Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E02245g5.437ON40340320720.0
SAKL0G02596g5.437ON4003565709e-69
TDEL0B021805.437ON4183615065e-59
Kwal_55.214155.437ON3893314722e-54
KLTH0F15994g5.437ON3903384541e-51
AER404C5.437ON3863634076e-45
KAFR0E038205.437ON3963693991e-43
ZYRO0F10098g5.437ON3732843919e-43
NCAS0F034005.437ON4153023677e-39
NDAI0B056905.437ON4233443633e-38
Kpol_1016.45.437ON4134053562e-37
Suva_2.5425.437ON4423713432e-35
TBLA0A028005.437ON4533013415e-35
Skud_4.6395.437ON4423643274e-33
CAGL0A02860g5.437ON4022833193e-32
TPHA0J026005.437ON4413043213e-32
Smik_4.6365.437ON4463203196e-32
YDR370C5.437ON4423873152e-31
KNAG0C048905.437ON4052742438e-22
KLLA0E12893g3.570ON384303880.023
Skud_7.213.570ON389237810.16
Smik_7.153.570ON387233810.17
AFR262CsingletonON775193800.27
NDAI0I032603.570ON377119750.84
YGL246C (RAI1)3.570ON387235750.89
CAGL0C01925g3.570ON400234750.97
KNAG0H035902.135ON70946722.2
SAKL0F00726g3.570ON383203694.7
Suva_7.153.570ON389229685.8
NCAS0E002403.570ON38066686.5
Ecym_32604.258ON650174678.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E02245g
         (403 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   802   0.0  
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   224   9e-69
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   199   5e-59
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   186   2e-54
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   179   1e-51
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   161   6e-45
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   158   1e-43
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   155   9e-43
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   145   7e-39
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   144   3e-38
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   141   2e-37
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   136   2e-35
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   135   5e-35
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   130   4e-33
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   127   3e-32
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   128   3e-32
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   127   6e-32
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   125   2e-31
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...    98   8e-22
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    39   0.023
Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON} Y...    36   0.16 
Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON} Y...    36   0.17 
AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON} S...    35   0.27 
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     33   0.84 
YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}  RA...    33   0.89 
CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {...    33   0.97 
KNAG0H03590 Chr8 (670845..672974) [2130 bp, 709 aa] {ON} Anc_2.1...    32   2.2  
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    31   4.7  
Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON} Y...    31   5.8  
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    31   6.5  
Ecym_3260 Chr3 (498431..500383) [1953 bp, 650 aa] {ON} similar t...    30   8.8  

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/403 (97%), Positives = 391/403 (97%)

Query: 1   MTTVSCDKDENKVDQLGESLSQLRISTRKNNKPSQKKGSLVLSCKKFPHVSVNYVVDKTP 60
           MTTVSCDKDENKVDQLGESLSQLRISTRKNNKPSQKKGSLVLSCKKFPHVSVNYVVDKTP
Sbjct: 1   MTTVSCDKDENKVDQLGESLSQLRISTRKNNKPSQKKGSLVLSCKKFPHVSVNYVVDKTP 60

Query: 61  KLLTDCKEVHNCSYIINDATLLWNEASRKPRLRPEVCTYIKDSKWENKAVKDSFIGIDLT 120
           KLLTDCKEVHNCSYIINDATLLWNEASRKPRLRPEVCTYIKDSKWENKAVKDSFIGIDLT
Sbjct: 61  KLLTDCKEVHNCSYIINDATLLWNEASRKPRLRPEVCTYIKDSKWENKAVKDSFIGIDLT 120

Query: 121 KGYDDYVPLDRNVLNSLVILKEAYQRYEKTLNPEKTTFVSLRHHIIDIIMCPFLDEPLSL 180
           KGYDDYVPLDRNVLNSLVILKEAYQRYEKTLNPEKTTFVSLRHHIIDIIMCPFLDEPLSL
Sbjct: 121 KGYDDYVPLDRNVLNSLVILKEAYQRYEKTLNPEKTTFVSLRHHIIDIIMCPFLDEPLSL 180

Query: 181 LMTVQPDKNILISVDKSKDKPNGIHETRNSFNKKICYTGFALEDLLIESPTEGHILEHEL 240
           LMTVQPDKNILISVDKSKDKPNGIHETRNSFNKKICYTGFALEDLLIESPTEGHILEHEL
Sbjct: 181 LMTVQPDKNILISVDKSKDKPNGIHETRNSFNKKICYTGFALEDLLIESPTEGHILEHEL 240

Query: 241 YYSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNL 300
           YYSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNL
Sbjct: 241 YYSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNL 300

Query: 301 LPKSDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHI 360
           LPKSDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHI
Sbjct: 301 LPKSDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHI 360

Query: 361 FQVLKQNXXXXXXXXXXXXFKVQIDTNLTLSISPASQFVTALG 403
           FQVLKQN            FKVQIDTNLTLSISPASQFVTALG
Sbjct: 361 FQVLKQNLLLLSQESTSTTFKVQIDTNLTLSISPASQFVTALG 403

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  224 bits (570), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 126/356 (35%), Positives = 204/356 (57%), Gaps = 8/356 (2%)

Query: 43  SCKKFPHVSVNYVVDKTPKLLTDCKEVHNCSYIINDATLLWNEASRKPRLRPEVCTYIKD 102
           +CK F H +V++      K   + +E+   + +++    L+++      L+ ++C YI +
Sbjct: 26  NCKGFVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHN 85

Query: 103 SKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYE-----KTLNPEKTT 157
                  +K  ++G DL  G++DY+PL  + LN++  +      +E     K  +  K T
Sbjct: 86  PAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFT 145

Query: 158 FVSLRHHIIDIIMCPFLDEPLSLLMTVQPDKNILISVDKSKDKPNGIHETRNSFNKKICY 217
            VS RHH+ID+IMCPF  E  +L++T   D  ++IS DKSK K +    ++++  +K+CY
Sbjct: 146 IVSNRHHLIDLIMCPFSLEEANLIVT-HLDGLLIISSDKSKPKVDSGIRSKDTRVRKLCY 204

Query: 218 TGFALEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSS 277
           TGF LE+L+ +   +   + H  +YSIV   L + + LL+QAEMDS N  TD Y E+K S
Sbjct: 205 TGFELENLVTKGKVDSPGM-HTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKCS 263

Query: 278 VHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSS 337
           V+F+L N+ HRRKLLRMWIQT L+P++DLL+GFR+ Y N+L+ LK Y   +IY K +  +
Sbjct: 264 VNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTRN 323

Query: 338 IVGKPGKFYKFNPNVANDWFQHIFQVLKQNXXXXXXXXXXXXFKVQIDTNLTLSIS 393
           +  +  K+Y FN  VA  W  H+   + +             FK+ +  +L LS++
Sbjct: 324 L-NENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPLQSFKLTLTRDLQLSLT 378

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  199 bits (506), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 123/361 (34%), Positives = 200/361 (55%), Gaps = 20/361 (5%)

Query: 11  NKVDQLGESLSQLRISTRKNNKPSQKKGSLVLSCKKFPHVSVNYVVDKTPKLLTDCKEVH 70
           NK++ LG   S    S ++  + S K+ ++ +   KF H  ++Y  D T      C+EV 
Sbjct: 20  NKLNSLGLQDSPHGPSKQRRKQQSGKR-TVCIPFSKFEHSDLDYFPDDTADFFEGCEEVA 78

Query: 71  NCSYIINDATLLWNEASRKPRLRPEVCTYIKDSKWENKAVKDS--FIGIDLTKGYDDYVP 128
                  +  L   ++S+KP L P +  +      EN+  K+   +IG DL +G++ Y P
Sbjct: 79  T----YQNGYLFMKDSSKKP-LYPCLQMFAALIA-ENRGPKNKLPYIGCDLYQGHERYKP 132

Query: 129 LDRNVLNSLVILKEAYQRYE-----KTLNPEKTTFVSLRHHIIDIIMCPFLDEPLSLLMT 183
           L  + L+S +   E  +++E     K+ N  K T +S RHH++D++M  F D+ +S++ T
Sbjct: 133 LPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDDEVSIICT 192

Query: 184 VQPDKNILISVDKSKDKPNGIHETRNSFNKKICYTGFALEDLLIESPTEGHILEHELYYS 243
                 ++ S D+SK++ NG++ ++NS  +KICY+GFALED L    T  H      +YS
Sbjct: 193 NIGKGKLIFSGDRSKEERNGLN-SKNSMTRKICYSGFALEDKL----TTSHDERMGPFYS 247

Query: 244 IVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPK 303
           IV G +N+ + LL++ EMD+ N + + YTE+K      + +T HRRKLL+ W+Q  L+P 
Sbjct: 248 IVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPD 307

Query: 304 SDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHIFQV 363
           SDL+IG R++   +LE L  Y    +Y K NN SI  +  K+  FN N+A +W  H  + 
Sbjct: 308 SDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSI-ARNNKYLNFNANIAVEWCFHCIES 366

Query: 364 L 364
           +
Sbjct: 367 I 367

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  186 bits (472), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 113/331 (34%), Positives = 175/331 (52%), Gaps = 17/331 (5%)

Query: 43  SCKKFPHVSVNYVVDKTPKLLTDCKEVHNCSYIINDATLLWNEASRKPRLRPEVCTYIKD 102
           +CK F H  +N           + +EV   +++++    L ++    P L  ++C + + 
Sbjct: 20  NCKNFQHAQINQFPKNVLPFFDEVQEVATITHLLDTDEFLLDDKLGMPELVQDLCEFTES 79

Query: 103 SKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEKT-----LNPEKTT 157
            K  NK     +IG DL   +D+YVP+    L  +  ++   +R+++       +    T
Sbjct: 80  GKLANKG---KYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADFT 136

Query: 158 FVSLRHHIIDIIMCPFLDEPLSLLMTVQPDKNIL-ISVDKSKDKPN-GIHETRNSFNKKI 215
            V  RH++ID+IM PF DE + L   +Q     L +S D    K + GIH       KKI
Sbjct: 137 IVCSRHNLIDLIMMPFSDEDVHL--KIQFSNGYLNLSPDAQYQKTDQGIHSGDTKI-KKI 193

Query: 216 CYTGFALEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIK 275
           CYTGF LE+L+  +           +YS+V G L D I LL++AEMD  N+ T +YTEIK
Sbjct: 194 CYTGFELENLITATSKPD---VRSSFYSLVEGKLGDGIKLLLKAEMDCFNSSTRSYTEIK 250

Query: 276 SSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHKINN 335
            S   K+ +TYHRRKLLRMW+QT+L+P ++LL+G R+ Y ++L   + Y    +Y K NN
Sbjct: 251 CSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNN 310

Query: 336 SSIVGKPGKFYKFNPNVANDWFQHIFQVLKQ 366
             +     K Y +N  ++  WF+H+ Q L Q
Sbjct: 311 QRLTVM-RKNYNYNATISVQWFRHVIQQLCQ 340

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  179 bits (454), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 107/338 (31%), Positives = 176/338 (52%), Gaps = 27/338 (7%)

Query: 41  VLSCKKFPHVSVNYVVDKTPKLLTDCKEVHNCSYIINDATLLWNEASRKPRLRPEVCTYI 100
            +SC+ F   S+++   +      + KE+   ++ I+            P L+ ++  + 
Sbjct: 18  CVSCRGFERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKDLGLFT 77

Query: 101 KDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEKTLNPEKT---- 156
              K    A  +S++G DL + YDD+ PL  N L  +  + E   ++E       +    
Sbjct: 78  ITKKL---AKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSD 134

Query: 157 -TFVSLRHHIIDIIMCPFLDEPLSL-------LMTVQPDKNILISVDKSKDKPNGIHETR 208
            T V  RH++ID+IM PF DE +          + + PDK         + K +GI+ + 
Sbjct: 135 FTIVCSRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQF-------QKKDDGIYSSE 187

Query: 209 NSFNKKICYTGFALEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLT 268
           ++  ++ICYTGF LEDL+ E+           +YS+V G ++  I LL +AEMD  N   
Sbjct: 188 SNI-RRICYTGFELEDLVTETQPGA---PKSAFYSLVQGKISKNIKLLFKAEMDCFNPAK 243

Query: 269 DTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQD 328
            +YTEIK +   K+ + +HRRKLLRMW+QT+L+P +DLLIG R+ Y ++L   + Y  Q+
Sbjct: 244 RSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQE 303

Query: 329 IYHKINNSSIVGKPGKFYKFNPNVANDWFQHIFQVLKQ 366
           +Y K NN ++     K Y +N N++  WF+H+ + L Q
Sbjct: 304 LYQKFNNRNLSLLKKK-YNYNANISVQWFRHLVKRLCQ 340

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  161 bits (407), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 113/363 (31%), Positives = 179/363 (49%), Gaps = 30/363 (8%)

Query: 45  KKFPHVSVNYVV-DKTPKLLTDCKEV-----HNCSYIINDATLLWNEASRKPRLRPEVCT 98
           KKFPH  +     +++ ++ ++ +EV         Y ++D   L       P L  E+C 
Sbjct: 28  KKFPHGPITRRGKERSIRIFSESREVGTAFRQGLVYDLDDKKNL-------PLLNDEICE 80

Query: 99  YIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEKT-----LNP 153
           YI      +K+    ++G DL+   + + P+    L+ L  L +   ++E        + 
Sbjct: 81  YISH---RSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASR 137

Query: 154 EKTTFVSLRHHIIDIIMCPFLDEPLSLLMTVQPDKNILISVDKSKDKPNGIHETRNSFNK 213
            K T VS RHHI+DI+M PF +E   L+ T    + + +       +P GI+ + +S  +
Sbjct: 138 SKFTIVSPRHHILDILMIPFGNERCRLVFTAH--RGLFVITLAPSQRPTGIN-SPSSATR 194

