Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E02223g5.436ON48048025310.0
SAKL0G02574g5.436ON48446712531e-169
KLTH0F16016g5.436ON48447110391e-137
AER403C5.436ON48046610231e-134
Kwal_55.214185.436ON4844669781e-127
Ecym_47605.436ON4784649601e-125
TDEL0E018905.436ON4744698321e-106
ZYRO0F10076g5.436ON4824648201e-104
Kpol_1062.285.436ON4654693553e-36
TPHA0E017505.436ON4594763262e-32
TBLA0A028105.436ON4814952636e-24
NCAS0G038602.304ON4612401685e-12
NCAS0G037502.304ON4612401685e-12
Ecym_33422.304ON4952361679e-12
Smik_14.3042.304ON5001341651e-11
YNL026W (SAM50)2.304ON4841341633e-11
KAFR0H032502.304ON4622821615e-11
Kpol_1003.512.304ON4781471589e-11
Suva_14.3192.304ON4841341581e-10
SAKL0E07194g2.304ON4952061534e-10
CAGL0M06853g2.304ON4661371534e-10
KLLA0E08735g2.304ON4922291518e-10
Skud_14.3022.304ON4841341509e-10
TPHA0G008302.304ON4784491491e-09
NDAI0G007102.304ON4911381482e-09
KLTH0G10824g2.304ON4951381463e-09
KNAG0H019402.304ON4561421392e-08
AGR392C2.304ON4951561356e-08
Kwal_27.114562.304ON4962061341e-07
TBLA0B060602.304ON5031741331e-07
ZYRO0A02310g2.304ON4922051205e-06
TDEL0G023402.304ON4941561018e-04
Ecym_82695.223ON28995704.1
KAFR0H012903.298ON33056704.3
ZYRO0D08118g6.344ON745142714.4
TBLA0H009708.384ON86975704.9
KAFR0I022501.409ON26144695.8
NCAS0E029707.436ON95843697.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E02223g
         (480 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {...   979   0.0  
SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {...   487   e-169
KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON} cons...   404   e-137
AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}...   398   e-134
Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026...   381   e-127
Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar...   374   e-125
TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436    325   e-106
ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {...   320   e-104
Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON} (62316....   141   3e-36
TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436    130   2e-32
TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436    105   6e-24
NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {O...    69   5e-12
NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON}               69   5e-12
Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar t...    69   9e-12
Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026...    68   1e-11
YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}  SAM50Esse...    67   3e-11
KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.3...    67   5e-11
Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON} (1170...    65   9e-11
Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026...    65   1e-10
SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {...    64   4e-10
CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} simil...    64   4e-10
KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} simila...    63   8e-10
Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026...    62   9e-10
TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.3...    62   1e-09
NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {O...    62   2e-09
KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} simila...    61   3e-09
KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.3...    58   2e-08
AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}...    57   6e-08
Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {...    56   1e-07
TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON} Anc_2...    56   1e-07
ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} simila...    51   5e-06
TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.3...    44   8e-04
Ecym_8269 Chr8 complement(542814..543683) [870 bp, 289 aa] {ON} ...    32   4.1  
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    32   4.3  
ZYRO0D08118g Chr4 complement(702839..705076) [2238 bp, 745 aa] {...    32   4.4  
TBLA0H00970 Chr8 (209566..212175) [2610 bp, 869 aa] {ON} Anc_8.3...    32   4.9  
KAFR0I02250 Chr9 complement(460748..461533) [786 bp, 261 aa] {ON...    31   5.8  
NCAS0E02970 Chr5 (590020..592896) [2877 bp, 958 aa] {ON} Anc_7.4...    31   7.6  

>KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {ON}
           conserved hypothetical protein
          Length = 480

 Score =  979 bits (2531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/480 (100%), Positives = 480/480 (100%)

Query: 1   MSSTTLSNQLPDGSCNKTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFK 60
           MSSTTLSNQLPDGSCNKTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFK
Sbjct: 1   MSSTTLSNQLPDGSCNKTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFK 60

Query: 61  SCEDIQKKLLFTGLFQSAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAV 120
           SCEDIQKKLLFTGLFQSAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAV
Sbjct: 61  SCEDIQKKLLFTGLFQSAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAV 120

Query: 121 YNKGSLSTTTRDTYSSAGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALP 180
           YNKGSLSTTTRDTYSSAGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALP
Sbjct: 121 YNKGSLSTTTRDTYSSAGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALP 180

Query: 181 FPKNPSVKAAVYANHTYLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFN 240
           FPKNPSVKAAVYANHTYLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFN
Sbjct: 181 FPKNPSVKAAVYANHTYLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFN 240

Query: 241 GMTMVARNIYGFADALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFH 300
           GMTMVARNIYGFADALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFH
Sbjct: 241 GMTMVARNIYGFADALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFH 300

Query: 301 EYILSQGFTNSKPLPHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLV 360
           EYILSQGFTNSKPLPHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLV
Sbjct: 301 EYILSQGFTNSKPLPHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLV 360

Query: 361 HLLDSFYLGGPKSLKGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGD 420
           HLLDSFYLGGPKSLKGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGD
Sbjct: 361 HLLDSFYLGGPKSLKGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGD 420

Query: 421 VLNNWRDANLERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
           VLNNWRDANLERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF
Sbjct: 421 VLNNWRDANLERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480

>SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  487 bits (1253), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 235/467 (50%), Positives = 325/467 (69%), Gaps = 4/467 (0%)

Query: 14  SCNKTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTG 73
           S  K +Y T V+VDGDNQ +P+SD LY+SI + +L+ PLQ +D+A  +  +I+KKL FTG
Sbjct: 22  SATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNAMNNFSEIKKKLFFTG 81

Query: 74  LFQSAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAVYNKGSLSTTTRDT 133
           LFQ  +ITLD+DV   S   L ENV K   +ELP+PT+A++ L+PA+YNK  L++ T D 
Sbjct: 82  LFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLIPALYNKLCLTSGTSDM 141

Query: 134 YSSAGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAVYA 193
            SS G R+ +IN  G AET+ LQ D+NY PF+GKL+E+ L  K  LP  KNPS+KA +  
Sbjct: 142 LSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGKFLLPLQKNPSIKAVIDV 201

Query: 194 NHTYLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFA 253
           N+  +DLFKQPF+   D+HKQ Q+  + G++KN+L N   +    FNG++ V RN+YGF 
Sbjct: 202 NYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPILFNGVSTVIRNLYGFN 261

Query: 254 DALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKP 313
           D   VS+SIKQF G+F KSSF+S++ +D+R+F   FP+SG R  L +EY+L+Q F+ +K 
Sbjct: 262 DIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFSKNKT 321

Query: 314 LPHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKS 373
           +P E+NFDK  +SYE H  + N ++ +SL    GAI P  +K+  +VH +D FYLGG KS
Sbjct: 322 VPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKA-AIVHTMDRFYLGGLKS 380

Query: 374 LKGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERK 433
           LKGFE N VG+ GG +FY+LGI+SS++LPN   +SPLR Q F N GD LN      L + 
Sbjct: 381 LKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQVFFNAGDSLNKRE---LPQS 437

Query: 434 PALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
            A +TG SL+Y  + AN+DL+Y+LPL  R+ D+AKPG +FG++LSFF
Sbjct: 438 FAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484

>KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  404 bits (1039), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 212/471 (45%), Positives = 299/471 (63%), Gaps = 18/471 (3%)

