Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D16434g8.325ON41437018710.0
SAKL0H14388gna 1ON38037212471e-171
SAKL0H15510g8.325ON39938912171e-166
KNAG0G024608.325ON40338511871e-161
NDAI0J010108.325ON38439111801e-161
KAFR0B057308.325ON37237811781e-160
Smik_12.1938.325ON42241211721e-159
NCAS0B035808.325ON34737811521e-157
Skud_12.1998.325ON42241111551e-156
Suva_10.2238.325ON42041011531e-156
Kpol_543.648.325ON42441011501e-155
YLR130C (ZRT2)8.325ON42241011471e-155
TPHA0A015508.325ON41139711331e-153
TPHA0D00970na 2ON38337611261e-152
KAFR0H022508.325ON37937811251e-152
CAGL0E01353g8.325ON43341511241e-151
TBLA0H012708.325ON40138011091e-150
KNAG0A051808.325ON39538910771e-145
Ecym_4202na 1ON37537610671e-143
KLTH0F09064gna 1ON36137510301e-138
CAGL0M04301g8.325ON38938810271e-137
AGL143Cna 1ON37437810231e-137
Kpol_1006.10na 2ON3913739901e-132
TBLA0F02390singletonON4274109871e-131
SAKL0F16346gsingletonON3793829341e-123
NDAI0G025708.325ON4292217696e-98
NCAS0C032508.325ON4291967541e-95
Smik_7.6na 3ON3723736454e-80
YGL255W (ZRT1)na 3ON3763716421e-79
Suva_7.6na 3ON3723726385e-79
Skud_7.12na 3ON3723726351e-78
KLTH0C00374gsingletonON3763716202e-76
ZYRO0F02200gsingletonON3813755924e-72
TDEL0D06550singletonON3813745761e-69
Kwal_14.824singletonON3743565732e-69
KLTH0A07722gna 4ON3923725664e-68
Kwal_23.6522na 4ON3893715602e-67
ZYRO0D17732gsingletonON3993785063e-59
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D16434g
         (414 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D16434g Chr4 complement(1384826..1386070) [1245 bp, 414 aa]...   725   0.0  
SAKL0H14388g Chr8 (1247106..1248248) [1143 bp, 380 aa] {ON} simi...   484   e-171
SAKL0H15510g Chr8 (1350297..1351496) [1200 bp, 399 aa] {ON} simi...   473   e-166
KNAG0G02460 Chr7 complement(560626..561837) [1212 bp, 403 aa] {O...   461   e-161
NDAI0J01010 Chr10 (230625..231779) [1155 bp, 384 aa] {ON} Anc_8....   459   e-161
KAFR0B05730 Chr2 complement(1182121..1183239) [1119 bp, 372 aa] ...   458   e-160
Smik_12.193 Chr12 complement(384118..385386) [1269 bp, 422 aa] {...   456   e-159
NCAS0B03580 Chr2 complement(635005..636048) [1044 bp, 347 aa] {O...   448   e-157
Skud_12.199 Chr12 complement(385437..386705) [1269 bp, 422 aa] {...   449   e-156
Suva_10.223 Chr10 complement(411354..412616) [1263 bp, 420 aa] {...   448   e-156
Kpol_543.64 s543 complement(147560..148834) [1275 bp, 424 aa] {O...   447   e-155
YLR130C Chr12 complement(402794..404062) [1269 bp, 422 aa] {ON} ...   446   e-155
TPHA0A01550 Chr1 (310086..311321) [1236 bp, 411 aa] {ON} Anc_8.3...   441   e-153
TPHA0D00970 Chr4 complement(195530..196681) [1152 bp, 383 aa] {O...   438   e-152
KAFR0H02250 Chr8 (429002..430141) [1140 bp, 379 aa] {ON} Anc_8.3...   437   e-152
CAGL0E01353g Chr5 (127845..129146) [1302 bp, 433 aa] {ON} simila...   437   e-151
TBLA0H01270 Chr8 (286413..287618) [1206 bp, 401 aa] {ON} Anc_8.3...   431   e-150
KNAG0A05180 Chr1 (764235..765422) [1188 bp, 395 aa] {ON} Anc_8.3...   419   e-145
Ecym_4202 Chr4 (419650..420777) [1128 bp, 375 aa] {ON} similar t...   415   e-143
KLTH0F09064g Chr6 (779431..780516) [1086 bp, 361 aa] {ON} simila...   401   e-138
CAGL0M04301g Chr13 complement(472227..473396) [1170 bp, 389 aa] ...   400   e-137
AGL143C Chr7 complement(431959..433083) [1125 bp, 374 aa] {ON} N...   398   e-137
Kpol_1006.10 s1006 complement(43032..44207) [1176 bp, 391 aa] {O...   385   e-132
TBLA0F02390 Chr6 (588534..589817) [1284 bp, 427 aa] {ON}              384   e-131
SAKL0F16346g Chr6 complement(1331198..1332337) [1140 bp, 379 aa]...   364   e-123
NDAI0G02570 Chr7 (588135..589424) [1290 bp, 429 aa] {ON} Anc_8.325    300   6e-98
NCAS0C03250 Chr3 (638559..639848) [1290 bp, 429 aa] {ON} Anc_8.325    295   1e-95
Smik_7.6 Chr7 (15678..16796) [1119 bp, 372 aa] {ON} YGL255W (REAL)    253   4e-80
YGL255W Chr7 (20978..22108) [1131 bp, 376 aa] {ON}  ZRT1High-aff...   251   1e-79
Suva_7.6 Chr7 (15340..16458) [1119 bp, 372 aa] {ON} YGL255W (REAL)    250   5e-79
Skud_7.12 Chr7 (25081..26199) [1119 bp, 372 aa] {ON} YGL255W (REAL)   249   1e-78
KLTH0C00374g Chr3 complement(32017..33147) [1131 bp, 376 aa] {ON...   243   2e-76
ZYRO0F02200g Chr6 (178997..180142) [1146 bp, 381 aa] {ON} simila...   232   4e-72
TDEL0D06550 Chr4 (1177932..1179077) [1146 bp, 381 aa] {ON}            226   1e-69
Kwal_14.824 s14 complement(65415..66539) [1125 bp, 374 aa] {ON} ...   225   2e-69
KLTH0A07722g Chr1 (650427..651605) [1179 bp, 392 aa] {ON} simila...   222   4e-68
Kwal_23.6522 s23 (1624044..1625213) [1170 bp, 389 aa] {ON} YGL25...   220   2e-67
ZYRO0D17732g Chr4 complement(1471224..1472423) [1200 bp, 399 aa]...   199   3e-59