Query: 214 KICYTGFALEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDTYTE 273
           KICYTGF LE LL  + T G   E   +YS +   L  +I +L+Q EMD+ N     YTE
Sbjct: 195 KICYTGFELERLL--TATSG--TERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTE 250

Query: 274 IKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHKI 333
           IKSSV F + N  H  KLL++W QT LLP +D+L+GFR+  ++ L+ +  Y +  I  K+
Sbjct: 251 IKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKL 310

Query: 334 NNSSIVGKPGKFYKFNPNVANDWFQHIFQVL--KQNXXXXXXXXXXXXFKVQIDTNLTLS 391
                      ++ FNP VA DW  +  + +  + +            F V+ID NL + 
Sbjct: 311 YIRDRTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFLVEIDKNLQMK 370

Query: 392 ISP 394
           I P
Sbjct: 371 IRP 373

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  158 bits (399), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 187/369 (50%), Gaps = 25/369 (6%)

Query: 36  KKGSLVLSCKKFPHVSVNYVVDKTPKLLTDCKEVHNCSYIINDATLLW-NEASRK--PRL 92
           +K  +V   K+F H S+ Y  +         +EV   +Y  +D  +   NE S+   P L
Sbjct: 24  QKTPIVSPFKRFQHRSIAYFPNHPANFFQISREV--ATY--HDGRIYEPNETSQDILPLL 79

Query: 93  RPEVCTYIKD-SKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYE--- 148
             ++    +  S  + +  K  +IG DL +G++++  + R  L+S +      +++E   
Sbjct: 80  NKDISKIAQGVSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHH 139

Query: 149 --KTLNPEKTTFVSLRHHIIDIIMCPFLDEPLSLLMTVQPDKNILISVDKSKDKPNGIHE 206
             K    +K T VS RHHI+++IM  F D     ++      N L++  +    P  ++E
Sbjct: 140 HCKYTENKKYTIVSARHHIVNLIMSIF-DTSKETIVNSTYLGNGLLTFSQDTSDPMTMNE 198

Query: 207 ---TRNSFNKKICYTGFALEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDS 263
              T+N   KKICY+GFALEDLL +S       + E  +SI    L+D I LL++ EMD+
Sbjct: 199 GIFTKNKNLKKICYSGFALEDLLTKS-------QKEPLFSITENQLDDNITLLLRCEMDA 251

Query: 264 INTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKA 323
            N LT  YTE+K     K+ +  HR+KLL+ WIQT +LP SDL+ G R+ Y+ EL  ++ 
Sbjct: 252 YNQLTQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEW 311

Query: 324 YKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHIFQVLKQNXXXXXXXXXXXXFKVQ 383
           Y    +Y + NN ++  +  K   FN N+A +W  H  + + +             F+++
Sbjct: 312 YSRDGLYRRFNNRNL-PENKKSLNFNANIAVEWSHHCIKTICELISDNLQGDAPQAFQIK 370

Query: 384 IDTNLTLSI 392
           +DT   +SI
Sbjct: 371 VDTFRNISI 379

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  155 bits (391), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 157/284 (55%), Gaps = 18/284 (6%)

Query: 111 KDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEKTLNPEKTTF--------VSLR 162
           K  F+G DL +G++D++PL   +L+S    +  YQ   K  N   T++        +S R
Sbjct: 77  KRDFLGSDLYQGWEDFLPLSPEILDSS---RGCYQWINKWENDNHTSYSQRSPFVVISPR 133

Query: 163 HHIIDIIMCPFLDEPLSLLMTVQPDKNILISVDKSKDKPNGIHETRNS-FNKKICYTGFA 221
           H+++++ M  F     S+L T   D  I++S     DK +  H +RN+   KKI ++G+A
Sbjct: 134 HYLVELTMQLFQQSKYSILCTHLGDGKIVLS-QVENDKKSHQHTSRNTTMTKKILHSGYA 192

Query: 222 LEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFK 281
           LEDLL    T G  +E + +++I+   L+  I L+++ E+DS N LT+T+TE+K      
Sbjct: 193 LEDLL----TRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYAPLN 248

Query: 282 LGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGK 341
           + N YHR KLL+ WIQ  + P+ DLLIG RN++   L+ L+ +  +++Y KIN+ ++   
Sbjct: 249 MHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNLPKS 308

Query: 342 PGKFYKFNPNVANDWFQHIFQVLKQNXXXXXXXXXXXXFKVQID 385
           P +F  +N ++A  W QH  + + +             FK+ ID
Sbjct: 309 PKRF-NYNADLAVQWCQHCIRSICKLVGENVDRSSPQCFKLTID 351

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  145 bits (367), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 159/302 (52%), Gaps = 29/302 (9%)

Query: 90  PRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSL----VILKEAYQ 145
           P L+ ++    K S  E + +K S++G DL  G++ +VP+    L+SL      +K+  +
Sbjct: 71  PHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWER 130

Query: 146 RYEKTLNP-EKTTFVSLRHHIIDIIMCPFL-------------DEPLSLLMTVQPDKNIL 191
           +      P  K   VS RHHI+++ M  F              D  L+++ T      +L
Sbjct: 131 KASTKYKPGRKFNIVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLL 190

Query: 192 ISVDKSKDKPNGIHE---TRNSFNKKICYTGFALEDLLIESPTE----GHILE--HELYY 242
            + D S +  N ++E   ++N   K+ICY+GFALEDL+ E+ +E    G  L    +  +
Sbjct: 191 FTKDWS-NTGNSMNEGIYSKNIILKRICYSGFALEDLMTETTSELEKEGEKLTGGEKAVF 249

Query: 243 SIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLP 302
           ++V   L+D+I +L++ E+D+ N     +TE+K     K+ N  HRRKLL+ W+QT +LP
Sbjct: 250 AVVENKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLP 309

Query: 303 KSDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHIFQ 362
            SD+LIG R+S   ELE ++ Y    +  KINN ++  +    + FN  VA  W QH  +
Sbjct: 310 DSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRNL-PESKIDWNFNAQVATQWSQHCIR 368

Query: 363 VL 364
            +
Sbjct: 369 SI 370

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  144 bits (363), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 104/344 (30%), Positives = 173/344 (50%), Gaps = 33/344 (9%)

Query: 45  KKFPHVSVNYVVDKTPKLLTDCKEV---HNCSYIINDATLLWNEASRKPRLRPEVCTYIK 101
           K+F H S++             K+V   HN     +D T L       P+L P +     
Sbjct: 42  KQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTNLI------PQLEPAIAKLAN 95

Query: 102 DSKWENKA--VKDSFIGIDLTKGYDDYVPLDRNVLNSL------VILKEAYQRYEKTLNP 153
            S   N+A  +K  ++G DL  GY+ ++P+D + L+S+      +   E   +++  L  
Sbjct: 96  PSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLG- 154