Query: 17  KTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTGLFQ 76
           K +YFT ++VDGDN  SP+S+ +Y S+   +L  PLQ +D +  +  +I+KKL++TGLF+
Sbjct: 25  KPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQSLSNFAEIKKKLIYTGLFR 84

Query: 77  SAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAVYNKGSLSTTTRDTYSS 136
             +I+LD++V     + L +++ K   +E+PIPTIA+++L P   N+ SL++ T DT SS
Sbjct: 85  DVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIARIRLTPINLNRASLTSFTGDTLSS 144

Query: 137 AGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAVYANHT 196
            G R   IN FG AE ++LQG + Y PF    DE++L AKL +P  KNPSVKA   AN+ 
Sbjct: 145 MGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLLIPLQKNPSVKAVFDANYA 204

Query: 197 YLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFADAL 256
            +DL  QPFI + D+H+Q Q  ++ G++K ++          +NG ++VARN+       
Sbjct: 205 NIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVLYNGFSVVARNLDEVRK-- 262

Query: 257 AVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSK--PL 314
             S++I+QF   F K+SF+S+L  D+R+F+  FP SG +  + +EY+LS+ F       +
Sbjct: 263 EASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYVLSESFDKKAGTAV 322

Query: 315 PHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSL 374
                FDKL+V +E HR FF  K++ SL L  G IF    KS  LVH +D FYLGG  SL
Sbjct: 323 SQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFS-AGKSSSLVHHIDKFYLGGMSSL 381

Query: 375 KGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERKP 434
           KGFERN VG  GG  FYKLG++SSFKLPNTP +SPLRLQ F N GDV N        +KP
Sbjct: 382 KGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFNAGDVQN--------KKP 433

Query: 435 -----ALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
                A S+G+SL+Y +S AN+DL+Y+ PL  R  DI KPG +FG+ LS +
Sbjct: 434 TQFSCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSLY 484

>AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}
           NOHBY530; No homolog in Saccharomyces cerevisiae'
          Length = 480

 Score =  398 bits (1023), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 210/466 (45%), Positives = 293/466 (62%), Gaps = 8/466 (1%)

Query: 14  SCNKTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTG 73
           S  K +Y T V V+ D +  P+SD + +SI + +LA PLQ + S   S E I+K L++TG
Sbjct: 22  SQTKPLYITSVQVE-DGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKNLMYTG 80

Query: 74  LFQSAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAVYNKGSLSTTTRDT 133
           L+Q   ITLDHD     ++ L+   PK  DIELP+P  A VK++PA Y + SL TTTRD+
Sbjct: 81  LYQDISITLDHDKSRLVNQFLSNIAPKEYDIELPLPVKALVKVLPAPYQRLSLVTTTRDS 140

Query: 134 YSSAGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAVYA 193
           Y+SAG RL  +NKFG AE  SLQ DVNYTPF+GKLD++L+  +  +PF  NPS+KA    
Sbjct: 141 YASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSIKAVFDV 200

Query: 194 NHTYLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFA 253
           N+  LDL+ QP+I E D+HKQ Q G + GI+K +L     S    F G+++V RN++G  
Sbjct: 201 NYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRLYSP-TAFAGVSIVGRNLHGIQ 259

Query: 254 DALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKP 313
              A S  +  +  +  K+SF+++    +R+    FPV G +    +E +LSQ    +  
Sbjct: 260 LDRA-SYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTVAGT-- 316

Query: 314 LPHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKS 373
            P E  F+K  V+YE H  F    + TSL L  G++   K  +KP+VH++D FYLGG  S
Sbjct: 317 -PQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGLSS 375

Query: 374 LKGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERK 433
           LKGF RN VG+RGG  FY+L + SS  LP TP+DSPLRLQ+F N GDV +  R   +   
Sbjct: 376 LKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRR--QIPED 433

Query: 434 PALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSF 479
            A +TG+SL+Y +  ANLDL+Y+LPL  R  D+AKPG +FG+ +++
Sbjct: 434 VAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479

>Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026W -
           Essential protein with similarity to S. pombe
           hypothetical protein E241976 [contig 130] FULL
          Length = 484

 Score =  381 bits (978), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 197/466 (42%), Positives = 292/466 (62%), Gaps = 8/466 (1%)

Query: 17  KTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTGLFQ 76
           K +YFT ++VDG+ +L P+SD  Y S+   +L+ PLQ ++ +  +  +I+KKL++TG+F 
Sbjct: 25  KPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQTLEQSLANFTEIKKKLIYTGMFS 84

Query: 77  SAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAVYNKGSLSTTTRDTYSS 136
             +I+LD D      + L ++  K L +E P+PTIA++ L P  +NK   +++T DT  S
Sbjct: 85  DVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARILLKPLEFNKLCFTSSTNDTVPS 144

Query: 137 AGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAVYANHT 196
            GAR  ++N  G AE ++LQ +V Y PF     E+ L AK+ +P  KNPSVKA    N+ 
Sbjct: 145 LGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVPLQKNPSVKAVFDTNYA 204

Query: 197 YLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFADAL 256
            +DL  QPF+ + D+H+Q Q  ++ G++K +L +        +NG ++VARN++   +  
Sbjct: 205 NIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKMNLSPVFYNGFSVVARNLHDVPN-- 262

Query: 257 AVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFT--NSKPL 314
             S +I+QF   F K+SF+S+L  D+R+F+  FP SG ++ L +EY+LSQ F   +   +
Sbjct: 263 EASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVLSQRFEKDSGNDM 322

Query: 315 PHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSL 374
             +  F+K ++S E  R FF  K++ SL +  G I P  N S  LVH +D FYLGG  SL
Sbjct: 323 ALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGN-SASLVHHMDKFYLGGLASL 381

Query: 375 KGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERKP 434
           KGFERN VG  GG +FYKL ++SSFKLP TP  SPLRLQ F+N G+V N   +       
Sbjct: 382 KGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQFFLNAGEVSN---EKPTSVSC 438

Query: 435 ALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
           A S+GISL+Y +  AN+DL+Y+LPL  R  D+AKPG +FG+ LS +
Sbjct: 439 AASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSLY 484

>Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii AER403C
          Length = 478

 Score =  374 bits (960), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 198/464 (42%), Positives = 295/464 (63%), Gaps = 8/464 (1%)

Query: 17  KTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTGLFQ 76
           K ++ T V V+ D +LSP+S+ +++SI   +L+ P Q + S   +   I+KKL++TGL+ 
Sbjct: 23  KPLFITSVYVN-DVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGTIEKKLMYTGLYD 81

Query: 77  SAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAVYNKGSLSTTTRDTYSS 136
              ITLD D     S  L E  PK   +ELP+P  AQ++LVPA Y   SL TTTRD+Y++
Sbjct: 82  DVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPLSLVTTTRDSYAA 141

Query: 137 AGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAVYANHT 196
           AG  L  +NKF  AETI LQG++N TPF+GK+DE+LL  K  +P  K PS+KA    N+ 
Sbjct: 142 AGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSLKCLVPLQKLPSMKAVFDINYA 201

Query: 197 YLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFADAL 256
            +DLFKQ ++ ESD+HKQ+Q G + GI++  + ++       ++G++++ RN+       
Sbjct: 202 LVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYSGISILGRNLLDLKKT- 260

Query: 257 AVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKPLPH 316
            VS SI  +  + +K S++ ++  ++++F    P+SG +  LF+E +L Q     K    
Sbjct: 261 EVSSSINSWVES-SKVSYVFQILQNNKKFLGTLPISGWKFNLFNEAVLGQTVAGEK---Q 316

Query: 317 ESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSLKG 376
           ES F K++ SYE +  F    ++TSL L  G IF +K+ S+  VH++D FYLGG  SLKG
Sbjct: 317 ESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKVHIMDQFYLGGLSSLKG 376

Query: 377 FERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERKPAL 436
           F+RN VG RGG  FYK+   SSF +P TP+ SPLRLQ+F+N GDV N+ R   +    A 
Sbjct: 377 FQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFNSER--GIPEDLAT 434

Query: 437 STGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
           +TGISL+Y +  A+LDL+Y+LPL +R  D+AKPG +FG+ +++ 
Sbjct: 435 ATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478

>TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436
          Length = 474

 Score =  325 bits (832), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 179/469 (38%), Positives = 273/469 (58%), Gaps = 7/469 (1%)

Query: 13  GSCNKTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFT 72
           GS  K +Y +K+++DGDN LSP+S  +Y++I ++ L+ P+Q V S+  +  DI++KLL T
Sbjct: 12  GSETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKLLCT 71

Query: 73  GLFQSAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPA-VYNKGSLSTTTR 131
           GL+Q   ITL+ D D +SS    ++ PK   IE P+ T A++ L P+ VYN  + +T+  
Sbjct: 72  GLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTAGTTSLV 131

Query: 132 DTYSSAGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAV 191
           D  +S      ++N  G A++ S    + Y P   K + + L    +LP  KNPSV+A++
Sbjct: 132 DDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNPSVRASL 191

Query: 192 YANHTYLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYG 251
             +   ++   + +I E+D+H + Q+ LS G++K ++     SV   + G+T   R+I G
Sbjct: 192 NFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITSTNRDISG 251

Query: 252 FADALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNS 311
                  S     + G F K S  S+  +D+R++Y  FPVSG  + + +EY++SQ   +S
Sbjct: 252 L--GAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQTKGSS 309

Query: 312 KPLPHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGP 371
           + LP E NF K   S + H   +  KL  SL L  G I P+  K++  VH +D +YLGG 
Sbjct: 310 QVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSEKTE--VHPMDKWYLGGL 367

Query: 372 KSLKGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLE 431
            S+KGF+ N VG  G  +FYK+ +++S KL NTPIDSPLRL  F+N G+  N+   A   
Sbjct: 368 DSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNTAT-- 425

Query: 432 RKPALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
              A +TGISL Y    AN+DL+Y+ PL  R  DI KPG +FG+  S+F
Sbjct: 426 NSYAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474

>ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {ON}
           similar to gnl|GLV|KLLA0E02222g Kluyveromyces lactis
           KLLA0E02222g and some similarites with YNL026W
           uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 482

 Score =  320 bits (820), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/464 (40%), Positives = 266/464 (57%), Gaps = 5/464 (1%)

Query: 17  KTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTGLFQ 76
           K +Y +K+ +DGDN  SP+SD L ++IF   L  PLQ V+++    EDI+KKLLFTGLF 
Sbjct: 24  KPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKLLFTGLFS 83

Query: 77  SAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAVYNKGSLSTTTRDTYSS 136
              ITLD D D  S   L + + ++  IE P+ T A+V L    YN  S +TT  D   S
Sbjct: 84  DVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPDYNTISGTTTLSDDNIS 143

Query: 137 AGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAVYANHT 196
                 W N  G A+  +L+   N+ P   + D +      +LP  K PSV+A V A   
Sbjct: 144 LAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVRAIVEAEGI 203

Query: 197 YLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFADAL 256
              L  +PF+   DEH Q Q+ + AG +K ++ N +KSV   + G+++V RN+  F    
Sbjct: 204 QRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYTGVSVVRRNLNEFKP-- 261

Query: 257 AVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKPLPH 316
             S+    F+G F K+SF++    D+R F   FP+SG + QL +EY++SQ   +SK L H
Sbjct: 262 TASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQSQGSSKQLNH 321

Query: 317 ESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSLKG 376
           ++NF+K +   E H   +  K+  S  L  G I+P  ++++  VH LD F LGG  SLKG
Sbjct: 322 DNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQ-TVHPLDRFQLGGLNSLKG 380

Query: 377 FERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERKPAL 436
           F  N VG  G  +FYKLG+S S KL NTP  SPLRLQ F N G+  ++++   +    A 
Sbjct: 381 FHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYK--TIFNSYAA 438

Query: 437 STGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
           +TG+SL+Y    A LDL+Y+ PL  R  D++KPGL+ G+ L+FF
Sbjct: 439 ATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482

>Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON}
           (62316..63713) [1398 nt, 466 aa]
          Length = 465

 Score =  141 bits (355), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 126/469 (26%), Positives = 226/469 (48%), Gaps = 33/469 (7%)

Query: 17  KTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTGLFQ 76
           K +Y ++V+V+ D+   P+S    Q++   ++++P+Q VD+A  S  DI++ LLFTGL+ 
Sbjct: 23  KPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIKRNLLFTGLYN 82

Query: 77  SAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVP--AVYNKGSLSTTTRDTY 134
             ++TL  D       L  + V   + IE  +PT A ++L P   V N  +  TTT +  
Sbjct: 83  DVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRLKPNDLVTNLQTTFTTTSNDC 142

Query: 135 SSAGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAVYAN 194
           S    +L W N  G A+  ++     Y   +    ++    +  LPF K PS++  +  +
Sbjct: 143 SVNFHKL-WPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGEFILPFTKVPSLRTVLSVD 201

Query: 195 HTYLDLFKQPFIGESDEHKQS-QFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFA 253
            +           +   H Q       AGI+K +L ++  +    ++G+++V  N   F 
Sbjct: 202 VS----------EDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPVFYSGLSIV-NNKPIFN 250

Query: 254 DALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKP 313
             + + D     Q    +S +++    DS ++   FP SG+ + L +EY+LSQ  +++KP
Sbjct: 251 GEIPI-DVPSPEQTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVLSQLDSDNKP 309

Query: 314 LPHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKS 373
           +   +N ++   ++E +    N++++T++ ++ G  FP    ++       +F       
Sbjct: 310 I--NTNINRFEANFEKYVSILNSRVITTVLMNGGFQFPIDESTR------STFVGESWDK 361

Query: 374 LKGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFI---NFGDVLNNWRDANL 430
                ++ + N+  + F K G  SSFKLPNT +DSPLRLQ      N    L N+ D   
Sbjct: 362 RNSLIKDIILNKSDMNF-KCGFISSFKLPNTELDSPLRLQISALTENKFKGLANYFDG-- 418

Query: 431 ERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSF 479
               A  TG+SL+Y     N+ LSY +PL       A  G +F + +++
Sbjct: 419 ---CAADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITY 464

>TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436
          Length = 459

 Score =  130 bits (326), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 118/476 (24%), Positives = 226/476 (47%), Gaps = 42/476 (8%)

Query: 17  KTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTGLFQ 76
           K +Y T+V V        +SD  Y++I   ++++P++ V       ++I+  L+ +GL++
Sbjct: 12  KPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNNLILSGLYK 71