>KLLA0D16434g Chr4 complement(1384826..1386070) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130C ZRT2 Low-affinity zinc transporter of the plasma
           membrane transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 414

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/370 (95%), Positives = 352/370 (95%)

Query: 45  SDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVAT 104
           SDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVAT
Sbjct: 45  SDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVAT 104

Query: 105 GFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQNDH 164
           GFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQNDH
Sbjct: 105 GFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQNDH 164

Query: 165 VHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPGSN 224
           VHSHFP                  YNQVVDEENVSLTVANNNNGAEITATNPHPSMPGSN
Sbjct: 165 VHSHFPSSKDQKSLEDEDDEDSDKYNQVVDEENVSLTVANNNNGAEITATNPHPSMPGSN 224

Query: 225 HFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFN 284
           HFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFN
Sbjct: 225 HFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFN 284

Query: 285 TLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYA 344
           TLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYA
Sbjct: 285 TLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYA 344

Query: 345 PGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGA 404
           PGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGA
Sbjct: 345 PGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGA 404

Query: 405 GLMALLGKWA 414
           GLMALLGKWA
Sbjct: 405 GLMALLGKWA 414

>SAKL0H14388g Chr8 (1247106..1248248) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 380

 Score =  484 bits (1247), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 241/372 (64%), Positives = 280/372 (75%), Gaps = 23/372 (6%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C  DNDYDG+DN+R+ A+F+ILIS  LG++FPILSSRYSFIRLPDWCFFIAK+FGSGVIV
Sbjct: 32  CPIDNDYDGRDNLRILAVFMILISSALGTFFPILSSRYSFIRLPDWCFFIAKYFGSGVIV 91