Query: 154 EKTTFVSLRHHIIDIIMCPFLDEPLS---LLMTVQPDKN--ILISVDKSKDKPNGIHETR 208
            K T VS RHHI+++ MC F    +    L +T +   N  +L S D +K    GI+ ++
Sbjct: 155 NKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIY-SK 213

Query: 209 NSFNKKICYTGFALEDLLIESPTEGH--------ILEHELYYSIVHGSLNDEIDLLIQAE 260
           +   +KI Y+GFALEDLL  +  + +        +   +  ++I+   LND+I LL++ E
Sbjct: 214 DGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRCE 273

Query: 261 MDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQ 320
           MDS N +   +TE+K     K+ N  HRRKLL+ W+QT ++P SD+LIG R+    EL  
Sbjct: 274 MDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELND 333

Query: 321 LKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHIFQVL 364
           ++ +   ++Y +INN ++         +N  +A  W QH  + +
Sbjct: 334 IEWFSRMNLYRQINNRNLPEAKLDL-NYNAEIAVQWSQHCIKSI 376

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  141 bits (356), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 119/405 (29%), Positives = 189/405 (46%), Gaps = 30/405 (7%)

Query: 13  VDQLGESLSQLRISTR------KNNKPSQKKGSL-VLSCKKFPHVSVNYVVDKTPKLLTD 65
           ++ +   LS L+I         K NK   KK  + ++   +F H +      KT  L  +
Sbjct: 5   INDVQTQLSNLKIGEDNPSRKVKQNKSRPKKNVINIIPFHRFVHSNARSFPQKTKDLFLE 64

Query: 66  CKEVHNCSYIINDATLLWNEASRKPRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDD 125
            K V   ++   D   +  E +  P L+ ++      S   +K  K  ++G DL    D 
Sbjct: 65  SKTV---AFFQKDQLFINVEDAALPLLKKDIANISGKSVLNSKKYKLPYLGSDLYASTDK 121

Query: 126 YVPLDRNVLNS------LVILKEAYQRYEKTLNPEKTTFVSLRHHIIDIIMCPFLDE--- 176
           Y PL  +VL+S       +   E   R E        T +S RHHI +I+M  F DE   
Sbjct: 122 YGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTILSPRHHITEIVMSLFEDEKNC 181

Query: 177 PLSLLMTVQPDKNILISVDKSKDKPNGIHETRNSFN---KKICYTGFALEDLLIESPTEG 233
            + LL T   +  IL+S D +    N      NS N   +KICY+GFA EDL++E   E 
Sbjct: 182 SVYLLCTYLKNGIILLSKDDASSSSNSNTTGLNSSNPMTRKICYSGFAFEDLVLEDIAEN 241

Query: 234 HILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLR 293
                   +S+V   L + I+LL++ E+D  N +T+ +TE+K     K    +  +++L+
Sbjct: 242 A----RPIFSVVESKLTESINLLLRNELDGYNNVTNMFTELKCFAPLKC--MFSAKEVLK 295

Query: 294 MWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVA 353
            W+QT L+P+SD++IG R++ S  LE L  Y  +D+    NN S+   P  F  FN N+A
Sbjct: 296 TWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNNPSLPPAPSHF-NFNANIA 354

Query: 354 NDWFQHIFQVLKQNXXXXXXXXXXX-XFKVQIDTNLTLSISPASQ 397
            +W +   + +                FK++ID + T+SI   S+
Sbjct: 355 VEWLKFTMESIVSLVSSSIADSNHPCSFKLKIDNHKTISIQKLSR 399

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  136 bits (343), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 110/371 (29%), Positives = 183/371 (49%), Gaps = 31/371 (8%)

Query: 47  FPHVSV-NYVVDKTPKLLTDCKEVHNCSYIINDATLLWNEASRK---PRLRPEVCTYIKD 102
           F H S+ N+     P +  + KEV     +  D  L    A+RK   P L+ ++    + 
Sbjct: 71  FLHTSIRNFPTKPPPDIFYESKEVA----LFTDNQLYV--AARKDVIPNLKEDISHLYES 124

Query: 103 SKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQ--RYEKTLNP----EKT 156
              E + +K  ++G+DL    D+ VP+  + L+++       +  R   +  P    +K 
Sbjct: 125 PLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGKKF 184

Query: 157 TFVSLRHHIIDIIMCPF--LDEPLSLLMTVQPDKNILISVDKSKD---KPNGIHETRNSF 211
           T V+ RHHI+D+ M PF   ++  S++ T   +  I +S +   D      GI+    + 
Sbjct: 185 TVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSGDPNI 244

Query: 212 NKKICYTGFALEDLLIE-SPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDT 270
            KKIC++GF  E+ L E +   G        +SIV G L+++I LL++ EMD+ N ++ T
Sbjct: 245 -KKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVSKT 303

Query: 271 YTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIY 330
            TE+K      + N+ HR+KLL+ WIQT LLP SD+++G R+SYS +L  ++ Y    ++
Sbjct: 304 NTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLF 363

Query: 331 HKINNSSIVGKP--GKFYKFNPNVANDWFQHIFQV---LKQNXXXXXXXXXXXXFKVQID 385
            K N+    G P   K   +N  VA +W +H  +    L +             F++ ID
Sbjct: 364 RKFNHP---GLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINID 420

Query: 386 TNLTLSISPAS 396
            N T+ I+  S
Sbjct: 421 ANGTIIITKLS 431

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  135 bits (341), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 89/301 (29%), Positives = 158/301 (52%), Gaps = 29/301 (9%)

Query: 90  PRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEK 149
           P L+ ++C     S  ++K  K  +IG DL K Y+ Y  +++  L+  +   +  Q Y+K
Sbjct: 89  PCLKDDICQIAGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDK 148

Query: 150 TLNPEKTTF--------VSLRHHIIDIIMCPF---LDEPLSLLMTVQPDKNILISVDKSK 198
               EK  +        ++ RHHI D+++ PF    D  +S+L+T   D  IL+S D + 
Sbjct: 149 KHANEKKKYGMDKEFVIITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAH 208

Query: 199 DKPNGIHETRNSFN--KKICYTGFALEDLLIESPTEGHI---LEHEL---------YYSI 244
           + P+   E +  +N  +KI  +GFA EDL+I+  T   +   LE +          Y+S+
Sbjct: 209 EPPDW-RENKQFYNSMRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSV 267

Query: 245 VHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKS 304
           V   ++ ++ +L+++EMD  N LT++YTE+K      +G+ +HR+KLL+ W+Q   LP S
Sbjct: 268 VENDISPKLTILLRSEMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNS 327

Query: 305 DLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGKPGKFYK-FNPNVANDWFQHIFQV 363
           DLL+G R++ +  L  +  +   D+  K +  S      +F++   P  A+ W+ H+   
Sbjct: 328 DLLVGSRDTQTGLLNDITWFSRDDLVTKCD--SYYSPRLRFHQNTTPTNASAWYYHVLSA 385

