Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E02201g5.435ON83583540660.0
SAKL0G02552g5.435ON8344203993e-39
KLTH0F16038g5.435ON7923953558e-34
Kwal_55.214225.435ON7824013503e-33
ZYRO0F10054g5.435ON6603672852e-25
Ecym_47615.435ON7984012817e-25
AER402C5.435ON8693932745e-24
NCAS0F033905.435ON8612592631e-22
NDAI0B056805.435ON8564112603e-22
Skud_4.6385.435ON8434002282e-18
Suva_2.5415.435ON8692282211e-17
KNAG0C049005.435ON7693922156e-17
YDR369C (XRS2)5.435ON8542262069e-16
Smik_4.6355.435ON8632021987e-15
TDEL0E019005.435ON7624121881e-13
KAFR0E038305.435ON8452381801e-12
TBLA0A028205.435ON9254231755e-12
TPHA0J025905.435ON7753711682e-11
CAGL0A02838g5.435ON8282111665e-11
Kpol_1016.55.435ON8121891551e-09
TBLA0A072606.20ON120457734.6
YDR216W (ADR1)8.425ON1323148726.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E02201g
         (835 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...  1570   0.0  
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   158   3e-39
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   141   8e-34
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...   139   3e-33
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   114   2e-25
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...   112   7e-25
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...   110   5e-24
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...   105   1e-22
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   104   3e-22
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...    92   2e-18
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...    90   1e-17
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...    87   6e-17
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...    84   9e-16
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...    81   7e-15
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...    77   1e-13
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...    74   1e-12
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...    72   5e-12
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...    69   2e-11
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...    69   5e-11
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....    64   1e-09
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...    33   4.6  
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    32   6.3  

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score = 1570 bits (4066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 787/835 (94%), Positives = 787/835 (94%)

Query: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGSDL 60
           MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGSDL
Sbjct: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGSDL 60

Query: 61  IITNKGKLTKFNEEIIPLDETIVVHNQNTVINIGGMPIDVNVRYFYEEWKIPHRLELNET 120
           IITNKGKLTKFNEEIIPLDETIVVHNQNTVINIGGMPIDVNVRYFYEEWKIPHRLELNET
Sbjct: 61  IITNKGKLTKFNEEIIPLDETIVVHNQNTVINIGGMPIDVNVRYFYEEWKIPHRLELNET 120

Query: 121 KSLVSDFGVKLSESFSKKTTTQICSDSSSYSGCLFALLKGVPVVSIEFLNQMGKLLQQGN 180
           KSLVSDFGVKLSESFSKKTTTQICSDSSSYSGCLFALLKGVPVVSIEFLNQMGKLLQQGN
Sbjct: 121 KSLVSDFGVKLSESFSKKTTTQICSDSSSYSGCLFALLKGVPVVSIEFLNQMGKLLQQGN 180

Query: 181 YLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEVGGGDAKLLAN 240
           YLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEVGGGDAKLLAN
Sbjct: 181 YLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEVGGGDAKLLAN 240

Query: 241 SSELDKFLSTNHEPAVVLGSSISQKMNSESTKLLEEFDKSIAETSLRHGVKLLNINQFVN 300
           SSELDKFLSTNHEPAVVLGSSISQKMNSESTKLLEEFDKSIAETSLRHGVKLLNINQFVN
Sbjct: 241 SSELDKFLSTNHEPAVVLGSSISQKMNSESTKLLEEFDKSIAETSLRHGVKLLNINQFVN 300

Query: 301 ILLENKINGLKKRDVVDLTSPSPVQQKKIQSAKASVNGKKTKSKPNIQSLDSLNFFGGGN 360
           ILLENKINGLKKRDVVDLTSPSPVQQKKIQSAKASVNGKKTKSKPNIQSLDSLNFFGGGN
Sbjct: 301 ILLENKINGLKKRDVVDLTSPSPVQQKKIQSAKASVNGKKTKSKPNIQSLDSLNFFGGGN 360

Query: 361 LEVTQNEEKHEPVISHTXXXXXXXXXXXXAFVPYNDNQDLDTSANGNTKTLPSYITNKSS 420
           LEVTQNEEKHEPVISHT            AFVPYNDNQDLDTSANGNTKTLPSYITNKSS
Sbjct: 361 LEVTQNEEKHEPVISHTSESKVKVKEESKAFVPYNDNQDLDTSANGNTKTLPSYITNKSS 420

Query: 421 LGGMSTEPANQPHTSTKKDDRTELXXXXXXXXXXXXLDNLMMRSSSQQATQIEPDDRNDK 480
           LGGMSTEPANQPHTSTKKDDRTEL            LDNLMMRSSSQQATQIEPDDRNDK
Sbjct: 421 LGGMSTEPANQPHTSTKKDDRTELQKVRRKRPRVQQLDNLMMRSSSQQATQIEPDDRNDK 480

Query: 481 LKLRRIGDTASNVNAEGVLPSNSPSNAENMIKNIKTPDISNKNPTLSAISLLEPGGAEHV 540
           LKLRRIGDTASNVNAEGVLPSNSPSNAENMIKNIKTPDISNKNPTLSAISLLEPGGAEHV
Sbjct: 481 LKLRRIGDTASNVNAEGVLPSNSPSNAENMIKNIKTPDISNKNPTLSAISLLEPGGAEHV 540

Query: 541 SAKKNLISDGGKSIDAQSSNRIEQNMGNMTELDSRPHSVARLETDLQVRSSTNIITAIAE 600
           SAKKNLISDGGKSIDAQSSNRIEQNMGNMTELDSRPHSVARLETDLQVRSSTNIITAIAE
Sbjct: 541 SAKKNLISDGGKSIDAQSSNRIEQNMGNMTELDSRPHSVARLETDLQVRSSTNIITAIAE 600

Query: 601 TKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQIKPRVLASIPISNGNTKWLGR 660
           TKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQIKPRVLASIPISNGNTKWLGR
Sbjct: 601 TKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQIKPRVLASIPISNGNTKWLGR 660

Query: 661 KNFKKFKKNWPSYLRRTTEGLCSDNTSNQIGREYITMRKYDSRKAKKHIAEEMDEIDIFP 720
           KNFKKFKKNWPSYLRRTTEGLCSDNTSNQIGREYITMRKYDSRKAKKHIAEEMDEIDIFP
Sbjct: 661 KNFKKFKKNWPSYLRRTTEGLCSDNTSNQIGREYITMRKYDSRKAKKHIAEEMDEIDIFP 720

Query: 721 CRSHSNSVGVMDIAIANTEHDSGFRFSNREYSIPTRSLFVAXXXXXXXXXXXXXXALAIY 780
           CRSHSNSVGVMDIAIANTEHDSGFRFSNREYSIPTRSLFVA              ALAIY
Sbjct: 721 CRSHSNSVGVMDIAIANTEHDSGFRFSNREYSIPTRSLFVADDDDDEENETSNNSALAIY 780

Query: 781 GQNNEQHYEGVGPAAAVSIRSPXXXXXXXXXXKLGDTDDEEDDTPRFNFRSRREI 835
           GQNNEQHYEGVGPAAAVSIRSP          KLGDTDDEEDDTPRFNFRSRREI
Sbjct: 781 GQNNEQHYEGVGPAAAVSIRSPATVSTASSVAKLGDTDDEEDDTPRFNFRSRREI 835

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  158 bits (399), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 117/420 (27%), Positives = 203/420 (48%), Gaps = 66/420 (15%)

Query: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDG-SD 59
           MWI+ + +D E      +   L+ G+ Y IGRS K    I+ DKSISR H+ +K +  ++
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLKVNKENE 60

Query: 60  LIITNKGKLTKFNEEIIPLDETIVVHNQNTV-INIGGMPIDVNVRYFYEEWKIPHRLELN 118
           L + N GKLT  N E++ +D+++  H +  + + +G  PI   + +  + WK+ H L  N
Sbjct: 61  LNLLNTGKLTTLNAEVLMVDQSLNFHPKGQLRLELGIKPIIATIEWQDQVWKVSHDLLYN 120