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           ATGFIHLLEPA+DALGEECLGGTFADYPWAFGICLMSLFALF  E +  Y+  K+ G  +
Sbjct: 92  ATGFIHLLEPASDALGEECLGGTFADYPWAFGICLMSLFALFFVEIITHYFAAKAAGNDS 151

Query: 163 DHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPG 222
            +                           V DEE  S    +     +    N + S+PG
Sbjct: 152 SNYSDE---------------------KSVKDEEADSQLAYSAVIKVDQQQENVN-SVPG 189

Query: 223 SNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDE 282
           ++H+ HD+ HQD A          KEKY NQ+++VFILEFG++FHSVF+GL+LAV G DE
Sbjct: 190 ADHYGHDEVHQDPAQAQNLVSQKDKEKYLNQIVAVFILEFGVVFHSVFVGLSLAVAG-DE 248

Query: 283 FNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHS 342
           FNTLFIVLVFHQMFEG+GLG RIAE  W +  RFTPWLLA G+T+ TPIAIAIGIGVRHS
Sbjct: 249 FNTLFIVLVFHQMFEGLGLGTRIAETPWPESERFTPWLLALGYTIATPIAIAIGIGVRHS 308

Query: 343 YAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCW 402
           +APGSR ALI+NGCFDAISAGILIYTGLVELMAHEFLY+++FKG NG K M+ AFF MC 
Sbjct: 309 FAPGSRKALISNGCFDAISAGILIYTGLVELMAHEFLYANSFKGPNGFKWMMLAFFIMCL 368

Query: 403 GAGLMALLGKWA 414
           GAGLMALLGKWA
Sbjct: 369 GAGLMALLGKWA 380

>SAKL0H15510g Chr8 (1350297..1351496) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 399

 Score =  473 bits (1217), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 236/389 (60%), Positives = 286/389 (73%), Gaps = 19/389 (4%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C++DN+YDG+D++R+ A+F+ILIS GLG++FPILSSRYS IRLP WCFFIAKFFGSGVIV
Sbjct: 13  CDNDNEYDGRDSLRILAVFMILISSGLGAFFPILSSRYSVIRLPAWCFFIAKFFGSGVIV 72

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           ATGFIHLL+PA D LG  CLGGTFADYPWAFGICLMSLFALF SE +  ++  K+ G  +
Sbjct: 73  ATGFIHLLKPATDNLGNTCLGGTFADYPWAFGICLMSLFALFFSEIITHHFFIKANG-NS 131

Query: 163 DHV--HSHFPXXXXXXXXXXXXXXXXXXYNQVVD----EENVSLTVANNNNGAEITAT-- 214
           DH   HSHF                     +  D     E + L V    +  E+  +  
Sbjct: 132 DHTNSHSHFGEPNHTTHQQFPDESEKKDDEEEADVECAAEYIPLKVGYFKDDEELRCSAS 191

Query: 215 ---------NPHPSMPGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGII 265
                     P  S+PG +HFSH++ HQDL+ +GT  +   +E+Y +Q+ +VFILEFG++
Sbjct: 192 QGVSRKSDRKPSVSVPGKDHFSHEQDHQDLSQLGTLVRQKEREQYLSQVFAVFILEFGVV 251

Query: 266 FHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGF 325
           FHSVF+GL+LAV G DEFNTLFIVLVFHQMFEG+GLG RIAE +W    R+TPWLL  G+
Sbjct: 252 FHSVFVGLSLAVAG-DEFNTLFIVLVFHQMFEGLGLGTRIAETTWPASKRYTPWLLGLGY 310

Query: 326 TLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFK 385
           TL+TPIAIAIGIGVRHS+APGS+ ALI NG FD+ISAGILIYTGLVELMAHEFLYS  FK
Sbjct: 311 TLSTPIAIAIGIGVRHSFAPGSKKALITNGVFDSISAGILIYTGLVELMAHEFLYSQQFK 370