Query: 77  SAEITLDHDVDVRSS------RLLTENVPKTLDIELPIPTIAQVKLVPAVYN--KGSLST 128
           + ++ L  D+D R+S      +L TE +     IE  +P  A + + P      K  ++ 
Sbjct: 72  NVDVKL--DLDERASLLNHSLKLSTEQI----GIESVVPISATLNMTPLYLTPYKNYVTF 125

Query: 129 TTRDTYSSAGARLFWINKFGNAE--TISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPS 186
            T +T +S      WIN FG ++  TI L  D+N T    ++D++ + AK  +P  +N S
Sbjct: 126 NTSNTQNSVSLNRDWINLFGTSDTGTIKLSADLNQTK--SEIDKKSIDAKFTMPLLRNSS 183

Query: 187 VKAAVYANHTYLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVA 246
           ++  + +  +         I +       QF L+ G+ K  L    KS+   ++G+ +  
Sbjct: 184 IRTILESKCS---------IAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNIQR 234

Query: 247 RN--IYGFADALAVSDSIKQFQGTFTKS-SFISELKSDSREFYNRFPVSGKRVQLFHEYI 303
           +   +   +D  + ++ I         S S  SE  +DSR + ++FP  G   +L H+++
Sbjct: 235 KQTTLGPLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQHV 294

Query: 304 LSQGFTNSKPLPHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLL 363
           L++  TNS     + N   +++S+E H    N ++ +S   D     P ++    L    
Sbjct: 295 LNE--TNSISNEIKKNISNINMSFEKHISTLNDQITSSFIFDGHVGVPLQSTFANLNS-- 350

Query: 364 DSFYLGGPKSLKGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLN 423
             F+    +  K   +N +        +K+G+ SSF++PN PI SP+R Q  ++   +  
Sbjct: 351 GEFWDNEKEIFKTLCQNDIK-----VSHKVGLVSSFRVPNIPITSPIRFQ--LSVLGINK 403

Query: 424 NWRDANLERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSF 479
           + R A   +  +  TG+SL+Y    + + LSY +PL +   D    GL+F + +++
Sbjct: 404 SKRMAEYLKNYSADTGVSLVYKGDHSQMKLSYQIPL-IHGNDNKHSGLSFDVAVTY 458

>TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436
          Length = 481

 Score =  105 bits (263), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 122/495 (24%), Positives = 216/495 (43%), Gaps = 56/495 (11%)

Query: 12  DGSCNKTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLF 71
           D +  K +Y +KVT+   N+   VSD   +S+ N +L+ PLQ + +  ++ E+I+ KL  
Sbjct: 17  DLNSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQ 76

Query: 72  TGLFQSAEITLDHDVDVRSS-RLLTENVP-KTLDIELPIPTIAQVKLVPAVYNK----GS 125
           T LF+  +I+LD +    S  + L +++    + ++ PIP  A + + P   NK     +
Sbjct: 77  TDLFEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKP---NKPLVDPN 133

Query: 126 LSTTTRDTYSSAGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNP 185
            + T  +  S       WIN    A+   +     Y   + K            P     
Sbjct: 134 YTWTISNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFKFDGLSTYPLVPFT 193

Query: 186 SVKAAVYANHTYLDLFKQ--------PFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIE 237
           SVK+      + + LFK          ++ ES   K  +F    G++ + LY        
Sbjct: 194 SVKSV-----SGISLFKPLQQSKDYIQYLVESGFRKDMRFPEEVGVKSSNLYTG-----L 243

Query: 238 TFNGMTMVARNIYGFADALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQ 297
             NG    A    G  + L ++ +I +    + K+S +S+  +DSR F    P  G    
Sbjct: 244 AING----AIKDEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFN 299

Query: 298 LFHEYILSQGFTNSKPLP----HESNFDKLSVSYETHRPFFNTKLVTSLHLDAGA----- 348
           +++EY+L+ G  +SK L     H SN  +  +++E +   F   ++ SL +  G      
Sbjct: 300 IYYEYVLN-GLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPS 358

Query: 349 --IFPWKNKSKPLVHLLDSFYLGGPKSLKGFERNCVGNRGGLYFYKLGISSSFKLPNTPI 406
             +F W+ K +         YL      +  E+N      G+ FY + +++S  L +   
Sbjct: 359 INMFNWETKRREANEFPVPSYLEE----RPHEKN-----DGIAFYNVCLNASVPLFSKCK 409

Query: 407 DSPLRLQSFINFGDVLNNWRDANLERKPALSTGISLIYSASFANLDLSYSLPL-RVRDYD 465
            SPLR Q+ I   +  NN    + +RKP ++  + L+Y +  A  D+ Y+LP+ ++  +D
Sbjct: 410 FSPLRFQNSIQL-ERYNNCC-PHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHD 467

Query: 466 IAKPGLTFGLDLSFF 480
             K G      +SF 
Sbjct: 468 -TKAGFAMNASISFL 481

>NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 109/240 (45%), Gaps = 31/240 (12%)

Query: 255 ALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKPL 314
           +L+ SDS+    G   K +  S +  DSR+     P  G+ ++ F+E  + + + N   L
Sbjct: 239 SLSASDSVLFQTGDDFKRTLGSTIIWDSRD-SQIAPNRGQSLKWFNELSVGRYWKNQLEL 297

Query: 315 PHESNFDKLSVSYETHRPFFNTKLVT-SLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKS 373
            H              + +F+   VT S +   G I    ++S   VH+ D F  GGP  
Sbjct: 298 SHL-------------KSWFDNDFVTMSCNFKTGYIHSLSSQS---VHISDKFQSGGPND 341

Query: 374 LKGFERNCVGNR------GGLYFYKLGISSSFKLPNTPID-SPLRLQSFINFGDVLNNWR 426
           ++ F+   +G +      GG  F   G+S   +LP      S  RL  FIN G+++++  
Sbjct: 342 IRSFQSMGLGPKDHMNSIGGDAFVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNG 401

Query: 427 DA------NLERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
            A       L R+ + S G+ +I     A  +L++S+PL +   D  + GL FG+ LSF 
Sbjct: 402 QALTDCLAALSRQHSTSAGVGIILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSFL 461

>NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 109/240 (45%), Gaps = 31/240 (12%)

Query: 255 ALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKPL 314
           +L+ SDS+    G   K +  S +  DSR+     P  G+ ++ F+E  + + + N   L
Sbjct: 239 SLSASDSVLFQTGDDFKRTLGSTIIWDSRD-SQIAPNRGQSLKWFNELSVGRYWKNQLEL 297

Query: 315 PHESNFDKLSVSYETHRPFFNTKLVT-SLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKS 373
            H              + +F+   VT S +   G I    ++S   VH+ D F  GGP  
Sbjct: 298 SHL-------------KSWFDNDFVTMSCNFKTGYIHSLSSQS---VHISDKFQSGGPND 341

Query: 374 LKGFERNCVGNR------GGLYFYKLGISSSFKLPNTPID-SPLRLQSFINFGDVLNNWR 426
           ++ F+   +G +      GG  F   G+S   +LP      S  RL  FIN G+++++  
Sbjct: 342 IRSFQSMGLGPKDHMNSIGGDAFVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNG 401

Query: 427 DA------NLERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
            A       L R+ + S G+ +I     A  +L++S+PL +   D  + GL FG+ LSF 
Sbjct: 402 QALTDCLAALSRQHSTSAGVGIILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSFL 461

>Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar to
           Ashbya gossypii AGR392C
          Length = 495

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 105/236 (44%), Gaps = 27/236 (11%)

Query: 258 VSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKPLPHE 317
            SDS+    G   K+S    +  DSR+    FP  G+ ++LF+E  L             
Sbjct: 274 ASDSLLLQCGDDFKNSISHAISRDSRD-NAIFPSRGQYIKLFNELSLG------------ 320

Query: 318 SNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSLKGF 377
             + K  + +   + + +   +T      G      N     +H+ D F+ GG   ++GF
Sbjct: 321 -TYWKSILEFTDAKSWLDKDFITMSTTIKGGYIANLNSDNKFIHMKDKFHSGGSNDVRGF 379

Query: 378 ERNCVGNR------GGLYFYKLGISSSFKLP-NTPIDSPLRLQSFINFGDVLN-NWRDAN 429
           ++  +G R      GG  F   GIS   +LP N   +S  RL  F+N G ++N N  D +
Sbjct: 380 QQMGLGPRDIYDSIGGDTFVAYGISVFSRLPVNKWSNSGFRLHWFLNGGRLINHNNSDLS 439

Query: 430 -----LERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
                L  + +++TGI +++    A  +L+++LPL     D  + G  +G+ LSF 
Sbjct: 440 GVLDQLCMEHSIATGIGILFKHPVARFELNFTLPLAAHSSDSVRKGFQYGIGLSFL 495

>Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026W
           (REAL)
          Length = 500

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 67/134 (50%), Gaps = 13/134 (9%)

Query: 360 VHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFYKLGISSSFKLPNTPID-SPLRL 412
           VH+ D F  GGP  ++ F+   +G R      GG  F   G+S   +LP   ++ S  RL
Sbjct: 367 VHICDKFQSGGPNDIRSFQTFGLGPRDLYDAIGGDAFVSYGVSMFSRLPWKKVEKSNFRL 426

Query: 413 QSFINFGDVLNNWRDA------NLERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDI 466
             F N G ++N+   +       L R+ + STGI L+     A  +L++SLP+   + D+
Sbjct: 427 HWFFNGGKLINHDNTSLSNCIGQLSREHSTSTGIGLVLRHPLARFELNFSLPITAHENDL 486

Query: 467 AKPGLTFGLDLSFF 480
            + G  FGL L+F 
Sbjct: 487 MRKGFQFGLGLAFL 500

>YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}
           SAM50Essential component of the Sorting and Assembly
           Machinery (SAM or TOB complex) of the mitochondrial
           outer membrane, which binds precursors of beta-barrel
           proteins and facilitates their outer membrane insertion;
           homologous to bacterial Omp85
          Length = 484

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 68/134 (50%), Gaps = 13/134 (9%)

Query: 360 VHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFYKLGISSSFKLPNTPID-SPLRL 412
           VH+ D F  GGP  ++GF+   +G R      GG  F   G+S   +LP   ++ S  RL
Sbjct: 351 VHICDKFQSGGPSDIRGFQTFGLGPRDLYDAVGGDAFVSYGLSVFSRLPWKKVEKSNFRL 410

Query: 413 QSFINFGDVLNNWRDA------NLERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDI 466
             F N G ++N+   +       L ++ + STGI L+     A  +L+++LP+   + D+
Sbjct: 411 HWFFNGGKLVNHDNTSLGNCIGQLSKEHSTSTGIGLVLRHPMARFELNFTLPITAHENDL 470

Query: 467 AKPGLTFGLDLSFF 480
            + G  FGL L+F 
Sbjct: 471 IRKGFQFGLGLAFL 484

>KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.304
           YNL026W
          Length = 462

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 121/282 (42%), Gaps = 34/282 (12%)

Query: 220 SAGIEKNFLYNNNKSVIETFN------GMTMVARNI-YGFADALAVSDSIKQFQGTFTKS 272
           + G++   LY   KS  +  N      G+ MV RN  +    +  VSD +   +G F K+
Sbjct: 194 NVGVKDLGLYMGTKSWFDAKNTWNYDLGLEMVKRNFNHKLNSSKVVSDYLLIQEGEFYKT 253

Query: 273 SFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKPLPHESNFDKLSVSYETHRP 332
           +  S +  D R      P  G+  ++ ++  L  G  N +   H + F+ +       + 
Sbjct: 254 TLRSTMVWDGRNGKTA-PTKGRLFKINND--LGFGTNNLQFWRHVTEFNLV-------KS 303

Query: 333 FFNTKLVT-SLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSLKGFERNCVGNR------ 385
           +     +T S  +  G I   KN S+  +H  D F  GGP  ++ F+   +G R      
Sbjct: 304 WLKDDFITMSNTIKFGYI---KNLSQDYIHFTDKFQNGGPNDIRSFQSMGIGPRHNSYSL 360

Query: 386 GGLYFYKLGISSSFKLPNTPI-DSPLRLQSFINFGDVLNN-----WRDA-NLERKPALST 438
           GG  F   G+S   KLP     DS  RL  F N G ++N+     W    NL  + + S 
Sbjct: 361 GGDAFLSYGVSIFSKLPIQKFHDSNFRLHWFFNGGKLINHDNASIWNCMQNLTIENSTSA 420

Query: 439 GISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
           G+ ++     A  ++++++P+     D+ + G  FGL   F 
Sbjct: 421 GVGVVLRHPMARFEMNFAVPITDHQDDLTRKGFQFGLGFEFL 462

>Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON}
           (117089..118525) [1437 nt, 479 aa]
          Length = 478

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 74/147 (50%), Gaps = 14/147 (9%)

Query: 347 GAIFPWKNKSKPLVHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFYKLGISSSFK 400
           G I    +  KPL H+ D F+LGG   ++GF+   +G +      GG  F   GIS   K
Sbjct: 333 GWITKIDDNDKPL-HISDKFHLGGSNDVRGFQLMGLGPKQINDAIGGDMFSAYGISLFSK 391

Query: 401 LPNTPI-DSPLRLQSFINFGDVLN---NWRDANLE---RKPALSTGISLIYSASFANLDL 453
           LP     DS  RL +F N G ++N   N  D NL+   ++ +L+ G  +I+    A  +L
Sbjct: 392 LPFKKFSDSNFRLHAFFNGGKLVNQNTNTFDRNLQSLFKENSLAIGTGIIFKHPVARFEL 451

Query: 454 SYSLPLRVRDYDIAKPGLTFGLDLSFF 480
           +++LPL     D  + G  +G+ +SF 
Sbjct: 452 NFTLPLTSYSTDHVRKGFQYGIGMSFL 478

>Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 68/134 (50%), Gaps = 13/134 (9%)

Query: 360 VHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFYKLGISSSFKLPNTPID-SPLRL 412
           VH+ D F  GGP  ++ F+   +G R      GG  F   G+S   +LP   +  S  RL
Sbjct: 351 VHICDKFQNGGPNDIRSFQTFGLGPRDLYDAIGGDAFVSYGVSVFSRLPWKKVQKSNFRL 410

Query: 413 QSFINFGDVLN--NWRDAN----LERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDI 466
             F N G ++N  N   +N    L ++ + STGI L+     A  +L++SLP+   + D+
Sbjct: 411 HWFFNGGKLINHDNMSLSNCIGQLSKEHSTSTGIGLVLRHPMARFELNFSLPIAAHENDL 470