Query: 119 ET--KSLVSDFGVKLSESFSKKTTTQIC-SDSSSYSGCLFALLKGVPVVSIEFLNQMGKL 175
               +   + +G+ ++ + S +T  QI   +  +YS CLF+L+KG+ +V   FL+     
Sbjct: 121 SMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLSDFQSH 180

Query: 176 LQQGNYL---DFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEVGG 232
           L    Y+   D+  +++ LL +H +FP++    ++  N+++IV  + +Y+  +YTIEV G
Sbjct: 181 L----YMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVAG 236

Query: 233 GDAKLLANSSELDKFLS-TNHEPAVVLGSSISQKM----------NSESTKLLEEFDKSI 281
           G+     N  + ++F+    H   V++   I++             SE  + LEE  K+ 
Sbjct: 237 GELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSEDARKLEEL-KAA 295

Query: 282 AETSLRHGVKLLNINQFVNI--------LLENKINGLKKRDVVDLTSP----------SP 323
           AE+    G KL ++N  V+         LLE     +  R   DL  P          +P
Sbjct: 296 AESL---GYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITP 352

Query: 324 VQQK--------------------KIQSAKASVNGKKTKSKPNIQSLDSLNFFGGGNLEV 363
           V  K                    +I   K  V  K+T ++  ++ LDSL+FF GGN++ 
Sbjct: 353 VPDKVSETAPFKGQLENSTARNDFEIMEQKIPVKRKRT-NRSKVRPLDSLDFFAGGNIQA 411

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 113/273 (41%), Gaps = 40/273 (14%)

Query: 591 STNIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQ-IKPRVLASIP 649
           ST ++ AI +TK +EV RL+  +I++D++ELTE+A+    + A +     I+        
Sbjct: 572 STALVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEKKDLIRKNSERGHC 631

Query: 650 ISNGNTKWLGRKNFKKFKKNWPSYLRRTTEGLCSD------NTSNQIGREYITMRKYDSR 703
           IS+    W GRKNFKKF K  P   +R  E   SD      N++  I REY+ ++K+D  
Sbjct: 632 ISSDTCLWEGRKNFKKFIKVQPRRSQR--ETFDSDGKNIVKNSAFLITREYVPLKKFD-- 687

Query: 704 KAKKHIAEEMDEIDIFPCRSHSNSVGVMDIAIANTEHDSGF------------RFSNREY 751
                   E ++ID     +HS + G +       +  S F            R  +++ 
Sbjct: 688 ------PNEKEQIDDTFFLNHSANEGPIPAQPRRIDETSNFTDDEEGPVFNFKRTKSKDP 741

Query: 752 SI-PTRSLFVAXXXXXXXXXXXXXXALAIYGQNNEQHYEGVGPAAAVSIRS--------- 801
           SI P +   +                L +  +++ Q       +     RS         
Sbjct: 742 SISPRKEHTLTNGDIEMKETSRSENRLFVTDEDDFQSLNITDNSIEAPERSISNPLRVND 801

Query: 802 -PXXXXXXXXXXKLGDTDDEEDDTPRFNFRSRR 833
            P          +  +  D++DD PRF F SRR
Sbjct: 802 KPSSGGNTSRLPRFTEASDDDDDEPRFRFSSRR 834

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  141 bits (355), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 109/395 (27%), Positives = 188/395 (47%), Gaps = 55/395 (13%)

Query: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKF-DGSD 59
           MWI+ + + DE     +V   L+ G +Y +GRS K   +I+ DKSISR H+ ++    S 
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60

Query: 60  LIITNKGKLTKFNEEIIPLDETIVV-HNQNTVINIGGMPIDVNVRYFYEEWKIPHRLELN 118
           L + N GKLTK   + + +D+ +    +Q+  + +G  P+   V Y    WKIPH L + 
Sbjct: 61  LEVLNAGKLTKIGGDNVKMDQMLEFGADQSVALEMGAGPVKGTVTYEPAIWKIPHDLAIT 120

Query: 119 ET-KSLVSDFGVKLSESFSKKTTTQICSD-SSSYSGCLFALLKGVPVVSIEFLNQMGKLL 176
           E+ K+ +S + ++++ S + KT+ QI  +   S+  CLFAL+K +P++   F+   G  +
Sbjct: 121 ESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFI---GDFV 177

Query: 177 QQ--GNYLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEVGGGD 234
            Q     +DF + ++ +  ++  F   +        +  +V  QK +   +  I+ G G+
Sbjct: 178 SQFADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAGSGN 237

Query: 235 AKLLANSSELDKFLSTN----------H--EPAVVLGSSISQKMNSESTKLLEEFDKSIA 282
             L  + S L  F+             H  E A  L S  +  M+ +  KLL+   +S+ 
Sbjct: 238 LWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQEAKLLKNKARSL- 296

Query: 283 ETSLRHGVKLLNINQFVNILLENKINGLKKRDVVDLTSPSPVQQKKIQ--SAKASVNG-- 338
                 G K  ++N  V+ +L+N        D++ L    P Q+K ++  SA  S+ G  
Sbjct: 297 ------GFKTRDVNDIVDAVLKN--------DILSLLDRVP-QEKALEENSAGGSIAGSQ 341

Query: 339 --------------KKTKSKPNIQSLDSLNFFGGG 359
                         K+ ++   IQ L+SL FFGGG
Sbjct: 342 VLADIVADAPNLRNKRKRANRQIQPLNSLAFFGGG 376

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 94/202 (46%), Gaps = 30/202 (14%)

Query: 579 VARLETDLQ-VRSSTNIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINT 637
           ++  +T++Q ++   ++I A  E KQ EV RL++ + +V   ELTE A+    + A +  
Sbjct: 512 ISHADTEVQAIKRPRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEK 571

Query: 638 IQIKPRVLASIPISNG-----NTKWLGRKNFKKFKKNWPSYLRRTTEGLCSDNTSNQ--- 689
           + +  R  + +P ++      N +W  RKNFKKF K WPS+  R++    +D   N+   
Sbjct: 572 VDLMRRP-SEVPENSNQRILTNPQWARRKNFKKFVKLWPSHSSRSSPDNITDAVRNKAYL 630

Query: 690 IGREYITMRKYDSRK-----------AKKHIAEEMDEIDIFPCRSHSNSVGVMDIAIANT 738
           I R+Y+++  YD  +            ++H A E   +   P        G + +     
Sbjct: 631 ITRDYVSLCPYDGTRNNSADDGFGDACQQHAAAEQSNLTASP--------GNLALLGVEV 682

Query: 739 EHDSGFRF-SNREYSIPTRSLF 759
           E+   F F S R  +    SLF
Sbjct: 683 ENGPAFAFQSQRAANSQANSLF 704

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score =  139 bits (350), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 110/401 (27%), Positives = 200/401 (49%), Gaps = 33/401 (8%)

Query: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGS-D 59
           MWI+ + +         V   L+ G++YSIGRS K   +I++DKSISR H+ ++ D S +
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60

Query: 60  LIITNKGKLTKFNEEIIPLDETI-VVHNQNTVINIGGMPIDVNVRYFYEEWKIPHRLELN 118
           +++   GKLTK + + +   + +    ++  +  +G  PI   V      WKIPH L L+
Sbjct: 61  VVLRVVGKLTKVSGKSVKAGQHLQFTADEEVLFEMGASPIKATVVKQQSFWKIPHDLSLS 120

Query: 119 ETKSL-VSDFGVKLSESFSKKTTTQICSDSS-SYSGCLFALLKGVPVVSIEFLNQMGKLL 176
           ++ S  ++DF ++++ S S  T+ QI  DSS S+S CLF+L+K +P++   F+   G  +
Sbjct: 121 QSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFI---GDFV 177

Query: 177 QQGN--YLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEVGGGD 234
            Q N  + DF S +  ++  +  FP+Y+      + +  +V  ++ +   ++ I+ G G 
Sbjct: 178 TQINDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDAGSGT 237

Query: 235 AKLLANSSELDKFL--STNHEPAVVLGSSISQKMNSESTKLLEEFD----KSIAETSLRH 288
             L  + S LD F+      +  ++L    + K +  ST+   + D    K +   +   
Sbjct: 238 LWLCDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLDVQEAKLLKNKAQNL 297

Query: 289 GVKLLNINQFVNILLENKINGLKKR-DVVDLTSPSPVQQKKIQSAKASV---------NG 338
           G ++ ++N  V  +L++    L +R  V +L S +P      ++   SV         + 
Sbjct: 298 GFRIHDVNDIVGAVLDHNFEKLLERVPVRNLPSKAPTGFPLEEATNKSVIKSADTPKPSN 357

Query: 339 KKTKSKPNIQSLDSLNFFGGGNL--------EVTQNEEKHE 371
           K+ ++   +  LDSL FFGGG+         EV ++E  HE
Sbjct: 358 KRKRTNRQVVPLDSLAFFGGGSAAESKQNPTEVPESERGHE 398

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 109/260 (41%), Gaps = 27/260 (10%)

Query: 597 AIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQI--KPRVLASIPISNGN 654
           A+ ETK  EV RL++ I+ V   ELTE A+      A + T  +    R  A    S G+
Sbjct: 526 AVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVETKDLMRADREYAVCGQSGGS 585

Query: 655 TKWLGRKNFKKFKKNWPSYLRRTTEGLCSD---NTSNQIGREYITMRKYDSRKAK----- 706
            +W GRKNFKKF K WPS   R +    ++   N ++ I REY+ +R Y+ + A      
Sbjct: 586 EQWAGRKNFKKFVKLWPSRSSRNSPDSATNALRNRAHLITREYVPLRPYEGQNANNQDDS 645

Query: 707 --KHIAEEMDEIDIFPCRSHSNSVGVMDIAIANTEHDSGFRFSNRE----YSIPTRSLFV 760
             K+  +++ E    P     +S  ++ + +   + +  F F +++    Y  P   L  
Sbjct: 646 FLKNSQDDLQEEATCPSIPPVSSTTILGVEV---DDEPAFLFRSQQEDDAYG-PDGGLGQ 701

Query: 761 AXXXXXXXXXXXXXXALAIYGQNNEQ------HYEGVGPAAAVSIRSPXXXXXXXXXXKL 814
                           L ++ + + Q      + + V   +A   R              
Sbjct: 702 RNQHTSVDKDSNRDQELFVFDEEDSQRDHVDTYTDAVQSRSASGARYQQPEPSISASKNC 761

Query: 815 GDTD-DEEDDTPRFNFRSRR 833
              D DE DD PRF F+SR+
Sbjct: 762 APQDSDESDDEPRFQFQSRK 781

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 91/367 (24%), Positives = 176/367 (47%), Gaps = 34/367 (9%)

Query: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGSD- 59
           MWI+ + +D E      V   L+ G  Y+IGRS+K    I+ DKSISR H+ I +DG D 
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60

Query: 60  -LIITNKGKLTKFNEEIIPLDETIVVHNQ--NTVINIGGMPIDVNVRYFYEEWKIPHRLE 116
            L + N+GK+T  +E+ + + E+I         ++ +G  P+ + +++    W +P    
Sbjct: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQGSR 120

Query: 117 LNETKSLVSDFGVKLSESFSKKTTTQICSDSSSYSGCLFALLKGVPVVSIEFLNQMGKLL 176
            +   S + + G+++  S   +    +  +  +YS  L+ L+K +P++++EFLN + + +
Sbjct: 121 SDH--SALEELGIEVLSSELSRANLIVIDEQQNYSRWLYGLVKRIPLMNLEFLNVVSQKV 178

Query: 177 QQGNYLDFQSMYQGLLNRHKL-FPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEVGGGDA 235
             G+  +F S++  ++N   L + S+     VL N+  +   +    +L   IE  GG  
Sbjct: 179 -SGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTSL--AIEAAGGKY 235

Query: 236 KLLANSSELDKFLSTNHEPA--VVLGSSISQKMNSESTKLLEEFDKSIAETSLRHGVKLL 293
             + +  EL + +    + +  V+L S ++                  AE     G K  
Sbjct: 236 SAVLSVEELREAVKRKGDLSNVVILKSHLTP-----------------AEELAPLG-KTF 277

Query: 294 NINQFVNILLENKINGLKKRDVVDLTSPSPVQQKKIQSAKASVNGKKTKSKPNIQSLDSL 353
            +   V  +L++++N LK   V+   +  P  +  ++     V  K+  ++P ++ LD L
Sbjct: 278 TVQDVVEAILKDEVNSLKN-GVIGEVAKRPEAEVPMEKP---VTKKRRLNRPRVKPLDIL 333

Query: 354 NFFGGGN 360
           +FF GG+
Sbjct: 334 SFFAGGD 340

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 75/157 (47%), Gaps = 24/157 (15%)

Query: 573 DSRPHSVARLETDL---QVRSSTNIITAIAETKQKEVKRLQEGIIEVDQSELTESA---- 625
           ++RPH    L +D    +  S  ++I  I +TK  EVKRL   II+V   ELTE A    
Sbjct: 437 NARPHRKPTL-SDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQL 495

Query: 626 ----LIDFKDAAKINTIQIKPRVLASIPISNGNTKWLGRKNFKKFKKNWPSYLRR--TTE 679
               L+D  D    N ++ + R   S  + + N  W  RKNFK F K WP Y  +  T+ 
Sbjct: 496 GNLVLVDRND----NLMRRRDR---SPTVDSHNPNWNNRKNFKNFVKVWPKYGGQDSTSR 548

Query: 680 GLCSDNTSNQ---IGREYITMRKYDSRKAKKHIAEEM 713
              SD   N+   + R+Y+  R Y S  + K   E++
Sbjct: 549 EGSSDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQEDL 585

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score =  112 bits (281), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 109/401 (27%), Positives = 186/401 (46%), Gaps = 37/401 (9%)

Query: 1   MWIVSFIFDDEAEKS--HKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGS 58
           MWI    + ++ +    + +   ++    Y +GR++K +  I  ++ +SR HL +K + +
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVID-ERGVSRTHLQLKANRN 59

Query: 59  DLIITNKGKLTKFNEEIIPLDETIVVHNQNTVIN--IGGMPIDVNVRYFYEEWKIPHRLE 116
            + IT  G   K   + I    +   H + + +   +G   I+  + +   E+K+P  LE
Sbjct: 60  IIEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDLE 119

Query: 117 LNE---TKSLVSDFGVKLSESFSKKTTTQICSD---SSSYSGCLFALLKGVPVVSIEFLN 170
           +N    TK  V   G+K+  S SK+T+ QI         Y   LFAL+KG+P+V + FL 
Sbjct: 120 INYIALTKMFV-QLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLK 178

Query: 171 QMGKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEV 230
            +  LL   + L F+S  + L     +FP +  +PN L  +  IV E+  +D L+YTIEV
Sbjct: 179 GISSLLN-SDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEKDEFDILKYTIEV 237

Query: 231 GGGDAKLLANSSELDKFLSTNHEPAVVL---GSSISQKMNSEST---KLLEEFDKSIAET 284
           GGG         +  K  ST     V+L    ++IS  ++++      +L E   SI   
Sbjct: 238 GGGTVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNILLEKAHSIGFK 297

Query: 285 SLRHGVKLLNI----NQFVNILLENKIN-----GLKKRDVVDLTSPSPVQQKKIQSAKAS 335
             +H  + L I    N F   L+++ I+          D +  TS S     K+  +  S
Sbjct: 298 --QHDTRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDGLKVNVSATS 355

Query: 336 VNGKKTKSKP-------NIQSLDSLNFFGGGNLEVTQNEEK 369
                T+  P       +++ LDSL+FF GG++E +   E+
Sbjct: 356 GLNLNTEGPPAKKRRINSVKPLDSLSFFAGGSIERSTRVER 396

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 65/121 (53%), Gaps = 5/121 (4%)

Query: 583 ETDLQVRSSTNIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQIKP 642
           ++ L  +S ++I+ AI E K++EV R++  I+E+   ELTE A+      A + ++ +  
Sbjct: 515 DSTLSTQSHSSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVESVDMLR 574

Query: 643 RVLASIPISNGNTKWLGRKNFKKFKKNWPSYLRRTTEGLCSDNTSNQ--IGREYITMRKY 700
           +  +    +  N +   R+NFK+F K WP+YL +    +C D    Q    R+ + ++ Y
Sbjct: 575 KTQSRHMKTETNKRHHVRRNFKRFVKVWPAYLNK---AICQDPMGAQRYSNRQCVPLKVY 631