Query: 364 L 364
           +
Sbjct: 386 I 386

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  130 bits (327), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 109/364 (29%), Positives = 177/364 (48%), Gaps = 23/364 (6%)

Query: 47  FPHVSVNYVVDKTPK-LLTDCKEVHNCSYIINDATLLWNEASRKPRLRPEVCTYIKDSKW 105
           F H S++ +  K P  +  D KEV   +   N            P LR  +    + S  
Sbjct: 71  FVHTSIHDLSRKPPGDIFQDSKEV---ALFTNYQAYTTARKDLIPSLRDGITELYESSLL 127

Query: 106 ENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSL---VILKEAYQRYEKTLN---PEKTTFV 159
           E +  K  ++G DL    D +VP+  + L+S+   +   E ++      N    +K T V
Sbjct: 128 EARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFTIV 187

Query: 160 SLRHHIIDIIMCPF--LDEPLSLLMTVQPDKNILISVDKSKD---KPNGIHETRNSFNKK 214
           S RHHI+D+ M  F   ++  SL++T      I  S +   D      GI+ +  +  KK
Sbjct: 188 SARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSSDPNM-KK 246

Query: 215 ICYTGFALEDLLIE--SPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDTYT 272
           ICY+GF  E  + E    T+ +  +H ++ S+V   L+++I LL++ E+D+ N ++ T T
Sbjct: 247 ICYSGFEFEHWVTEDIKATDLNGPKHPIF-SVVESKLSEDIGLLMRCEIDAFNPVSRTNT 305

Query: 273 EIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHK 332
           E+K      + N+ HR+KLL+ WIQT LLP SD++IG R+S+S +L  ++ Y    +Y K
Sbjct: 306 ELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLYKK 365

Query: 333 INNSSIVGKPGKFYKFNPNVANDWFQHIFQV---LKQNXXXXXXXXXXXXFKVQIDTNLT 389
            N+  +     K   FN  VA +W  H  +    L +             F+V ID N T
Sbjct: 366 FNHPGLPPS-KKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSIDANGT 424

Query: 390 LSIS 393
           ++I+
Sbjct: 425 IAIT 428

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  127 bits (319), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 84/283 (29%), Positives = 147/283 (51%), Gaps = 13/283 (4%)

Query: 90  PRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEK 149
           P+L+  +    K +  E   +   F+GI L + +D Y P+    L++         +YE 
Sbjct: 87  PQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYEN 146

Query: 150 TLNP---EKTTFV--SLRHHIIDIIMCPFLDE--PLSLLMTVQPDKNILISVDKSKDKPN 202
           +      E   FV  + RHH+ID+ + PF  +   ++LL    P   + IS D + +  +
Sbjct: 147 SHGQKYGEDRDFVIVTARHHMIDLAILPFSRQFTNVNLLCAYTPGNLLEISQDPADNTND 206

Query: 203 GIH-ETRNSFNKKICYTGFALEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEM 261
            +   T N   KKIC++GFALED+L ES  +    E    + IV   + +   LL++ E+
Sbjct: 207 KVGVNTDNPILKKICFSGFALEDILTESANDE---ERNPTFLIVENEIAN-TRLLMRCEI 262

Query: 262 DSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQL 321
           D+ N +T  YTE+K    +  GN  HRRKLL+ WIQT ++P +D++IG R++ S  L+ +
Sbjct: 263 DAYNPITSHYTELKCYAKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDV 322

Query: 322 KAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHIFQVL 364
           + Y    +Y+K+ + S+     +   ++P ++  W++ +   L
Sbjct: 323 RCYNRNLLYNKLISKSLPRCDSEL-NYDPAISVVWYRSLINTL 364

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  128 bits (321), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/304 (31%), Positives = 154/304 (50%), Gaps = 21/304 (6%)

Query: 75  IINDATLLWNEASRKPRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVL 134
           I N+   L NE S  P L  ++    + S  ++K  K  ++G +L    + + P+D  +L
Sbjct: 100 ITNNEAELINE-SNPPFLTKDISNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLL 158

Query: 135 NSLVILKEAYQRYEKTLNPEKT-----TFVSLRHHIIDIIMCPFLDEPLSL-----LMTV 184
           +S V   E Y R  K    +K      TF++ RHH+ +++M  +      L     L T 
Sbjct: 159 DSTVPCFE-YLRTLKISEEDKLYNTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTR 217

Query: 185 QPDKNILISVDKSKD---KPNGIHETRNSFNKKICYTGFALEDLLIESPTEGHILEHELY 241
             D  I+IS D +K+    P   H+ +NSF+KK+  +GF  E+L+IE+  E H    + Y
Sbjct: 218 IKDDLIVISEDLAKENNPSPQN-HKLQNSFSKKVINSGFTFEELVIENFQECH----KPY 272

Query: 242 YSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLL 301
           + I    L  +   +I++EMDS N  T+T+TE+K      LG   HR+KLL+ W QT L 
Sbjct: 273 FYISENRLTPKSTFIIRSEMDSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLS 332

Query: 302 PKSDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHIF 361
           P  D++IG R++ S  LE L  Y  +++Y K+ + S+      F  F P++   W  H  
Sbjct: 333 PNCDIVIGIRDTSSGILEDLLWYSRENMYQKLQDPSLPKFKNSF-DFKPHIGIQWLNHCI 391

Query: 362 QVLK 365
             ++
Sbjct: 392 HAIE 395

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  127 bits (319), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 94/320 (29%), Positives = 160/320 (50%), Gaps = 19/320 (5%)

Query: 90  PRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEK 149
           P L+ ++    + S  + +  K  ++G DL      +VP+  + L+S++      + +  
Sbjct: 112 PNLKGDIAELCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRL 171

Query: 150 TLNPE------KTTFVSLRHHIIDIIMCPF--LDEPLSLLMTVQPDKNILISVDKSKDK- 200
             + E      K T V+ RHHI+D+ M  F   ++  SL+ T      I  S ++  D  
Sbjct: 172 NNHGEDFKIGRKFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSR 231

Query: 201 --PNGIHETRNSFNKKICYTGFALEDLLIESPTEGHILEHEL-YYSIVHGSLNDEIDLLI 257
               GI+ +  +  KKICY+GF  E+ + E      +   +L  +S+V   L++EI LLI
Sbjct: 232 MSKEGIYSSDPNM-KKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLI 290

Query: 258 QAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNE 317
           + EMD+ N ++   TE+K      + N+ HRRKLL+ WIQT L P SD++IG R+S+S +
Sbjct: 291 RCEMDAFNPVSGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQ 350

Query: 318 LEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQH----IFQVLKQNXXXXXX 373
           L  ++ Y    +  K N+S +     +   +N  VA +W  H    I ++L  N      
Sbjct: 351 LLDIQWYSRDSLCMKFNHSGLPSNKREL-NYNAKVAVEWCNHCIKSICELLGAN-ISDYS 408