Query: 467 AKPGLTFGLDLSFF 480
            + GL FG+ L+F 
Sbjct: 471 MRKGLQFGIGLAFL 484

>SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {ON}
           similar to uniprot|P53969 Saccharomyces cerevisiae
           YNL026W SAM50 Essential component of the Sorting and
           Assembly Machinery (SAM complex) of the mitochondrial
           outer membrane the authentic non-tagged protein was
           localized to the mitochondria
          Length = 495

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 94/206 (45%), Gaps = 30/206 (14%)

Query: 290 PVSGKRVQLFHEYILSQGFTNSKPLPHESNFDKLSVSYETHRPFFNTKLVT-SLHLDAGA 348
           P  G   +L +E  L +             F K ++ +     +F    +T +  L  G 
Sbjct: 305 PTRGNYAKLLNELALGK-------------FWKTTLEFSQTNSWFTNDFITMTGTLKGGY 351

Query: 349 IFPWKNKSKPLVHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFYKLGISSSFKLP 402
           I  +  KS+PL H+ D F+ GG   ++GF+   +G +      GG  F   G+S   +LP
Sbjct: 352 ISNFHPKSQPL-HMGDKFHNGGSNDVRGFQAMGLGPKDLYDSMGGDAFVAYGVSLFSRLP 410

Query: 403 -NTPIDSPLRLQSFINFGDVLNNWRDANLE-------RKPALSTGISLIYSASFANLDLS 454
                +S  RL  F+N G ++N+  + NL        ++ + STG+ L++    A  +L+
Sbjct: 411 VRRWYESNFRLHWFVNGGRLINH-NNTNLSSCIKSLAQEHSTSTGVGLVFKHPVARFELN 469

Query: 455 YSLPLRVRDYDIAKPGLTFGLDLSFF 480
           +++P+     D  + G  +G+ L+F 
Sbjct: 470 FTVPISAHSSDSVRKGFQYGIGLTFL 495

>CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026w
          Length = 466

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 64/137 (46%), Gaps = 13/137 (9%)

Query: 357 KPLVHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFYKLGISSSFKLPNTPI-DSP 409
           K  +H+ D F  GGP  ++ F+   VG +      GG  F   G+S   KLP     DS 
Sbjct: 330 KKTLHINDKFMSGGPNDIRSFQSFGVGPKDLQDAIGGDTFLSYGVSIFSKLPIKKFEDSH 389

Query: 410 LRLQSFINFGDVLNNWRD------ANLERKPALSTGISLIYSASFANLDLSYSLPLRVRD 463
            RL  F N G ++N+          +L R+ + S G  ++     A  +L++SLPL V  
Sbjct: 390 FRLHWFFNGGKLINHQNKPVIDTLHDLSRQHSTSVGCGIVLRHPVARFELNFSLPLTVST 449

Query: 464 YDIAKPGLTFGLDLSFF 480
            D  + G  FGL +SF 
Sbjct: 450 EDSLRKGFQFGLGMSFL 466

>KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 102/229 (44%), Gaps = 31/229 (13%)

Query: 267 GTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKPLPHESNFDKLSVS 326
           G   K S +  +  D+R+     P SG+  +  +E  L +             F K ++ 
Sbjct: 280 GDDVKHSVVHSITRDTRDNIIA-PSSGQMWKFINEVSLGK-------------FWKTNLE 325

Query: 327 YETHRPFFNTKLVT-SLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSLKGFERNCVGNR 385
           Y   + +FN   +T S  + AG I  +  K+ PL HL D FY GG   ++ F+   +G +
Sbjct: 326 YNFTKSWFNRNFITMSSTVKAGYIHNFHAKTYPL-HLADKFYNGGSNDVRSFQLMGLGPK 384

Query: 386 ------GGLYFYKLGISSSFKLP-NTPIDSPLRLQSFINFGDVLNNWRDAN-------LE 431
                 GG      G+S   +LP     DS  RL  F N G ++N   +AN       + 
Sbjct: 385 DIYDYVGGDTSLSYGLSLFSRLPFKRFYDSNFRLHLFFNGGRLINR-NNANTTDTLMQML 443

Query: 432 RKPALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
            + +LSTG  L++    A  +L++++P+     D  + G  +G+ +SF 
Sbjct: 444 SQHSLSTGFGLVFRHPVARFELNFTVPITAHTSDATRKGFQYGIGISFL 492

>Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 66/134 (49%), Gaps = 13/134 (9%)

Query: 360 VHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFYKLGISSSFKLPNTPID-SPLRL 412
           +H+ D F  GGP  ++ F+   +G R      GG  F   G+S   +LP   +  S  RL
Sbjct: 351 IHICDKFQSGGPNDIRSFQTFGLGPRDLYDTIGGDAFVSYGVSVFSRLPWEKVKKSNFRL 410

Query: 413 QSFINFGDVLN--NWRDAN----LERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDI 466
             F N G ++N  N   +N    L ++ + STG+ L+     A  +L++SLP+   + D+
Sbjct: 411 HWFFNGGKLINHDNMSLSNCMGRLSKEHSTSTGLGLVLRHPMARFELNFSLPIAAHENDL 470

Query: 467 AKPGLTFGLDLSFF 480
            + G  FGL L F 
Sbjct: 471 MRKGFQFGLGLVFL 484

>TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.304
           YNL026W
          Length = 478

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 99/449 (22%), Positives = 182/449 (40%), Gaps = 70/449 (15%)

Query: 60  KSCEDIQKKLLFTGLFQSAEITLDHDVDVRSSRLLTENVPKTLDIELPIPT-------IA 112
           +S +D+ KKL+  GL ++   T D    +    L+    P TL     IPT        +
Sbjct: 72  ESADDLAKKLIQHGLVENISNTFDTQ-GISRHNLIASTYPSTLYDSSNIPTKVSVIDITS 130

Query: 113 QVKLVPAVYNKGSLSTTTRDTYSSAGARLFWINKFGNAETISL---QGDVNYTPFNGKLD 169
           ++KL+P         T   +       +    N FG  E ++L   +G   ++ +     
Sbjct: 131 KIKLIPLKKFMAKTGTNIGNGEGDGYLQFQLRNIFGGGERLNLDITKGTKTHSSY----- 185

Query: 170 ERLLGAKLALPFPKNPSV--KAAVYANHTYLDLFKQPFIGESDEHKQSQFGLSAGIEKNF 227
                  L    P NP+      +Y N+  L       +G      + + G+        
Sbjct: 186 ------LLNYTQPVNPTWIWDTILYQNNRQLGSSIDMIVGGLRSSIKGKTGIHD------ 233

Query: 228 LYNNNKSVIETFNGMTMVARNIYGFADALAVSDSIKQFQGTFTKSSFISELKSDSREFYN 287
            Y N++  IE     T +  +          S+++    G   K S    +  D+R+ + 
Sbjct: 234 -YVNHEFYIEGLLRETKIISS--------NCSNTLLFQAGNDQKVSIGHSIAWDTRDNH- 283

Query: 288 RFPVSGKRVQLFHEYILSQGFTNSKPLPHESNFDKLSVSYETHRPFFNTKLVT-SLHLDA 346
             P  G  +++F+E  L++             + K  +   T   F    L+T +  +  
Sbjct: 284 IIPTYGSFLKVFNEVALNR-------------YLKSQIEVNTAMSFLKNSLITVNGTMRL 330

Query: 347 GAIFPWKNKSKPLVHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFYKLGISSSFK 400
           G I    +  +PL H+ D F LGG   ++ F+   +G +      GG  +   GIS    
Sbjct: 331 GYISNISSTLRPL-HIGDRFQLGGGNDVRSFQPMGLGPKDIYDSIGGNSYTAYGISVFTA 389

Query: 401 LP-NTPIDSPLRLQSFINFGDVLNN------WRDA--NLERKPALSTGISLIYSASFANL 451
           LP  + + S  ++ +FIN G ++N+      + DA  +L ++ +LSTG+ +I+    A  
Sbjct: 390 LPFKSLMTSNFKIHTFINGGKLINHNSSNGTFTDAVKDLIKENSLSTGVGIIFKHPVARF 449

Query: 452 DLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
           +L+++LPL     D+ + G  +G+ +SF 
Sbjct: 450 ELNFTLPLITHKSDMVRKGFQYGIGISFL 478

>NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {ON}
           Anc_2.304
          Length = 491

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 67/138 (48%), Gaps = 13/138 (9%)

Query: 356 SKPLVHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFYKLGISSSFKLPNTPID-S 408
           S   +H+ D F  GGP  ++ F+   +G +      GG  F   GIS   KLP      S
Sbjct: 354 SSSFLHISDKFQNGGPNDIRSFQTMGLGPKDIFNSIGGDAFVSYGISIFSKLPIKDWSKS 413

Query: 409 PLRLQSFINFGDVLN------NWRDANLERKPALSTGISLIYSASFANLDLSYSLPLRVR 462
             RL  F+N G ++N      N    +L R+ ++STG+ ++     A  +L++S+PL + 
Sbjct: 414 NFRLHWFLNGGKLINHNGMSINNCFTDLSRQHSISTGVGILLRHPMARFELNFSVPLTIH 473

Query: 463 DYDIAKPGLTFGLDLSFF 480
             D  + G  FG+ LSF 
Sbjct: 474 QGDDVRKGFQFGVGLSFL 491

>KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 495

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 68/138 (49%), Gaps = 14/138 (10%)

Query: 356 SKPLVHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFYKLGISSSFKLP-NTPIDS 408
           SKPL H+ D F+ GG   ++ F+   +G +      GG  F   G+S   +LP     DS
Sbjct: 359 SKPL-HISDKFHNGGSNDVRSFQLMGLGPKDLHDSLGGDAFVSYGVSLFSRLPFKRWSDS 417

Query: 409 PLRLQSFINFGDVLNNWRD------ANLERKPALSTGISLIYSASFANLDLSYSLPLRVR 462
             RL +F N   ++N   D      ++L R+ + STGI L+     A  +L++ +PL   
Sbjct: 418 NFRLHAFFNGARLINTNGDQLKNCISSLAREHSTSTGIGLVLGHPVARFELNFGIPLTAH 477

Query: 463 DYDIAKPGLTFGLDLSFF 480
             D A+ G  +G+ LSF 
Sbjct: 478 TSDSARKGFQYGIGLSFL 495

>KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.304
           YNL026W
          Length = 456

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 63/142 (44%), Gaps = 17/142 (11%)

Query: 354 NKSKPLVHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFYKLGISSSFKLPNTPI- 406
           N +K  +H  D F  GGP  ++ F+ N +G R      GG  F   G+S   K+P     
Sbjct: 317 NPAKSYIHFTDKFQNGGPNDVRNFQLNGIGPRHMHHSMGGDAFIAYGVSLFSKIPLKRFQ 376

Query: 407 DSPLRLQSFINFGDVLNN--------WRDANLERKPALSTGISLIYSASFANLDLSYSLP 458
           DS  RL  + N G ++N+         R+  LE   ++  GI  +     A  +L++ +P
Sbjct: 377 DSNFRLHWYFNGGKLINHNNLPIHTLLRELTLEHSTSIGAGI--VMRHPMARFELNFGVP 434

Query: 459 LRVRDYDIAKPGLTFGLDLSFF 480
           L     D+ + G  FGL   F 
Sbjct: 435 LTSHVGDLQRKGFQFGLGFEFL 456

>AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL026W
           (SAM50)
          Length = 495

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 75/156 (48%), Gaps = 14/156 (8%)

Query: 338 LVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFY 391
           L  S  L AG I   +   +P +H+ D F+ GG   ++GF+   +G +      GG  F 
Sbjct: 341 LTLSTTLKAGYIKNLQPGLRP-IHIRDKFHCGGANDVRGFQLMGLGPKDAQDSLGGDAFL 399

Query: 392 KLGISSSFKLP-NTPIDSPLRLQSFINFGDVLNNWRDANLE------RKPALSTGISLIY 444
             G+S   +LP      S  RL  F+N G +L++   + L+       + ++S G  L++
Sbjct: 400 TYGLSLFSRLPVQRWAGSDFRLHWFLNGGRLLSHNGASLLDVGTTLLEEHSISCGTGLLF 459

Query: 445 SASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
               A  +L+++LPL     D A+ G  +G+ +SF 
Sbjct: 460 QHPVARFELNFTLPLATHSSDTARKGFQYGIGVSFL 495

>Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {ON}
           YNL026W - 1:1 [contig 27] FULL
          Length = 496

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 92/206 (44%), Gaps = 28/206 (13%)

Query: 289 FPVSGKRVQLFHEYILSQGFTNSKPLPHESNFDKLSVSYETHRPFFNTKLVT-SLHLDAG 347
           FP++G  +++ +E  L++             F K S  +   R + N    T S  +  G
Sbjct: 305 FPLAGSFLKISNEIALNK-------------FWKSSFEFSNVRSWCNNDFFTASGTVKGG 351

Query: 348 AIFPWKNKSKPLVHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFYKLGISSSFKL 401
            I  +  ++KPL H+ D F+ GG   ++ F+   +G +      GG  F   G+S   +L
Sbjct: 352 YINNFHPQTKPL-HVSDKFHNGGSNDVRSFQLMGLGPKDLYDSMGGDAFVSYGVSIFSRL 410

Query: 402 P-NTPIDSPLRLQSFINFGDVLNNWRD------ANLERKPALSTGISLIYSASFANLDLS 454
           P     +S  RL +F N   ++N          + L  + + STG+ L++    A  +L+
Sbjct: 411 PIKRWSESNFRLHAFFNGARLINTNGTPFKSSLSTLASEHSTSTGVGLVFGHPVARFELN 470

Query: 455 YSLPLRVRDYDIAKPGLTFGLDLSFF 480
           + +PL     D  + G  +G+ LSF 
Sbjct: 471 FCVPLTAHSSDSIRKGFQYGIGLSFL 496

>TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON}
           Anc_2.304 YNL026W
          Length = 503

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 80/174 (45%), Gaps = 15/174 (8%)

Query: 320 FDKLSVSYETHRPFFNTKLVT-SLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSLKGFE 378
           F K ++    ++ FF    +T +     G I  +   SK  +H  D F  GG   ++GF+
Sbjct: 330 FFKTNLEIVKNKSFFRDDFITMACTFKTGYIHNFFPNSKA-IHRNDKFQNGGANDIRGFQ 388

Query: 379 RNCVGNR------GGLYFYKLGISSSFKLPNTPI-DSPLRLQSFINFGDVLNNWRDA--- 428
              +G +      GG  F   G S   K+P     DS  R   F+N G ++N+       
Sbjct: 389 FMGLGPKDRFDSVGGDAFISYGFSVMNKIPIWKFYDSNFRFHWFVNGGKLINSNGKGLLN 448