Query: 386 GENGLKKMLWAFFTMCWGAGLMALLGKWA 414
           GE G K+M+ A+F MC GAGLMALLG+WA
Sbjct: 371 GEGGCKRMIGAYFIMCLGAGLMALLGRWA 399

>KNAG0G02460 Chr7 complement(560626..561837) [1212 bp, 403 aa] {ON}
           Anc_8.325 YLR130C
          Length = 403

 Score =  461 bits (1187), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 226/385 (58%), Positives = 281/385 (72%), Gaps = 14/385 (3%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C   N Y+G + +R+ A+FIILIS G+G +FPI++SRYSFIRLPDWCFFIAKFFGSGVIV
Sbjct: 20  CAVSNSYNGHNGLRILAVFIILISSGVGVFFPIMASRYSFIRLPDWCFFIAKFFGSGVIV 79

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT FIHLL+PA++ALG+ CLGGTFA+YPWAFGICLMSLF LF +E V+ ++ +KS G  +
Sbjct: 80  ATAFIHLLQPASEALGDPCLGGTFAEYPWAFGICLMSLFMLFFTEIVSHHFISKSLGDSH 139

Query: 163 -----------DHVHSHFPXXXXXXXXXXXXXXX--XXXYNQVVDEENVSLTVANNNNGA 209
                      D   S F                     + Q VD      TV +  + A
Sbjct: 140 ESHGGADSVYGDDDDSEFSVSKQREIVDSQKGELFIKDKFEQEVDLSQGITTVPSTRDYA 199

Query: 210 EITATNPHPSMPGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSV 269
            +T+T   P++PG +HF+HD  HQD + +GTP Q   KE+Y NQ+++V ILE GIIFHSV
Sbjct: 200 NLTSTELEPTIPGKDHFAHDTEHQDPSQLGTPVQEQDKEQYLNQIVAVTILEAGIIFHSV 259

Query: 270 FIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTT 329
           F+GL+L+V+G +EF TLFIVL FHQMFEG+GLG R+AE +W +  + TPWL+   F LT+
Sbjct: 260 FVGLSLSVSG-EEFETLFIVLTFHQMFEGLGLGTRVAETNWPENRKNTPWLMGLAFMLTS 318

Query: 330 PIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENG 389
           PIA+AIGIGVRHS+ PGSR +LIANG FDAIS+GILIYTGLVELMAHEFL+S+ FKG  G
Sbjct: 319 PIAVAIGIGVRHSWVPGSRKSLIANGVFDAISSGILIYTGLVELMAHEFLFSNQFKGPGG 378

Query: 390 LKKMLWAFFTMCWGAGLMALLGKWA 414
           LKKML+A+F MC GAGLMALLGKWA
Sbjct: 379 LKKMLYAYFIMCLGAGLMALLGKWA 403

>NDAI0J01010 Chr10 (230625..231779) [1155 bp, 384 aa] {ON} Anc_8.325
          Length = 384

 Score =  459 bits (1180), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 230/391 (58%), Positives = 283/391 (72%), Gaps = 30/391 (7%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C + ND++G+ N+R+ ++F+IL+S  +G++FP+LS+RYS+IRLP WCFF+AKFFGSGVIV
Sbjct: 5   CLNTNDFNGRTNIRILSIFMILLSSAIGTFFPLLSTRYSYIRLPPWCFFLAKFFGSGVIV 64

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGF-- 160
           AT FIHLLEPA+DALG+ CLGGTFADYPWAFGICLMSLF LF +E V+ +Y NK++    
Sbjct: 65  ATAFIHLLEPASDALGDPCLGGTFADYPWAFGICLMSLFFLFFTEIVSHFYVNKAFETVS 124

Query: 161 --QNDHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITA----- 213
              + ++HSH                        VD +N   T  N+    + T+     
Sbjct: 125 HSASGNIHSH----------SNEDDDDHDHDKDSVDIKNKHTTTNNDLESLQSTSPGIIG 174

Query: 214 ----------TNPHPSMPGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFG 263
                      N      GSNH+ H   HQD   +GT    ++KE+Y NQLL+V ILEFG
Sbjct: 175 LATFTRSHDNVNKQMGTIGSNHYDHALVHQDPGQMGTSLNDSAKEQYANQLLAVTILEFG 234