Query: 374 XXXXXXFKVQIDTNLTLSIS 393
                 F++ ID+N T++I+
Sbjct: 409 CKNPESFEISIDSNNTIAIT 428

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  125 bits (315), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 105/387 (27%), Positives = 183/387 (47%), Gaps = 27/387 (6%)

Query: 26  STRKNNKPSQKKGSLVLSCKKFPHVSVNYVVDKTPK-LLTDCKEVHNCSYIINDATLLWN 84
           S +++N   ++   + +    F H  ++  + K P+ +  + KEV   +   N       
Sbjct: 50  SQQRDNYRKRRPKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEV---ALFTNGRAYTIL 106

Query: 85  EASRKPRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAY 144
                P L+  +    + S  E K  K  ++G DL    D++VP+  + L+S+      +
Sbjct: 107 RKDLIPNLKESIAELYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSV---SPCF 163

Query: 145 QRYEKTL--NP-------EKTTFVSLRHHIIDIIMCPF--LDEPLSLLMTVQPDKNILIS 193
              E  +  NP       +K T V+ RHHI+D+ M  F   +   SL++T      +   
Sbjct: 164 SYIENWILDNPGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFC 223

Query: 194 VDKSKDK---PNGIHETRNSFNKKICYTGFALEDLLIESPTEGHILEHEL-YYSIVHGSL 249
            +  KD      GI+    +  KKICY+GF  E+ + E+     +   +   +S+V   L
Sbjct: 224 RNVKKDSQMSKEGIYSNDPNM-KKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKL 282

Query: 250 NDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIG 309
           ++EI LLI+ EMD+ N +++T TE+K      + N+ HRRKLL+ W+QT LLP SD++IG
Sbjct: 283 SEEIGLLIRCEMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIG 342

Query: 310 FRNSYSNELEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHIFQV---LKQ 366
            R+S+S +L  ++ Y  +D+  K  N   +    K   +N  +A +W  +  +    L +
Sbjct: 343 LRDSHSGQLLDIQWYS-RDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVE 401

Query: 367 NXXXXXXXXXXXXFKVQIDTNLTLSIS 393
                        F++ IDTN  + I+
Sbjct: 402 ANISDYSSTKPESFEIGIDTNNAIVIT 428

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score = 98.2 bits (243), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 128/274 (46%), Gaps = 25/274 (9%)

Query: 106 ENKAVKDSFIGIDLTKGYDDYV-PLDRNVLNSLVILKEAYQRYEKTLNPEKT-------T 157
           ++ + K  ++G+ L  G++DYV  +  ++L+S     +    + +    EK         
Sbjct: 94  KSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKFGESYRHI 153

Query: 158 FVSLRHHIIDIIMCPFL-DEPLSLLMTVQPDKNILISV--DKSKDKPNGIHETRNSFNKK 214
            V  RHH++++ M  F  D    L+ TV   K I++S   D S+   N      +   + 
Sbjct: 154 IVGPRHHLVELTMALFANDSDYKLVCTVLRGKFIVLSQFDDGSQRNRNEGITLSDRRTRM 213

Query: 215 ICYTGFALEDLLIESPTEGHILEHELYYS--IVHGSLNDEIDLLIQAEMDSINTLTDTYT 272
           +CY+GF +    I S   G I     YY   I  G L          EMD+ N + + YT
Sbjct: 214 LCYSGFVI--CKIWSLNRGIIPSQFFYYGTPIRRGHL-----ATFTCEMDAYNQIENHYT 266

Query: 273 EIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHK 332
           E+K      + ++YH+ KLLR W+QT + P +D++IG RN+Y   L+ +     + +Y K
Sbjct: 267 ELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRESLYRK 326

Query: 333 INNSSIVGKPGKFYKFNPN--VANDWFQHIFQVL 364
            NN     +P     FN N  VA +W Q+  + +
Sbjct: 327 FNNKH---QPRAHTNFNYNAQVAVEWSQYAMKAI 357

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 63/303 (20%), Positives = 112/303 (36%), Gaps = 55/303 (18%)

Query: 40  LVLSCKKFPHVSVNYVVDKTPKLLTDCKEVHNCSYIINDATLLWNEASRKPRLRPEVCTY 99
           +VLS   F          K PK L       +  +++ND + L                Y
Sbjct: 1   MVLSSSLFVQKRSTTTALKQPKELGHYSRTQDNGFLVNDDSRL-------------AYYY 47

Query: 100 IKDSKWENKAVKDSFIGIDLTKGYDDY-----VPLDRNVLNSLVILKEAYQRYEKTLNPE 154
           + D+  + K        +DL  G   +        D   L+ L+   E Y+R  +     
Sbjct: 48  LPDTDLDKK--------LDLLSGIKKFKECNTEEFDSTTLHGLLSTLEEYER--RKSKKT 97

Query: 155 KTTFVSLRHHIIDIIMCPFLDE---PLSLLMTVQPDKNILISVDKSKDKPNGIHETRNSF 211
           K   ++ R  I  +I   F      P++  + V  D  + I   K+      I++ R S 
Sbjct: 98  KVDIITFRGIIRKLISSAFDSSQFNPVNFRI-VSFDGQLFIKEVKTDASETSINKNRESL 156

Query: 212 NKKICYTGFALEDLL-------------IESPTEGHILEHELYYSIVHGSLNDEIDLLIQ 258
             +  Y+G+  E L              +E   +  I   + + S+V   +  +  +LI 
Sbjct: 157 QARAYYSGYKFEALATLSLPLPLVPRTTLEKRPKKIINNGDQFISMVRTGIG-KCKILIG 215

Query: 259 AEMDSINTLTDT-------YTEIKSSVHFKLGNTYHR--RKLLRMWIQTNLLPKSDLLIG 309
           AE+D I    +        Y E+K +      +  H+  RKL + W+Q  L+  + ++ G
Sbjct: 216 AEVDCIFDFKEDSDDNLKHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYG 275

Query: 310 FRN 312
           FR+
Sbjct: 276 FRD 278

>Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 52/237 (21%), Positives = 92/237 (38%), Gaps = 52/237 (21%)

Query: 117 IDLTKGYDDYVPL-----DRNVLNSLVILKEAYQRYE-KTLNPEKTTFVSLRHHIIDIIM 170
           +DL+ G+  +        DR  L  L+   E+ +R++ K +N +  TF  +   +I    
Sbjct: 57  LDLSAGFQKFKDYYKDFEDRCSLRGLLETIESSERHKGKKINADIITFRGIARKLIS--- 113

Query: 171 CPFLDEPL-------------SLLMTVQPDKNILISVDKSKDKPNGIHETRNSFNKKICY 217
           C F D P               L +   PD   +I    +   P   H      N    +
Sbjct: 114 CAF-DSPAFNAVNLRIISFNGQLFIKEVPD---VIDATTAASTPGTGHSNDQDLN---AF 166