Query: 429 ---NLERKPALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSF 479
              +L ++ ++S G+ +++    A  +L++++P+     DI + G  +G+ LSF
Sbjct: 449 TFNDLSKQNSMSVGMGIVFRHPMARFELNFAIPVVTHSGDITRKGFQYGIGLSF 502

>ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 86/205 (41%), Gaps = 25/205 (12%)

Query: 290 PVSGKRVQLFHEYILSQGFTNSKPLPHESNFDKLSVSYETHRPFFNTKLVT-SLHLDAGA 348
           PVS  R  LF  Y       N   L     F K  +     + +F    +T +  L  G 
Sbjct: 299 PVSASRGSLFRWY-------NELSL---GKFWKSQIELSKAQSWFRDDWLTVNGTLKTGY 348

Query: 349 IFPWKNKSKPLVHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFYKLGISSSFKLP 402
           I  +   S+ L ++ D F  GG   ++ F+   +G +      GG  F   G+S   +LP
Sbjct: 349 IHNFHPTSQSL-NICDKFQNGGGNDVRSFQYMGLGPKDIYDSIGGDAFVSYGVSVFTRLP 407

Query: 403 NTPID-SPLRLQSFINFGDVLNNWRDA------NLERKPALSTGISLIYSASFANLDLSY 455
              I  S  RL  F+N G ++N+   +      NL  + + S G  L+     A  +L++
Sbjct: 408 FHKISHSNFRLHWFLNGGKLINHNNSSLQDVIKNLSTQHSTSIGFGLVLKHPVARFELNF 467

Query: 456 SLPLRVRDYDIAKPGLTFGLDLSFF 480
           +LP+     D  + G  +G+ LSF 
Sbjct: 468 ALPVTCHTGDCIRKGFQYGIGLSFL 492

>TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.304
           YNL026W
          Length = 494

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 66/156 (42%), Gaps = 14/156 (8%)

Query: 338 LVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSLKGFERNCVGNR------GGLYFY 391
           L +   L +G I    +  KP ++  D F+ GG   ++ F    +G +      GG  F 
Sbjct: 340 LGSCCTLRSGYIQNLSSSRKP-INTFDKFHNGGANDIRSFHIMGLGPKDLYDSIGGDAFV 398

Query: 392 KLGISSSFKLP-NTPIDSPLRLQSFINFGDVLNNWRD------ANLERKPALSTGISLIY 444
             G+S   +LP      S  RL  F N G ++N+           L  + + S G  ++ 
Sbjct: 399 AYGVSFFSRLPIKRWSHSNFRLHWFFNGGKLINHNNAPFTNILEQLASEHSTSVGFGILL 458

Query: 445 SASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480
               A  +L+++LPL     D  + G  +G+ +SF 
Sbjct: 459 RHQVARFELNFTLPLTCHSGDALRKGFQYGIGISFL 494

>Ecym_8269 Chr8 complement(542814..543683) [870 bp, 289 aa] {ON} no
           homolog in Ashbya gossypii
          Length = 289

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 8/95 (8%)

Query: 47  ILADPLQKVDSAFKSCEDIQKKLLFTG--LFQSAEITLDHDVDVRSSRLLTENVPKT--L 102
           +L  P ++V+ A KS E   +KLL     LF   E+TL  + D+ SSR    N   T   
Sbjct: 136 LLEKPCRRVNDADKS-ELRHRKLLIKTDPLFTKKEVTLKWEKDITSSRKAFNNRIATELA 194

Query: 103 DIELPIPTIAQVKLVPAVYNKGSLSTTTRDTYSSA 137
           D   P+  +A    +P  Y++  L+     ++ S+
Sbjct: 195 DFRRPVEPVA---FIPDRYDEEELTVVYTKSWKSS 226

>KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 5/56 (8%)

Query: 409 PLRLQSFINFGDVLNNWRDANLERKPALSTGISLIYS----ASFANLDLSYSLPLR 460
           PL  Q F  F D    W+D NL   P +S+  S IYS    AS A +D   S  ++
Sbjct: 111 PLNTQRFDGFQDAEERWQDKNLPSVPMISSN-SFIYSIAGTASSAAIDSHVSQEMQ 165

>ZYRO0D08118g Chr4 complement(702839..705076) [2238 bp, 745 aa] {ON}
           similar to uniprot|P37254 Saccharomyces cerevisiae
           YNR033W
          Length = 745

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 53/142 (37%), Gaps = 21/142 (14%)

Query: 35  VSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLL----FTGLFQSAEITLDHDVDVRS 90
           +S + YQ+++  +       +  +  S  D+ K  L     TG  +   + L H+++ R 
Sbjct: 614 MSVEEYQTVYQMVSVVQAHNLSKSIYSGLDVLKHSLPPGSMTGAPKKITVQLLHELEERK 673

Query: 91  SRLLTENVPKTLDIELPIPTIAQVKLVPAVYNKGSLSTTTRDTYSSAGARLFWINKFGNA 150
            R +   V   L +                 N+   S   R  YS  G  L W+   G A
Sbjct: 674 RRGVYSGVTGYLSMN----------------NRADWSVNIRCLYSYNGG-LRWMCGAGGA 716

Query: 151 ETISLQGDVNYTPFNGKLDERL 172
            T+  QG+      N KLD  L
Sbjct: 717 ITVLSQGESELAELNTKLDSAL 738

>TBLA0H00970 Chr8 (209566..212175) [2610 bp, 869 aa] {ON} Anc_8.384
           YLR166C
          Length = 869

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 7/75 (9%)

Query: 20  YFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTGLFQSAE 79
           YF  + ++ DN LS   D  Y  +F++ L D     D   +S E I        + +++ 
Sbjct: 400 YFQALELNSDNNLSSTLDQCYSDLFSKYLFDRSNYFDIEKRSLEAIL-------IEKTSN 452

Query: 80  ITLDHDVDVRSSRLL 94
            +L H+ +VRS  LL
Sbjct: 453 FSLKHEKEVRSKALL 467

>KAFR0I02250 Chr9 complement(460748..461533) [786 bp, 261 aa] {ON}
           Anc_1.409 YCL010C
          Length = 261

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 125 SLSTTTRDTYSS--AGARLFWINKFGNAETISLQGDVNYTPFNG 166
           S+ TT  +T +S  A A+ +W++++   ETI +  +V Y P  G
Sbjct: 92  SMPTTRNNTPTSLHAEAKQYWVSQYNPVETIKVGSEVAYRPKRG 135

>NCAS0E02970 Chr5 (590020..592896) [2877 bp, 958 aa] {ON} Anc_7.436
           YBL101C
          Length = 958

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 288 RFPVSGKRVQLFHEYILSQGFTNSKPLPHE-SNFDKLSVSYET 329
           R P +    ++ ++Y++SQGF N+K + H+ +N D L +S  T
Sbjct: 102 RSPTTLNHKEILNDYLVSQGFLNAKQVSHKNNNNDHLQISMAT 144

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,904,871
Number of extensions: 2515014
Number of successful extensions: 6465
Number of sequences better than 10.0: 49
Number of HSP's gapped: 6592
Number of HSP's successfully gapped: 49
Length of query: 480
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 367
Effective length of database: 40,524,141
Effective search space: 14872359747
Effective search space used: 14872359747
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)