Query: 264 IIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAA 323
           I+FHSVFIGL+LAV+G +EF TLFIVL+FHQMFEG+GLG R+AEV W K  RFTPWL+A 
Sbjct: 235 IVFHSVFIGLSLAVSG-EEFTTLFIVLIFHQMFEGLGLGTRLAEVPWDKSKRFTPWLMAL 293

Query: 324 GFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDN 383
           GF+LTTPIAIAIG+GVRHS+ P SR ALI+NGCFDAISAGILIYTGLVELMAHEFLYS+ 
Sbjct: 294 GFSLTTPIAIAIGLGVRHSFVPTSRRALISNGCFDAISAGILIYTGLVELMAHEFLYSNQ 353

Query: 384 FKGENGLKKMLWAFFTMCWGAGLMALLGKWA 414
           FKGENG KKM+ A+  MC+GAGLMALLGKWA
Sbjct: 354 FKGENGFKKMISAYICMCFGAGLMALLGKWA 384

>KAFR0B05730 Chr2 complement(1182121..1183239) [1119 bp, 372 aa]
           {ON} Anc_8.325 YLR130C
          Length = 372

 Score =  458 bits (1178), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 223/378 (58%), Positives = 282/378 (74%), Gaps = 21/378 (5%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C++ NDY+G DN+R+ A+F+ILIS  LG++FP+LSS+YSFI+LP+WCFFIAKFFGSGVIV
Sbjct: 10  CQTSNDYNGSDNLRILAVFMILISSALGAFFPLLSSKYSFIKLPNWCFFIAKFFGSGVIV 69

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT FIHLLEPA+DAL  +CLGGTFADYPWAFGICLMSLF LF SE  + Y+  ++YG ++
Sbjct: 70  ATAFIHLLEPASDALTNDCLGGTFADYPWAFGICLMSLFFLFFSEICSHYFILRAYGNED 129

Query: 163 DHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNN---GAEITATNPHPS 219
              HSHFP                   + V  ++N    ++N+ +   G+ I    P   
Sbjct: 130 ---HSHFPSGNDDSKL-----------SDVDSDKNTETRISNHRDIESGSFIRDAGPTSG 175

Query: 220 ---MPGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALA 276
              +PG +H+SHD  HQD + +GTPA+ + KE Y NQ+ +V ILEFGI+FHSVFIGL+LA
Sbjct: 176 NSFIPGRDHYSHDAVHQDPSQLGTPAESSDKENYANQIFAVSILEFGIVFHSVFIGLSLA 235

Query: 277 VTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIG 336
           V G +EF TLF+VL+FHQMFEG+GLG R+AE +W K  + TPW++A G+++TTPI+ AIG
Sbjct: 236 VAG-EEFKTLFVVLIFHQMFEGLGLGTRLAETNWPKSKKLTPWIMALGYSITTPISTAIG 294

Query: 337 IGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWA 396
           IGVRHS+ P SR ALI NG FDA SAGILIYTGLVELMAHEFLYS  FK ++GLK+ML A
Sbjct: 295 IGVRHSFLPESRKALIVNGVFDAFSAGILIYTGLVELMAHEFLYSSTFKQKDGLKRMLLA 354

Query: 397 FFTMCWGAGLMALLGKWA 414
           +  M  GAG+MALLGKWA
Sbjct: 355 YLCMATGAGIMALLGKWA 372

>Smik_12.193 Chr12 complement(384118..385386) [1269 bp, 422 aa] {ON}
           YLR130C (REAL)
          Length = 422

 Score =  456 bits (1172), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 235/412 (57%), Positives = 284/412 (68%), Gaps = 43/412 (10%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C++ NDY+G   +R+ A+FIILIS GLG YFPILSSRYSFIRLP+WCFFIAKFFGSGVIV
Sbjct: 14  CQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIV 73

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGF-- 160
           AT F+HLL+PAA+ALG+ECLGGTFA+YPWAFGICLMSLF LF +E +  YY  K+ G   
Sbjct: 74  ATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYYVAKTLGHDH 133