Query: 701 D 701
           +
Sbjct: 632 E 632

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score =  110 bits (274), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 96/393 (24%), Positives = 177/393 (45%), Gaps = 46/393 (11%)

Query: 1   MWIVSFIFDDEAEKS--HKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGS 58
           MW+    +    +      +  AL    E+ +GR++K T  I+ +K +SR HL ++    
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEVIDD 59

Query: 59  DLIITNKGKLTKFNEE------IIPLDETIVVHNQNTVINIGGMPIDVNVRYFYEEWKIP 112
            + I   G   K   E      ++P   +        ++ +G   +   + +   E+K+P
Sbjct: 60  HVNILLLGSQLKVGGEDASKGSVLPFGPS----QSPVILEVGSHSVQCILEWAQWEFKVP 115

Query: 113 HRLELNETKSL---VSDFGVKLSESFSKKTTTQIC---SDSSSYSGCLFALLKGVPVVSI 166
           + L L E  +L   +   G+++  SFSK TT  I     D   Y   LFAL+KG+P++ +
Sbjct: 116 NTL-LQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHL 174

Query: 167 EFLNQMGKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRY 226
           EFL Q   LL+Q    DF    + +  +H  F  +      L+ +  IV  +  ++ L+Y
Sbjct: 175 EFLKQFTALLRQP-VTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKY 233

Query: 227 TIEVGGGDAKLLANSSELDKFLSTNHEPAVVLGSSISQKMNSESTKLLEEFDKS-IAETS 285
           T+E+GGG      + ++L   L T     + +  +++ K +   +  +++ D +   E  
Sbjct: 234 TLEIGGGTVHFCHDINDLSACLKT-----IPINGALALKYDHGISAEVKKVDDTRYCEVL 288

Query: 286 LRHGVKLLNINQFVNILLENKINGL---KKRDVVDLTSPSP-----VQQKKIQSAKASVN 337
             HG++L  +++    +L +K+  L   +   ++ L  P P      Q+ K +S      
Sbjct: 289 HSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEMKQESLSPISL 348

Query: 338 G--------KKTKSKPNI---QSLDSLNFFGGG 359
           G        +K K++  +   Q LDSL+FF GG
Sbjct: 349 GNTTIKDLPRKDKTRKRLKKPQPLDSLSFFAGG 381

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 57/113 (50%), Gaps = 8/113 (7%)

Query: 593 NIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQIKPRVLASIPISN 652
           NI+ AI + K++EV R++  I+E+   ELTE A+   K  A +  + +  R   ++    
Sbjct: 598 NIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDML-RQQHTVDTVG 656

Query: 653 GNTKWLGRKNFKKFKKNWPSYLRRTTEGLCSDNTSNQIG---REYITMRKYDS 702
            +     RKN+K FKK WP Y+ R      S  T N      R+Y+ +  Y++
Sbjct: 657 SSPLTFARKNYKNFKKVWPKYMNRKN----SPETRNATAISNRKYLPLELYET 705

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 131/259 (50%), Gaps = 39/259 (15%)

Query: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKF-DGSD 59
           MW++ + +D E   + K+ + +Q  V Y+IGRS K    I+ DKSISR HL +K+ D +D
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60

Query: 60  LIITNKGKLTKFNEEIIPLDETIVVHNQNTV-INIGGMPIDVNVRYFYEEWKIPHRL-EL 117
           + I N+GKLT   E+ + + +++   N N++ I +G  P+ V++ ++   W IP+ L + 
Sbjct: 61  IHIINQGKLTYIGEQYLDVGQSLTFGNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGLTQF 120

Query: 118 NETKSLVSDFGVKLSESF--SKKTTTQICSDSSSYSGC--LFALLKGVPVVSIEFL---- 169
           +ET   + DFGV ++      +KT   +  D  + SG   L+  +K +PV   +F     
Sbjct: 121 HET---LKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTAC 177

Query: 170 -----------NQMGKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFE- 217
                      N   +L +  N L F S Y  L +R +LF +Y         + LI+F+ 
Sbjct: 178 EILSSNDNDFDNSWHRLQETSNTL-FCSHYISLKDRSRLFENY---------VILILFDN 227

Query: 218 ---QKMYDTLRYTIEVGGG 233
              +    TL+  + +GG 
Sbjct: 228 ETNKDAVKTLKTALNLGGA 246

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 60/119 (50%), Gaps = 12/119 (10%)

Query: 594 IITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQIKPRVLAS-----I 648
            + AI ETK +EV RL+  ++E+D  ELTE A+        +   Q   R  AS      
Sbjct: 541 FVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRT 600

Query: 649 PISNGNTK----WLGRKNFKKFKKNWPSYLRRTTEGLCSD---NTSNQIGREYITMRKY 700
           P    + K    W  RKNFKKF K +P Y+++ TE   +D   N +  I R Y+ M+K+
Sbjct: 601 PTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTESDTTDLIRNNAFLITRNYVPMKKF 659

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 105/411 (25%), Positives = 194/411 (47%), Gaps = 71/411 (17%)

Query: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGS-D 59
           MWI+ + +  E     KV   L+  + YSIGRS+K    I+ DKSISR H+ IK++ S  
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60

Query: 60  LIITNKGKLTKFNEEIIPLDETI---VVHNQNTVINIGGMPIDVNVRYFYEEWKIPHRLE 116
           L + N+GKLT   E  + +DE++   VV  +   +++G  P+ V +R+      IP+  E
Sbjct: 61  LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNMYE 120

Query: 117 LNETKSLVSDFGVKLSESFSKKTT--TQICSDSSSYSGCLFALLKGVPVVSIEFLNQMGK 174
             + + L++ +G++++    ++ +  T +    + Y   L AL  G+PV   ++L ++  
Sbjct: 121 --QFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVSN 178

Query: 175 LLQQGNYLDFQSMYQGL--LNRHKLFPSYRYVPNVLSNMTLIVFEQKMYD---------- 222
           +L+  N + F +  Q +  +   KL PS+      LSN +   F+   +           
Sbjct: 179 MLRPDN-ITFDTDVQKINSMESLKLVPSFS-----LSNNSKNFFQDYFFIITLNKSSVSE 232

Query: 223 ------TLRYTIEVGGGDAKLLANSSELD----KFLSTNHEPAVVLGSSISQK---MNSE 269
                  LR ++++ GG+ +++ + +EL     K LST+ +  V++    + K   MN E
Sbjct: 233 HADKSFILRKSLQLIGGEEEIIKDPTELQNSVTKILSTSGKNIVIVTDEDNGKRMIMNFE 292

Query: 270 STKLLEEFDKSIAETSLRHGVKLLNINQFVNILLENKINGLKKRDV-------VDLTSPS 322
              +     K I ++ +++  KLL  N     L E  +   K  ++       V++  P 
Sbjct: 293 CRNV-----KDIFDSFVKNDPKLLKSN-----LTETGVVSPKAPEIFENEKLMVEIQEP- 341

Query: 323 PVQQKKIQSAKASVNGKKTKSKP--------------NIQSLDSLNFFGGG 359
           P++    + + +S N K T  +P               ++ L+SL+FF GG
Sbjct: 342 PIEAAITEESTSSKNLKHTPPEPVTTHIVKKRRLARKRVKPLESLDFFVGG 392

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 59/132 (44%), Gaps = 26/132 (19%)

Query: 594 IITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKI--------------NTIQ 639
           ++  I + K +EV RLQ  I  VD  ELTE A+ +F + A +              NT +
Sbjct: 541 MVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTNK 600

Query: 640 IKPRVLASIPISNGNTKWLGRKNFKKFKKNWPSYLR--------RTTEGLCSD---NTSN 688
               V+      N      GR+NFK+F K +P Y++        R   G  SD   N + 
Sbjct: 601 STNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNG-ASDFIRNNAF 659

Query: 689 QIGREYITMRKY 700
            I R Y+ +++Y
Sbjct: 660 LITRNYVPLKQY 671

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 103/400 (25%), Positives = 169/400 (42%), Gaps = 67/400 (16%)

