Sbjct: 83  ---ECAVIKEKK 91

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 27.7 bits (60), Expect = 5.2,   Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 21/46 (45%)

Query: 47  VDGKPANFAGSHLTIVADSKDEVVELLKNDVFAKNDIWDVDNALIY 92
           +DG+       H   +A+ K E+V  +   +  K+  WD    LIY
Sbjct: 502 LDGQHVALMSKHTITIANKKLELVNSMHETIRIKSAAWDESGVLIY 547

>KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1204

 Score = 27.7 bits (60), Expect = 6.8,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 20/45 (44%)

Query: 48  DGKPANFAGSHLTIVADSKDEVVELLKNDVFAKNDIWDVDNALIY 92
           DG+       H   +A  + E+V  +   +  K+  WD  N LIY
Sbjct: 502 DGQYVALMSKHTITIATRRLEMVNSMHETIRIKSAAWDESNVLIY 546

>CAGL0M04653g Chr13 (505982..508861) [2880 bp, 959 aa] {ON} similar
           to uniprot|P27801 Saccharomyces cerevisiae YLR148w PEP3
           vacuolar membrane protein
          Length = 959

 Score = 26.9 bits (58), Expect = 9.8,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 18/41 (43%)

Query: 58  HLTIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAV 98
           H+ I+ +S   +V  L N V     IW  DN  I  F   V
Sbjct: 302 HILILRESSITIVNQLDNSVIYNQSIWSNDNEHILGFASDV 342

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,644,658
Number of extensions: 445379
Number of successful extensions: 1050
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1032
Number of HSP's successfully gapped: 27
Length of query: 103
Length of database: 53,481,399
Length adjustment: 74
Effective length of query: 29
Effective length of database: 44,996,115
Effective search space: 1304887335
Effective search space used: 1304887335
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)