Query: 218 TGFALEDLL-------------IESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSI 264
           TG+  E L+             IE  T+  +   + Y S+V   + +   L++ AE+D +
Sbjct: 167 TGYKFETLVTLSNPLQYTPREVIEKRTKRIVSHGDEYISVVRTGVGN-CKLILGAEVDCV 225

Query: 265 NTLTDT-------YTEIKSSVHFKLGNTYHR--RKLLRMWIQTNLLPKSDLLIGFRN 312
               +        Y E+K +      +  H+  RKL R W+Q  L+    ++ GF++
Sbjct: 226 FDFKENGKDNLKHYAELKCTQQVMNISDTHKFERKLFRTWLQCFLVGIPRIIYGFKD 282

>Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON}
           YGL246C (REAL)
          Length = 387

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 95/233 (40%), Gaps = 40/233 (17%)

Query: 117 IDLTKGYDDYVPL-----DRNVLNSLVILKEAYQRYE-KTLNPEKTTFVSLRHHIIDIIM 170
           +DL+ G+  +        DR  L  L+   E+ +R++ K +N +  TF  +   +I    
Sbjct: 57  LDLSAGFQKFKDYYNDFEDRCSLRGLLETIESSERHKGKKINADVITFRGIARKLIS--- 113

Query: 171 CPFLDEP---LSLLMTVQPDKNILI---SVDKSKDKPNGIHETRNSFNKKI-CYTGFALE 223
           C F D P      L  V  +  + I   S      K +      N+ N+ +  +TG+  E
Sbjct: 114 CAF-DSPSFNTVNLRVVSFNGQLFIKEVSEAIGASKTSSTVSAGNNINQDLSAFTGYKFE 172

Query: 224 DL-------------LIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDT 270
            L             +IE  T+  +   + Y S+V   +     L++ AE+D I    + 
Sbjct: 173 TLATLSNPLQYTPREVIEKRTKRIVSHGDEYISVVRTGVGS-CKLILGAEVDCIFDFKEN 231

Query: 271 -------YTEIKSSVHFKLGNTYHR--RKLLRMWIQTNLLPKSDLLIGFRNSY 314
                  Y E+K +      +  H+  RKL R W+Q  L+    ++ GF++ +
Sbjct: 232 GRDNLKHYAELKCTKQVMNASDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDH 284

>AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 775

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 79/193 (40%), Gaps = 23/193 (11%)

Query: 137 LVILKEAYQRYEKTLNPEKTTFVSLRHHIIDIIMCPFLDEPLSLLMTVQP-DKNILISVD 195
           L  L E  +R  K +N +    ++ R  +  +I C F      + M V   D  + I   
Sbjct: 492 LQTLMEYERRKSKKVNAD---IIAFRGQVKRLIHCAFGGHATDVDMYVMSFDGQLFIRAA 548

Query: 196 KSK-DKPNGIHETRNSFNKKICYTGFALEDLLI------ESPTE------GHILEHELYY 242
           + K + P      R S+     Y+G+  E + +      E+P E        ++ +   Y
Sbjct: 549 RKKLEFPT---SPRESWAYLAYYSGYKFERMALLDRPVAETPREVLESRGKQVVRNGPQY 605

Query: 243 SIVHGSLNDEIDLLIQAEMDSINTLTD-TYTEIKSSVHFKL--GNTYHRRKLLRMWIQTN 299
             V  +   E  L++ AE+D I    + T   +K  V  K+   N     KL   W+Q  
Sbjct: 606 RTVMRTGVGEHKLVLGAEIDGIIDFREPTGDNLKHYVELKVCQKNRNFSEKLFSSWLQCF 665

Query: 300 LLPKSDLLIGFRN 312
           L+  + ++IGFR+
Sbjct: 666 LVGINRVIIGFRD 678

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 46/119 (38%), Gaps = 23/119 (19%)

Query: 216 CYTGFALEDLLIESPTEGHILEHEL-------------YYSIVHGSLNDEIDLLIQAEMD 262
           CYTG+  E L   S     +    L             Y ++V   +     L++ AE+D
Sbjct: 153 CYTGYKFESLATLSQPLPLVSRTTLEKRPKKISSNGDEYIAVVKTGVGSS-KLVLGAEID 211

Query: 263 SINTLTDT-------YTEIKSSVHFKLGNTYHR--RKLLRMWIQTNLLPKSDLLIGFRN 312
            I    +        Y E+K S         HR  RKL + W+Q  L+    ++ GFR+
Sbjct: 212 CIFDFKEENKDNLRHYAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFRD 270

>YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}
           RAI1Nuclear protein with decapping endonuclease activity
           targeted toward mRNAs with unmethylated
           7-methylguanosine cap structures; binds to and
           stabilizes the exoribonuclease Rat1p; required for
           pre-rRNA processing; homologous to human DOM3Z
          Length = 387

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 99/235 (42%), Gaps = 44/235 (18%)

Query: 117 IDLTKGYDDYVPL-----DRNVLNSLVILKEAYQRYE-KTLNPEKTTFVSLRHHIIDIIM 170
           +DL+ G+  +        DR  L  L+   E+ +R++ K +N +  TF  +   +I    
Sbjct: 57  LDLSSGFQKFKDYYKDFEDRCSLRGLLETIESSERHKGKKINADIITFRGIARKLIS--- 113

Query: 171 CPFLDEP---LSLLMTVQPDKNILI-----SVDKSKDKPNGIHETRNSFNKKI-CYTGFA 221
           C F D P      L  V  +  + I     +V+ +K   +   E   + N+ +  +TG+ 
Sbjct: 114 CAF-DSPSFNTVDLRIVSFNGQLFIKEVPEAVNAAK--ASSATEAGRNINQDLNVFTGYK 170

Query: 222 LEDL-------------LIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLT 268
            E L             +IE  T+  +   + Y S+V   + +   L++ AE+D I    
Sbjct: 171 FETLATLSNPLQYTPREVIEKRTKRIVSHGDEYISVVRTGVGN-CKLILGAEVDCIFDFK 229

Query: 269 DT-------YTEIKSSVHFKLGNTYHR--RKLLRMWIQTNLLPKSDLLIGFRNSY 314
           +        Y E+K +      +  H+  RKL R W+Q  L+    ++ GF++ +
Sbjct: 230 ENGRDNLKHYAELKCTQQVANISDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDH 284

>CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {ON}
           similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246c RAI1
          Length = 400

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 93/234 (39%), Gaps = 39/234 (16%)

Query: 116 GIDLTKGYDDYVPL-----DRNVLNSLV-ILKEAYQRYEKTLNPEKTTFVSLRHHIIDII 169
           GIDL+ G   +  +     DR  L  L+  L E  ++  K  N +  TF  +   +I   
Sbjct: 56  GIDLSAGASKFRDVAKDFKDRCSLKGLLDTLMEYEKKKNKKSNVDIITFRGIMSKLIRAS 115