Query: 1   MWIVSFIFD-DEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFD--- 56
           MW++ +    ++   SH  C  LQ    YSIGRS+K +  I+ DKSISR H+  K++   
Sbjct: 1   MWVIRYQNTVEDGHISHISC-CLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEING 59

Query: 57  -----GSDLIITNKGKLTKFNEEIIPLDETIVVHNQN----TVINIGGMPIDVNVRYFYE 107
                 S L + N+GKLT  N++ + + E  +++       T I +G  P  + V +  E
Sbjct: 60  GLNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSE 119

Query: 108 EWKIPHRLELNETKSLVSDFGVKLSESFSKKTTTQICSD--SSSYSGC--LFALLKGVPV 163
            W IP    L E ++ +S FG+    S        + SD  SS  +G   L+AL+  +P+
Sbjct: 120 IWNIPSH--LTEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPL 177

Query: 164 VSIEFLNQMGKLLQQGNY--LDFQSMYQGLLNRHKLFPSYRYVPNVLSN----MTLIVFE 217
             +  L  + K L   +   L F  M++ +LN  + F  + +  +VLS+    +  I+  
Sbjct: 178 KKLRLLVDVCKTLLPASVRNLKFDEMWKDVLNSPE-FNVFNFDASVLSSKFMKLNRIIVL 236

Query: 218 QKMYDTLRYTIEVGGGDAKLLANSSELDKFLSTNHEPAVVLGSSISQKMNSESTKLLEEF 277
               +  R +  + G + KLL      D   S  +E    L  SI   + + + K     
Sbjct: 237 TTTSNERRLSATLRGLNVKLL----NFDNMKSL-YEHVDGLKPSIKYLILTSTNK----- 286

Query: 278 DKSIAETSLRHGVKLLNINQFVNILLENKINGLKKRDVVDLTSPSPVQQKKIQS-AKASV 336
                     +G     IN  +  ++E+ +  +     V    P  +Q KK +  ++   
Sbjct: 287 --------TENGQIQCTINGLITSVIEDALPAITNTKSV----PCEIQNKKFERVSEVQS 334

Query: 337 NGKKTKSKPNI-----------------QSLDSLNFFGGG 359
              KT   P I                 Q LDSL+FF GG
Sbjct: 335 TSSKTLHTPEIEVGPAILKKRRLNRRRVQPLDSLSFFAGG 374

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 65/138 (47%), Gaps = 24/138 (17%)

Query: 586 LQVRSST---NIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINT---IQ 639
           LQ R S    + + AI ETK +EV+R +  I++++  EL+E  +   K+ A +     + 
Sbjct: 540 LQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLL 599

Query: 640 IKPRVLASIPISNGNTK---------WLGRKNFKKFKKNWPSYLRRTTEGLCSDNTSNQ- 689
            KP++L +  +     K         W  RKNFK F K WP + +   EG   D  ++  
Sbjct: 600 RKPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKF-KMQNEGNKGDTQNSDF 658

Query: 690 -------IGREYITMRKY 700
                  I R Y+ +RKY
Sbjct: 659 IRSAAFLITRNYVPLRKY 676

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 114/228 (50%), Gaps = 25/228 (10%)

Query: 1   MWIVSF--IFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFD-- 56
           MW++ +  I +D +  S   C  LQ    YSIGRS+K    I+ DKSISR H+  K++  
Sbjct: 1   MWVIRYQNILEDGSINSISCC--LQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEIN 58

Query: 57  ------GSDLIITNKGKLTKFNEEIIPLDETIVVH----NQNTVINIGGMPIDVNVRYFY 106
                 G+ L + N+GKLT  N++ + + ET  +     + +T I +G  PI +   +  
Sbjct: 59  DSLNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWID 118

Query: 107 EEWKIPHRLELNETKSLVSDFGVKLSESFSKKTTTQICSD--SSSYSGC--LFALLKGVP 162
           E W IP  L   + ++++S FG+    S    + + + SD  S++  G   L+AL+  +P
Sbjct: 119 EIWNIPSNLA--QFQTILSQFGIATKTSIDDDSASILISDFPSNNDDGMRELYALVHTIP 176

Query: 163 VVSIEFLNQMGKLLQQGNY--LDFQSMYQGLLNRHKLFPSYRYVPNVL 208
           +   + L  +   L   +   L F   +  ++N+  LF  + Y P+VL
Sbjct: 177 LKKSQLLVDLCNSLLSSSVMNLKFDETWNNMVNK-PLFKVFDYDPSVL 223

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 72/149 (48%), Gaps = 23/149 (15%)

Query: 577 HSVARLETDLQVRSST--NIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAK 634
           H+    E  L+ +S+T  + + AI +TK +EVKR++  I+E++  EL+E A+    + A 
Sbjct: 557 HNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAI 616

Query: 635 I---NTIQIKPRVLASIPISNGNTK---------WLGRKNFKKFKKNWPSYLRRTTEGLC 682
           +   N +   PR + S    +   +         W  RKNFK F K WP+  +   EG  
Sbjct: 617 VEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWPNS-KTPKEGDK 675

Query: 683 SDNTSNQ--------IGREYITMRKYDSR 703
            +N ++         I R Y+ ++KY  +
Sbjct: 676 GNNQNSDFIRSAAFLITRNYVPLKKYSKK 704

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 99/392 (25%), Positives = 169/392 (43%), Gaps = 48/392 (12%)

Query: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKC-TFRIQTDKSISRVHLLIKFDGSD 59
           MWI+ + ++ E   +  V   LQ    YSIGRS+K     I+ DKSISR H+  ++   D
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60

Query: 60  LI-ITNKGKLTKFNEEIIPLDETI---VVHNQNTVINIGGMPIDVNVRY---FYEEWKIP 112
            + I N GKLT  N+  +   ET    +  ++ T I +G  P+ VN+ +   F +   I 
Sbjct: 61  YVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWEDVFIDMTPIS 120

Query: 113 ---HRLELNETKSLVSDFGVKLSESFSKKTTTQICSDSSSYSGCLFALLKGV-PVVSIEF 168
                L+L       S  GV + ++     T  I      +   L AL++G   +   + 
Sbjct: 121 DTGQSLKLIGIYPAGSTHGVNIEDAMK---TLCIKIKEIKWPHQLIALIRGANRLYKADL 177

Query: 169 LNQMGKLLQQGNYLDFQSMYQGLLNR------HKLFPSYRYVPNVLSNMTLIVFEQKMYD 222
           ++ M + L   N  +  S +  + NR      +K +P+++   N   + T+I F+    D
Sbjct: 178 VDLMAQQLVDSN--ENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFTIIYFDNNDSD 235

Query: 223 T--LRYTIEVGGGDAKLLANSSELDKFLSTNHEPAVVLGSSISQKMNSESTKLL--EEFD 278
              +R  +E  GG      N+   +K+ STN     VL              LL  E F 
Sbjct: 236 ISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVL--------------LLRSERFQ 281

Query: 279 KSIAETSLRHGVKLLNINQFVNILLENKINGLKKRDVVDLTSPSPVQQKKIQSAKASVNG 338
            S     + + + + +   F   + EN ++ L  R++  L   + + QK+++  K  V  
Sbjct: 282 VSHPVYEILNKIDICSTGSFFKAVTENNVSTLVHRELF-LRRYTDITQKEMRRPKEPVED 340

Query: 339 ------KKTKSKPNIQSLDSLNFFGGGNLEVT 364
                 K+  ++  +Q L+ L FF GG+   T
Sbjct: 341 TAVPLKKRRLNRRKVQPLNPLEFFAGGDTATT 372

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 64/122 (52%), Gaps = 13/122 (10%)

Query: 589 RSSTNIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAA----KINTIQIKPRV 644
           R+S++++  I   K  E +RLQ  +  VD SELT+ A+ DF + A     +N ++ KP +
Sbjct: 542 RNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPAM 601

Query: 645 LASIPISNGNTKWLGRKNFKKFKKNWPSYLRRTTEGLCSDNTSNQIGREYITMRKYDSRK 704
           +    I +       R NFKKF K WP   R+  + L   N +  I R+Y+ M+ Y+  +
Sbjct: 602 VTESSIRS------DRPNFKKFMKVWPK-ARKGNDSL--RNNAYLITRDYVPMKAYNRNE 652