Query: 161 ----QNDHVHSHFPXXXXXXXXXXXXXXXXXXYNQVV-------------DEE------- 196
               +N  +    P                   N+ V             +EE       
Sbjct: 134 GDHGENTSIDVDVPSSDLAVSNIDSQPASFN--NEAVYFIHNNKTPYTTRNEEIGATPIK 191

Query: 197 ---------NVSLTVANNNNGA-EITATNPH----PSMPGSNHFSHDKSHQDLATIGTPA 242
                    N  L   N  + A E+   + H    PS+PG +HFSH+  HQD + +GT  
Sbjct: 192 EKEPSSNITNYDLEAGNTESIANELFPMSSHATNIPSVPGKDHFSHENDHQDASQLGTRI 251

Query: 243 QMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLG 302
           +   KE+Y NQ+L+VFILEFGIIFHSVF+GL+L+V G +EF TLFIVL FHQMFEG+GLG
Sbjct: 252 EEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAG-EEFETLFIVLTFHQMFEGLGLG 310

Query: 303 ARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISA 362
            R+AE +W +  R+TPWL+   FTLT+PIA+A+GIGVRHS+ PGSR ALIANG FD+IS+
Sbjct: 311 TRVAETNWPESKRYTPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRKALIANGVFDSISS 370

Query: 363 GILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMALLGKWA 414
           GILIYTGLVELMAHEFLYS+ FKG  GLKKML A+F MC GA LMALLGKWA
Sbjct: 371 GILIYTGLVELMAHEFLYSNQFKGPGGLKKMLSAYFIMCCGAALMALLGKWA 422

>NCAS0B03580 Chr2 complement(635005..636048) [1044 bp, 347 aa] {ON}
           Anc_8.325
          Length = 347

 Score =  448 bits (1152), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 218/378 (57%), Positives = 281/378 (74%), Gaps = 41/378 (10%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C++ NDY+G+ N+R+ ++F+I+IS GLG +FP+L+S+YSFIRLPDWCFF+AKFFGSGVIV
Sbjct: 5   CQAQNDYNGETNIRILSVFMIMISSGLGVFFPLLASKYSFIRLPDWCFFLAKFFGSGVIV 64

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT F+HLL+PA++AL + CLGGTFADYPWAFGICLMSLF LF +E  + YY +K++    
Sbjct: 65  ATAFVHLLQPASEALSDPCLGGTFADYPWAFGICLMSLFFLFFTEIFSHYYISKAFS--- 121

Query: 163 DHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNN-GAEITATNPHP--- 218
                                          DE++ S T++ +++  +++ A    P   
Sbjct: 122 -------------------------------DEKDSSDTISKDSSYDSDLEANQVIPVND 150

Query: 219 SMPGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVT 278
           S PG  HFSH++ HQD   IGTPA   +KE+Y NQ+ +VFILEFGI+FHS+FIGL+LAV+
Sbjct: 151 SRPGKQHFSHEEDHQDAIQIGTPANDKAKEQYTNQVFAVFILEFGILFHSIFIGLSLAVS 210

Query: 279 GNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKK--HRFTPWLLAAGFTLTTPIAIAIG 336
           G DEF+TLFIVL+FHQMFEG+GLG R+AE +W      ++TPWL+   FT  TP+AIAIG
Sbjct: 211 G-DEFHTLFIVLIFHQMFEGLGLGTRVAETNWPDSGPKKWTPWLMGLAFTFVTPVAIAIG 269

Query: 337 IGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWA 396
           +GVRHS+ PGSR ALIANG FD++S+GILIYTGLVELMAHEFLYS+ FKG  G KKML+A
Sbjct: 270 LGVRHSWVPGSRRALIANGVFDSLSSGILIYTGLVELMAHEFLYSNQFKGPGGFKKMLYA 329

Query: 397 FFTMCWGAGLMALLGKWA 414
           +F MC GAG+MALLGKWA
Sbjct: 330 YFFMCCGAGIMALLGKWA 347

>Skud_12.199 Chr12 complement(385437..386705) [1269 bp, 422 aa] {ON}
           YLR130C (REAL)
          Length = 422