Query: 170 MCPFLDEPLSLLMTVQPDKNILI---------SVDKSKDKPNGIHETRNSFNKKICYTGF 220
           M P     + L + V  D  + I         + + +    N   +   S  +   YTG+
Sbjct: 116 MEPPNFNKVDLRI-VSYDGQLFIKDVSDYNAATNESNSSGVNSRQQAGTSRQQIDTYTGY 174

Query: 221 ALEDLL-IESP---TEGHILEH---------ELYYSIVHGSLNDEIDLLIQAEMDSINTL 267
             E +  ++ P    E  ++E          + Y ++V   +  E  +++ AE+D I   
Sbjct: 175 KFEGIATLDKPLPYVEREVIEKRPRKILNNGDEYITVVRTGVG-ECKVVLGAEIDCIFDF 233

Query: 268 TDT-------YTEIKSSVHFKLGNTYHR--RKLLRMWIQTNLLPKSDLLIGFRN 312
            +        YTE+K S      N   R  +K+ R W+Q  L+    ++ GFR+
Sbjct: 234 KEEGKDNLKHYTELKCSSQISTTNDVRRFEKKMFRAWLQCFLVGVPRVIYGFRD 287

>KNAG0H03590 Chr8 (670845..672974) [2130 bp, 709 aa] {ON}
          Anc_2.135 YHR124W
          Length = 709

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 24 RISTRKNNKPSQKKGSLV--LSCKKFPHVSVNYVVDKTPKLLTDCK 67
          R+   +  KPS+K+G L+  L  K+ PH S N    KTP  L + K
Sbjct: 18 RLGRPRGRKPSKKQGELLAKLDLKRKPHKSTNLYNSKTPNKLKNAK 63

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 81/203 (39%), Gaps = 31/203 (15%)

Query: 136 SLVILKEAYQRYEKTLNPE-KTTFVSLRHHIIDIIMCPFLDEPL---SLLMTVQPDKNIL 191
           +L  L    Q YE+  N + K   ++ R  I  +I   F D P      L  V  D  + 
Sbjct: 79  TLRALLSTIQSYEQRKNKKAKADIITFRGIIRKLISSAF-DNPRYNRVNLRIVSFDGQLF 137

Query: 192 ISVDKSKDKPNGIHETRNSFNKKICYTGFALEDLLIESPTEGHI----LEH--------- 238
           I   K   +P    +T +S   +  Y+G+  E L+      G +    LE          
Sbjct: 138 I---KEVGEPFVPPKTTDSIEHRSYYSGYKFESLVTLPKPLGEVSRTTLEKRPKKIVNNG 194

Query: 239 ELYYSIVHGS-------LNDEIDLLIQAEMDSINTLTDTYTEIKSS--VHFKLGNTYHRR 289
           E Y S+V          L  E+D +   + DS + L   YTE+K +  V          R
Sbjct: 195 EQYISVVRTGVGKSKLILGAEVDCVFDFKEDSGDNLKH-YTELKCTKGVTTIAEARAFER 253

Query: 290 KLLRMWIQTNLLPKSDLLIGFRN 312
           K+ + W+Q  L+  + ++ GFR+
Sbjct: 254 KIFKTWLQCFLVGVNRVIYGFRD 276

>Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 47/229 (20%), Positives = 96/229 (41%), Gaps = 32/229 (13%)

Query: 117 IDLTKGYDDYVPL-----DRNVLNSLVILKEAYQRYE-KTLNPEKTTFVSLRHHIIDIIM 170
           +DL+ G+  +        DR  L  L+   E+ +R++ K +N +  TF  +   +I    
Sbjct: 57  LDLSTGFQKFKDYYKDFEDRCSLRGLLGTIESSERHKGKKVNVDIITFRGIARKLISSAF 116

Query: 171 CPFLDEPLSLLMTVQPDKNILISVDKSKD--KPNGIHETRNSFNKKIC-YTGFALEDL-- 225
                  ++L +     +  +  V ++ D  KP        + N+++  +TG+  E L  
Sbjct: 117 DSPAFNAVNLRIVSFNGQLFIKEVPEAADVVKPASAAGAVPNNNQELSGFTGYKFETLAT 176

Query: 226 -----------LIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDT---- 270
                      +IE  T+  +   + Y S+V   + +   L++ AE+D +    +     
Sbjct: 177 LSNPLQYTPREVIEKRTKRIVSHGDEYISVVRTGVGN-CKLILGAEVDCVFDFKENGKDN 235

Query: 271 ---YTEIKSSVHFKLGNTYHR--RKLLRMWIQTNLLPKSDLLIGFRNSY 314
              Y E+K +      +  H+  RKL R W+Q  L+    ++ GF++ +
Sbjct: 236 LKHYAELKCTQQVMNVSDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDH 284

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 3/66 (4%)

Query: 249 LNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHR--RKLLRMWIQTNLLPKSDL 306
           L  EID +   + D  + L   Y E+K +         H+  RK+ R W+Q  L+    +
Sbjct: 214 LGAEIDCVFDFKEDGKDNLKH-YAELKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRI 272

Query: 307 LIGFRN 312
           + GFR+
Sbjct: 273 IYGFRD 278

>Ecym_3260 Chr3 (498431..500383) [1953 bp, 650 aa] {ON} similar to
           Ashbya gossypii AER064C
          Length = 650

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 75/174 (43%), Gaps = 13/174 (7%)

Query: 129 LDRNVLNSLVILKEAYQR--YEKTLNPEKTTFVSLRHHIIDIIMCPFLDEPLSLLMTVQP 186
           LD  +LN  V+     Q   Y KT +  KTT   L +H+ID +M    +  +++  ++  
Sbjct: 155 LDDILLNCNVLFTRDLQNLYYPKTTSFAKTTRTMLVNHLIDAVMSLCCENDITITHSISL 214

Query: 187 DKNILISVDKSKDKPNGIHETRNSFNKKICY----TGFALEDLLIESPTEGHI-LEHELY 241
            +     VD  + + N +  +   F +++ Y    +G     ++IE   +    L  +L 
Sbjct: 215 GRYSKRFVDGLRSQLNDLETSEKQFQREMLYGEKHSGLQTNLIVIERQIDPLTPLLSQLT 274

Query: 242 YSIVHGSLNDEIDLLIQAEMDSI---NTLTDTYTEIKSSVHFKLGNTYHRRKLL 292
           YS   G LND     + A++  +   + L     E + ++ + + N +   K +
Sbjct: 275 YS---GMLNDIYGFTVDAKLKGLKPSDILEGANNETEVTLDYSMDNVWDDLKFI 325

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,614,309
Number of extensions: 2151124
Number of successful extensions: 6470
Number of sequences better than 10.0: 49
Number of HSP's gapped: 6608
Number of HSP's successfully gapped: 49
Length of query: 403
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 291
Effective length of database: 40,638,807
Effective search space: 11825892837
Effective search space used: 11825892837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)