Query: 705 AK 706
            K
Sbjct: 653 PK 654

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 107/226 (47%), Gaps = 21/226 (9%)

Query: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFD---- 56
           MW+V +    E      +   LQ    YSIGRS+K    I+ DKSISR H+  K++    
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 57  ----GSDLIITNKGKLTKFNEEIIPLDETIVVHN----QNTVINIGGMPIDVNVRYFYEE 108
                S L + NKGKLT  N++ + + ET  ++     ++T+I +G  PI +   +  E 
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120

Query: 109 WKIPHRLELNETKSLVSDFGVKLSESFSKKTTTQICSDSSSYSGC----LFALLKGVPVV 164
           W IP    L + ++++S++G+    S +      + SD           L+AL+  +P+ 
Sbjct: 121 WNIPP--HLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMK 178

Query: 165 SIEFLNQMGKLL--QQGNYLDFQSMYQGLLNRHKLFPSYRYVPNVL 208
              FL ++   L       L F  M+  +++  + +  + + PN+L
Sbjct: 179 KSRFLMELCNTLLPTSKTNLKFDEMWNDMISNPE-YNVFDFDPNIL 223

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 64/148 (43%), Gaps = 26/148 (17%)

Query: 594 IITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQIKPRVLASIPISNG 653
            + AI ETK +EVKR++  I+E+   EL+E A+   K+ A    ++    +L     S G
Sbjct: 559 FVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLA---IVEPSNNLLRKSFDSEG 615

Query: 654 NT---------------KWLGRKNFKKFKKNWPSYLRRTTEG----LCSD---NTSNQIG 691
           N                +W  RKNFK F K  P       EG      SD   N +  I 
Sbjct: 616 NKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNNTQSSDFIRNAAFLIT 675

Query: 692 REYITMRKYDSRKAKKHIAEEMDEIDIF 719
           R Y+ ++KY  +        E +E D+F
Sbjct: 676 RNYVPLKKYSKKDTTTKWGTEENE-DMF 702

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 97/202 (48%), Gaps = 22/202 (10%)

Query: 1   MWIVSF--IFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFD-- 56
           MW+V +  I +D        C  LQ    YSIGRS+K    I+ DKSISR H+ +K+   
Sbjct: 1   MWVVRYQNILEDGTISVISCC--LQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSN 58

Query: 57  -GSD-----LIITNKGKLTKFNEEIIPLDETIVVH----NQNTVINIGGMPIDVNVRYFY 106
            GSD     L + N+GKLT  N + + + ET ++     + +T I +G  PI + V +  
Sbjct: 59  SGSDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKN 118

Query: 107 EEWKIPHRLELNETKSLVSDFGVKLSESFSKKTTTQICSDSSSYSGC----LFALLKGVP 162
           + W IP  L   + ++ +S FG+    S ++  T  + SD  S        L AL + +P
Sbjct: 119 QVWNIPSHLA--QFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIP 176

Query: 163 VVSIEFLNQMGKLLQQGNYLDF 184
           +   + L ++   L   +  D 
Sbjct: 177 LKKSQLLVKLCNTLLSASITDL 198

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 71/148 (47%), Gaps = 28/148 (18%)

Query: 593 NIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQIKPRVLASIPISN 652
           + + AI +TK++EVKR++  I+E++  EL+E A+   +   ++  ++    +L  +P   
Sbjct: 554 SFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLE---RLAIVEANNDLLRKLPDYR 610

Query: 653 GNT---------------KWLGRKNFKKFKKNWPSYLRRTTEGLCSDNTSNQ-------- 689
            NT               +W  RKNFK F K WP + +   EG  +D   +         
Sbjct: 611 LNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKF-KAQKEGSKNDTQKSDFIRGAAFL 669

Query: 690 IGREYITMRKYDSR-KAKKHIAEEMDEI 716
           I R Y+ ++KY  + K  K   EE D++
Sbjct: 670 ITRNYVPLKKYSKKNKVTKWDKEESDDM 697

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 100/412 (24%), Positives = 184/412 (44%), Gaps = 69/412 (16%)

Query: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGSDL 60
           MWI+ + ++ E     +V   L     +SIGRS+K    I+ DKSISR H+ + +D    
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60

Query: 61  II--TNKGKLTKFNEEIIPLDETI----VVH-NQNTVINIGGMPIDVNVRYFYEEWKIPH 113
           +I   N+G+LT    + + + E++     +H  +  +I +G  PI V V +    + +P 
Sbjct: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120

Query: 114 RL-ELNETKSLVSDFGVKLSESFSKKTTTQICSDSSSYS-GCLFALLKGVPVVSIEFLNQ 171
           +L +  +T   V   GVK +++   ++TT I +D   ++  CLF L+ G  + + +FL +
Sbjct: 121 QLSQFIDTLDHVG-IGVK-ADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFLVE 178

Query: 172 MGKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMY------DTLR 225
           +  +L +     F+  +  L+       SY   PN L    +I+   K Y       T+ 
Sbjct: 179 VTNILSKPTTT-FEESWDSLIQNE----SYMLYPNNLGPHEVILKGYKFYLIASDVITMA 233

Query: 226 YT---IEVGGGDAKLLANSSEL-DKFLSTNHEPAVVLGSSISQKMNSESTKLLEEFDKSI 281
           Y    +E G G+  ++ N+ +L D+    N    +++  +       E+TK+    DK  
Sbjct: 234 YVQEALERGNGELIVVENTEQLLDRLKQENSTDDLIVLKA------EETTKI--PGDK-- 283

Query: 282 AETSLRHGVKLLNINQFVNILLENKINGL---------KKRDVVDLTSPSPVQQKKIQSA 332
                   +KL  +   VN +  N +  L            DV+    P+ + + ++ S+
Sbjct: 284 --------IKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPT-LTKTEVSSS 334

Query: 333 KASVNGKKT-------KSKP--------NIQSLDSLNFFGGGNLEVTQNEEK 369
           ++  N + T         KP         ++ LDSL FF GG+    + E++
Sbjct: 335 QSLSNKEHTPEHTVTPAEKPPVKRRRYNRVKPLDSLMFFAGGDYSTEEPEQE 386

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 90/376 (23%), Positives = 156/376 (41%), Gaps = 51/376 (13%)

Query: 415 ITNKSSLGGMSTEPANQPHTSTKKDDRTELXXXXXXXXXXXXLDNLMMRSSSQQATQIEP 474
           ++NK      +  PA +P    ++ +R +             LD+LM  +    +T+ EP
Sbjct: 337 LSNKEHTPEHTVTPAEKPPVKRRRYNRVK------------PLDSLMFFAGGDYSTE-EP 383

Query: 475 DDRNDKLKLRRIGDTASNVNAEGV-----LPSNSPSNAENMIKNIKTPDISNKNPTLSAI 529
           +    ++  + +   AS+     +     +P N  S   +     + P+I  KN +   +
Sbjct: 384 EQ---EISTQPVNPAASDTAKTSITTQINVPENDASQESSAFDKFQ-PNIVLKN-SAKPL 438

Query: 530 SLLEPGGAEH---VSAKKNLISDGGKSID---AQSSNRIEQNMGNMTELDSRPHSVARLE 583
           ++  PG A +   ++     + D  + I+    +S  + EQ   NM E   RP   AR +
Sbjct: 439 TIDSPGDAHNTHEINTANQHVKDIAQQIEMNHPESEQQSEQANLNMVETTPRP--TARKK 496

Query: 584 TDLQVRSSTN-----------IITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDA 632
           T    +S+ N           ++  I + K +EVKRL+  +++VD  ELTE A+    D 
Sbjct: 497 TLQDFKSTVNNPDNSASSTEGLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDL 556

Query: 633 AKI--NTIQIKPRVLASIPIS--NGNTKWLGRKNFKKFKKNWPSYLRRTTEGLCSDNTSN 688
           A +  N   I+ + + S   S  + +  W GRKNFK F K    Y  +       + +S+
Sbjct: 557 AIVQPNDSLIRRQKIDSAETSRNDQHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSD 616

Query: 689 QIGRE-YITMRKYDSRKAKKHIAEEMDEIDIFPCRSHSNSVGV-MDIAIANTEHDSGFRF 746
            I    Y+  R+Y    +K +  E   E+  FP  S   S    +   I + E    F F
Sbjct: 617 FIRNSGYLLTRQY--VPSKIYTKESSKEMQDFPEASEQTSRQFSVPQVIDDPEDAEPFTF 674

Query: 747 SNREYSIPTRS-LFVA 761
           +      P  + LFV 
Sbjct: 675 TRHTSGTPANNGLFVV 690

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 112/238 (47%), Gaps = 19/238 (7%)

Query: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFD---- 56
           MWI+ +  + E     KV   LQ    YSIGRS+K    I+ DKSISR H+ I++D    
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60

Query: 57  --GSDLIITNKGKLTKFNEEIIPLDETIVVHNQ---NTVINIGGMPIDVNVRYFYEEWKI 111
             G+ L + N+GKLT  +E  +  DE+    ++     V+ +G  P+ V + +    W +
Sbjct: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSTVVVKLGTKPVVVRISWTPIFWDL 120

Query: 112 PHRLELNETKSLVSDFGV--KLSESFSKKTTTQICSDSSSYSGCLFALLK-GVPVVSIEF 168
                L   KS+ S  G+  ++  S  +  +  I  + S++S  +FALLK    +V    
Sbjct: 121 SKDF-LQFEKSINS-MGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKPVL 178

Query: 169 LNQMGKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVP--NVLSNMTLIVFEQKMYDTL 224
           L+++  +L      +F  ++  L    + F +Y   P   V  N  L  F+   + T+
Sbjct: 179 LSEVCNVLLADCQTNFDEIWAQLF---ESFSNYTVYPGFTVEGNDILRAFQDVQFYTV 233

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 121/300 (40%), Gaps = 55/300 (18%)

Query: 573 DSRPHSVARLETDLQVRSST--NIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFK 630
           +S PH   + +  L  RS +    I A+  TK +EVKR++  I++V  SEL+E A+    
Sbjct: 562 ESGPH---KFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAI---N 615

Query: 631 DAAKINTIQIKPRVLASIPISNG---NTKWLGRKNFKKFKKNWPSYLRRTTEGLCSDNTS 687
             + +  ++  P ++           N  W GR+NFKKF K WP + R   + L   N +
Sbjct: 616 KLSNLTIVESNPNLIRERRADKNDSVNDMWKGRRNFKKFNKVWPQH-RDGYDSL--RNNA 672

Query: 688 NQIGREYITMRKYDSRK----------AKKHIAEEMD------------EIDIFPCRSHS 725
             I R Y+ ++ YD ++           + H  +E D            E DI      +
Sbjct: 673 FLIIRNYVELKPYDGKRNDNDSSDFHEGRSHFNDENDYEVIRRGNPAVSEDDILLNEMRT 732

Query: 726 NSVGVMDIAIANTEHDSGFRFSNREYSIPT----RSLFVAXXXXXXXXXXXXXXALAIYG 781
            ++G+ D    N   +   R +N + ++PT      LFVA                  +G
Sbjct: 733 KAIGLTD----NGNDEDFTRIANSDQAVPTVHGVSRLFVADDDSEDELQEERLEKG--FG 786

Query: 782 QNNEQHYEGVGPAAAVSIRSPXXXXXXXXXXKLG--------DTDDEEDDTPRFNFRSRR 833
            N   ++  V   +   I +            LG        D+ DE+DD P+F FR  R
Sbjct: 787 SNRNSNHSFVKEGSTSGILN-DFSKDTVLRSHLGRKKAFTQIDSGDEDDDGPKFKFRRNR 845

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 98/423 (23%), Positives = 176/423 (41%), Gaps = 71/423 (16%)

Query: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDG--- 57
           MWI+S+ +    +    V   L+    YSIGRS K    ++ DKSISR H+   + G   
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGNLN 60

Query: 58  SDLIITNKGKLTKFNEEIIPLDETIVVH---NQNTVINIGGMPIDVNVRYFYEEWKIPHR 114
           + L + N+GKLT+ N  I+   ET++ +        + +G  P+ V   +    + IP  
Sbjct: 61  NQLSLLNQGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIP-- 118

Query: 115 LELNETKSLVSDFGVKLSESFSKKTTTQICSD-------SSSYSGCL-FALLKGVPVVSI 166
           +E  + +S + D+G  ++    K        D       ++  SG L ++L+    ++  
Sbjct: 119 IEFQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIILKS 178

Query: 167 EFLNQMGKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVPNV------LSNMTLIVFEQKM 220
            FL  +  LL   N   F   +Q LL+  K+   +R + N+      L+ + LIV     
Sbjct: 179 SFLTSLLNLL-NPNVTTFNIDFQNLLDASKI-EDFRNI-NLESLKVELTGIKLIVLNDNT 235

Query: 221 YDTLRYTIEVGGGDAKLLANSSE---LDKFLSTNHEPAVVLGSSISQKMNSESTKLLEEF 277
            D + +   +   +   +    +   ++   S + E  ++L +S S+ + +      ++F
Sbjct: 236 TDLIYFIAAMEVINLPTITTEDDTIFINTVKSHSEERLILLTTSNSRHIETIKVHTFKDF 295

Query: 278 DKSIAETSLRHGVKLLNINQFVNILLENKINGLKK--RDVVDLT---------SPSPVQQ 326
                      G+K  NIN  + ++ ++  + +++  R+ + L          SP     
Sbjct: 296 ---------YQGIKNQNINHLIQVIKKDSPHTIERNSRETISLNNENQTYSQLSPYIEDN 346

Query: 327 KKIQS--------------AKASVNGKKTKSKP---------NIQSLDSLNFFGGGNLEV 363
            K+ S               K SVN    +  P          +Q LDSL+FF GGN   
Sbjct: 347 NKVNSNTISDSLLKQTSELIKPSVNDHAPEKPPVKRRRLNRKRVQPLDSLHFFVGGNTNP 406

Query: 364 TQN 366
           TQN
Sbjct: 407 TQN 409

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 66/134 (49%), Gaps = 11/134 (8%)

Query: 589 RSST--NIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINT---IQIKPR 643
           RS T  N I+A+ + K +E  RL    +++   ELTE A+  F + A + T   I I   
Sbjct: 602 RSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISEG 661

Query: 644 VLASIPISNGNTKWLGRKNFKKFKKNWPSYLRRTT----EGLCS--DNTSNQIGREYITM 697
              +  I++ + KW GRKNFK F K  P Y  +T      G+ S   N++  + REY+ M
Sbjct: 662 KKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLLAREYVPM 721

Query: 698 RKYDSRKAKKHIAE 711
           +++        I E
Sbjct: 722 QEFKMNNQGNRIQE 735

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 89/371 (23%), Positives = 164/371 (44%), Gaps = 61/371 (16%)

Query: 18  VCKALQYGVEYSIGRSAKCTFRIQTDKSISRVH--LLIKFDGSD----LIITNKGKLTKF 71
           V   L   VEY+IGRS+K  F I+ DKSISR H  LL K+   D    + I N GK+T  
Sbjct: 18  VSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKYSSDDKNVIIQIKNFGKVTMI 77

Query: 72  NEEIIPLDETI--VVHNQNTVINIGGMPIDVNVRYFYEE--WKIPHRLELNETKSLVSDF 127
            ++ +  DET+   + ++   +NIG  PI + +  F +E        ++ +++K ++++ 
Sbjct: 78  KDKYLSQDETLQFTLIDKKLEVNIGTSPITLEI--FNQEVVCNSIEDIQNSDSKLILNNL 135

Query: 128 GVKLSESFS-KKTTTQICSDSSSYSGCLFALLK---GVPVVSIEFLNQMGKLLQQGNYLD 183
            +   +  + K+    I    +SY+  L  L     G+P+V+IE L  +       N  D
Sbjct: 136 NILQDDPLTLKREGPTIIIKENSYTDILLELFSNVFGIPIVTIEELRGI------ANAND 189

Query: 184 FQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEVGGGDAKLLANSSE 243
           F S +  + +R K       +   LS    I    K  D ++  I     + K+L +  +
Sbjct: 190 FYSYWDKIYSRKKNKGKACMLD--LSTCYYISEVDKYVDYVKVAIRSLNAEIKILKDKDD 247

Query: 244 LDKFLSTNHEPA-----VVLGSSISQKMNSESTKLLEEFDKSIAETSLRHGVKLLNINQF 298
           L K +  N          VL + I+Q          EE   +I+ TS+   ++ +  N  
Sbjct: 248 LVKDIRKNISKGNISKFFVLSNDITQG---------EEAPFNISVTSIAKLLEAVKTNNM 298

Query: 299 VNILLEN----------KINGLKKRDVVDLTSPSPVQQKKIQSAKASVNGKKTKSKPNIQ 348
            +I++ +          ++   K  ++++   P   +++++  +K             ++
Sbjct: 299 KDIVMHDYSSFKIEIPREVKSPKDDNIIEKQEPPAPKRRRMNRSK-------------VK 345

Query: 349 SLDSLNFFGGG 359
            LD+L+FF GG
Sbjct: 346 PLDTLSFFAGG 356

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 66/146 (45%), Gaps = 19/146 (13%)

Query: 590 SSTNIITAIAETKQKEVKRLQEGIIEVDQSELTESAL--IDFKDAAKINTIQIKPRVLAS 647
           SST+++  I   K + V R+   I+ VD++EL E  L          +N   +K    A 
Sbjct: 520 SSTDLVRTIQNVKSRGVDRVNSKIVTVDENELNEEELNKFFDVVVVDVNDKLMKKHPNAQ 579

Query: 648 IPISNG----NTKWLGRKNFKKFKKN---WPSYLRRTTEGLCSDNTSNQI---GREYITM 697
             I N     N+ +  RK++K FKK+   W S L +    + SDN  N +    R  I +
Sbjct: 580 KVIDNANIDHNSNFKNRKDYKLFKKSIPKWQSKLNKQHHSMTSDNGENLVVSKNRNKIPL 639

Query: 698 RKYDSRKAKKHIAEEMDEIDIFPCRS 723
           RKY+         E++ E DIF   S
Sbjct: 640 RKYNEN-------EKIHEADIFEFES 658

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 101/211 (47%), Gaps = 12/211 (5%)

Query: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGSDL 60
           MW++ + + +E  +  KV   ++  V+Y+IGRS+K    I+ DKSISR H+ +K+  S  
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60

Query: 61  II--TNKGKLTKFNEEIIPLDETIVVHNQNTVIN--IGGMPIDVNVRYFYEEWKIPHRLE 116
            I  TN GKLTK +E+ +  +E I      T I   +G  P+ + +    E + IP+   
Sbjct: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPN--S 118

Query: 117 LNETKSLVSDFGVKLSESFSKKTTTQICSDSSSYSGCLFALLKGVPVVSIEFLNQM-GKL 175
           L++ +  +   G+++S   +   +T + +        LFA    + + S   L ++  KL
Sbjct: 119 LSQFRETLETLGIQISVDNANVNSTSLITVGDFGYRELFAACNDINIYSSGLLTEICNKL 178

Query: 176 LQQGNYLD-----FQSMYQGLLNRHKLFPSY 201
           +   +  D      QS Y   L+   L   +
Sbjct: 179 VNDHDNFDAEWRSMQSSYHRNLDLEGLLSQF 209

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 74/157 (47%), Gaps = 17/157 (10%)

Query: 525 TLSAISLLEPGGAEHVSAKKNL-------ISDGGKSIDAQSSNRIEQNMGNMTELDSRPH 577
           +L+  +LL+  G E  + K  L       I    K++DAQ  N   Q + ++ + D +  
Sbjct: 486 SLTQSNLLQSMGYEKSNNKTELSKKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDNDPK-- 543

Query: 578 SVARLETDLQVRSSTNIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINT 637
                   LQ R   +I+  +  TK+ EVKRL   I++++ SELTE A+    D   +  
Sbjct: 544 ------RTLQKRD-IDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEP 596

Query: 638 IQIKPRVLASIPISN-GNTKWLGRKNFKKFKKNWPSY 673
           +    R  + I  +N    +W  RKNFKKF K  P Y
Sbjct: 597 VADLIRTKSDISANNTTQQQWKNRKNFKKFVKICPKY 633

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 93/189 (49%), Gaps = 22/189 (11%)

Query: 533 EPGGAEHVSAKKNLISDGGKSIDAQSSNRIEQNMGNMTELDSRPHSVARLET-------- 584
           +P   E++S ++ L+S+  KS    SS  IE  +   +   +  +   R +T        
Sbjct: 455 KPKLEENISIQQ-LLSNKVKSTSDTSSVLIETQIAKESNTKAIEYGKVRQKTLTDYKHTS 513

Query: 585 DLQV-RSSTNIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKD--AAKINTIQIK 641
           D ++ R S +++ AI + K++E  R++  I+E+ ++ELTE A+  F D     INT   K
Sbjct: 514 DERIERPSVDLVHAIQDIKERETLRVKTSIVEIKENELTEEAINKFSDLTVVDINTRLFK 573

Query: 642 PRVLASIPISNGNTK---WLGRKNFKKFKKNWPSYLRRTTEGLCSD-------NTSNQIG 691
            + L     +N N     W G+KNFKKF K  P Y R    G  +D       N++  I 
Sbjct: 574 DKSLDINKPANSNQNNMDWSGKKNFKKFVKMVPKYKRSQGNGQHADSCSTFIRNSAMLIT 633

Query: 692 REYITMRKY 700
           R ++ M++Y
Sbjct: 634 RNFVPMKQY 642

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 57/108 (52%), Gaps = 4/108 (3%)

Query: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGSD- 59
           MW++ + +  +     K+   ++    Y +GRS+K    ++ DKSISR  + I++D    
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRDKD 60

Query: 60  -LIITNKGKLTKFNEEIIPLDETIVVHNQNTVIN--IGGMPIDVNVRY 104
            +++ N GK+T   E  +   ET+   ++N ++   IG  PI VN+ +
Sbjct: 61  CIMVKNLGKVTMVEERYLSDGETLSFQSKNDLVTMKIGTTPIVVNLSW 108

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON}
           Anc_6.20 YML002W
          Length = 1204

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 32/57 (56%)

Query: 171 QMGKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYT 227
           +M K+++   + +F S  QG+ N    +  Y   PN++ N  L  F++K+ +T +Y+
Sbjct: 139 KMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEFLTAFDRKLIETEQYS 195

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
            source-responsive zinc-finger transcription factor,
            required for transcription of the glucose-repressed gene
            ADH2, of peroxisomal protein genes, and of genes required
            for ethanol, glycerol, and fatty acid utilization
          Length = 1323

 Score = 32.3 bits (72), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 66/148 (44%), Gaps = 15/148 (10%)

Query: 173  GKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEVGG 232
            G ++Q+ N+ DF++ Y      H        +P  L + ++I +E  +    +  + +  
Sbjct: 891  GHVVQKQNFYDFRNFYYSFTYGH-----LHSIPEFLGS-SMIYYEYDLRKGTKSHVFLDR 944

Query: 233  GDAKLLANSSEL-----DKFLSTNHEPAVVLGSSISQKMNSESTKLLEEFDKSIAETSLR 287
             D K L  S +      D   +TN   A+++  +I  K N  S + +++ D+S  E  +R
Sbjct: 945  IDTKRLERSLDTSSYGNDNMAATNKNIAILIDDTIILKNNLMSMRFIKQIDRSFTE-KVR 1003

Query: 288  HGVKLLNINQFVNILLENKINGLKKRDV 315
             G      + F+N +   ++N LK   V
Sbjct: 1004 KGQIAKIYDSFLNSV---RLNFLKNYSV 1028

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 85,759,594
Number of extensions: 3795251
Number of successful extensions: 11414
Number of sequences better than 10.0: 88
Number of HSP's gapped: 11920
Number of HSP's successfully gapped: 108
Length of query: 835
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 717
Effective length of database: 39,950,811
Effective search space: 28644731487
Effective search space used: 28644731487
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)