 Score =  449 bits (1155), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 231/411 (56%), Positives = 283/411 (68%), Gaps = 41/411 (9%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C++ NDY+G   +R+ A+FIILIS GLG YFPILSSRYSFIRLP+WCFFIAKFFGSGVIV
Sbjct: 14  CQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIV 73

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYG--- 159
           AT F+HLL+PAA+ALG+ECLGGTFA+YPWAFGICLMSLF LF +E +  Y+  K+ G   
Sbjct: 74  ATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLGHDH 133

Query: 160 -----------------------------FQNDHVHS----HFPXXXXXXXXXXXXXXXX 186
                                          N+ V+S      P                
Sbjct: 134 GDNEGVGTVDADIASSESAVRNGGPNPASLNNEAVYSIHNNKIPYTTRNEEIVGTPVKEK 193

Query: 187 XXYNQVVD---EENVSLTVANNNNGAEITATNPHPSMPGSNHFSHDKSHQDLATIGTPAQ 243
              + V++   E   + ++AN        ATN   S+PG +H+SH+  HQD + +G   +
Sbjct: 194 DPNSNVINYDLETGNTESIANGLIPMNSHATNL-TSVPGKDHYSHENYHQDASELGKGIE 252

Query: 244 MTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGA 303
              KE+Y NQ+L+VFILEFGIIFHSVF+GL+L+V G +EF TLFIVL FHQMFEG+GLG 
Sbjct: 253 EEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAG-EEFETLFIVLTFHQMFEGLGLGT 311

Query: 304 RIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAG 363
           R+AE +W +  R+TPWL+   FTLT+PIA+AIGIGVRHS+ PGSR ALIANG FD+IS+G
Sbjct: 312 RVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVRHSWVPGSRRALIANGVFDSISSG 371

Query: 364 ILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMALLGKWA 414
           ILIYTGLVELMAHEFLYS+ FKG +GLKKML A+F MC GA LMALLGKWA
Sbjct: 372 ILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIMCCGAALMALLGKWA 422

>Suva_10.223 Chr10 complement(411354..412616) [1263 bp, 420 aa] {ON}
           YLR130C (REAL)
          Length = 420

 Score =  448 bits (1153), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 232/410 (56%), Positives = 283/410 (69%), Gaps = 41/410 (10%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C++ NDY+G   +R+ A+FIILIS GLG YFPILSSRYSFIRLPD CFFIAKFFGSGVIV
Sbjct: 14  CQASNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPDCCFFIAKFFGSGVIV 73

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT FIHLL+PAA+ALG ECLGGTFA+YPWAFGICL+SLF LF +E +  Y+  K+ G  +
Sbjct: 74  ATAFIHLLQPAAEALGNECLGGTFAEYPWAFGICLISLFLLFFTEIITHYFVAKTLGHDH 133

Query: 163 -DH-----VHSHFPXXXXXX------XXXXXXXXXXXXYNQ-----VVDEENVSLTVANN 205
            DH     + S  P                        +N        +EE V+ +V   
Sbjct: 134 GDHGEVAAIDSRVPSSEYTIGNLHSDTASFNDEAVYSIHNNKNSYTAKNEELVATSVKEK 193

Query: 206 N-----------------NGAEITATNPH----PSMPGSNHFSHDKSHQDLATIGTPAQM 244
                             NG  I  ++ H     S+PG +H+SH+  HQD + +GT  + 
Sbjct: 194 ESDMLKYDLEVGKTESIANG--IVPSSSHMSNFASVPGKDHYSHENDHQDASQLGTQIEE 251

Query: 245 TSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGAR 304
             KE+Y NQ+L+VFILEFGIIFHSVF+GL+L+V G +EF TLFIVL FHQMFEG+GLG R
Sbjct: 252 EDKEQYINQMLAVFILEFGIIFHSVFVGLSLSVAG-EEFETLFIVLTFHQMFEGLGLGTR 310

Query: 305 IAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGI 364
           +AE +W    R+TPWL+   FTLT+PIA+A+GIGVRHS+ PGSR ALIANG FD+IS+GI
Sbjct: 311 VAETNWPDSKRYTPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRRALIANGIFDSISSGI 370

Query: 365 LIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMALLGKWA 414
           LIYTGLVELMAHEFLYS+ FKG +GL+KML A+F MC GA LMALLGKWA
Sbjct: 371 LIYTGLVELMAHEFLYSNQFKGPDGLRKMLSAYFIMCCGAALMALLGKWA 420

>Kpol_543.64 s543 complement(147560..148834) [1275 bp, 424 aa] {ON}
           complement(147560..148834) [1275 nt, 425 aa]
          Length = 424

 Score =  447 bits (1150), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 227/410 (55%), Positives = 285/410 (69%), Gaps = 41/410 (10%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           CE+ ND+DG+ N+RV ++F+I+IS GLG +FP+L+SRYSFIRLP+WCFFIAKFFGSGVIV
Sbjct: 18  CEATNDFDGRINLRVLSIFMIMISSGLGVFFPLLASRYSFIRLPEWCFFIAKFFGSGVIV 77

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           +T FIHLL PAA+ALG +CLGGTF +YPWAFGICLMSLF LF +E +  Y+ +KS    N
Sbjct: 78  STAFIHLLVPAAEALGNDCLGGTFVEYPWAFGICLMSLFLLFFTEIITHYFMSKS--LDN 135

Query: 163 DH-----VHSHF---------------PXXXXXXXXXXXXXXXXXXYNQVVDEENVS--- 199
           DH      HSHF                                  Y+  +D + V+   
Sbjct: 136 DHGDSGHSHSHFGNQNKDIEINSHFSSDEDEVDNKDISEERTYQMKYDFELDTKKVNEQT 195

Query: 200 -----------LTVANNNNGAEITATNPH----PSMPGSNHFSHDKSHQDLATIGTPAQM 244
                      +  +++ N      TN       S+PG NH+SHDK+HQD + +GTP + 
Sbjct: 196 SPLYSVSSYAQVGTSSSKNSILPKETNIKLKQLESIPGKNHYSHDKNHQDPSQLGTPVEE 255

Query: 245 TSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGAR 304
             KE+Y  Q++ V ILE G+IFHS+F+GL+LAV+G +EF TLFIVLVFHQMFEG+GLG R
Sbjct: 256 IDKEQYLGQIVGVTILEIGVIFHSIFVGLSLAVSG-EEFITLFIVLVFHQMFEGLGLGTR 314

Query: 305 IAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGI 364
           +AE +W    R+TPWL+A GFTLTTPIAIAIGIGVR+S+ PGSR +LIANG FDAIS+GI
Sbjct: 315 LAEANWPHSKRYTPWLMALGFTLTTPIAIAIGIGVRYSWIPGSRKSLIANGVFDAISSGI 374

Query: 365 LIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMALLGKWA 414
           LIYTGLVELMAHEFL+S+ FKG  G K+ML A+F MC GA LMA+LG+WA
Sbjct: 375 LIYTGLVELMAHEFLFSNQFKGPGGFKRMLSAYFVMCCGAALMAVLGRWA 424

>YLR130C Chr12 complement(402794..404062) [1269 bp, 422 aa] {ON}
           ZRT2Low-affinity zinc transporter of the plasma
           membrane; transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 422

 Score =  446 bits (1147), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 226/410 (55%), Positives = 281/410 (68%), Gaps = 39/410 (9%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C++ N Y+G   +R+ A+FIILIS GLG YFPILSSRYSFIRLP+WCFFIAKFFGSGVIV
Sbjct: 14  CQASNGYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWCFFIAKFFGSGVIV 73

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT F+HLL+PAA+ALG+ECLGGTFA+YPWAFGICLMSLF LF +E +  Y+  K+ G  +
Sbjct: 74  ATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEIITHYFVAKTLGHDH 133

Query: 163 -DH--VHSHFPXXXXXXXXXXXXXXXXXXYNQ--------------VVDEENVSLTVANN 205
            DH  V S                     +N                 +EE V+  +   
Sbjct: 134 GDHGEVTSIDVDAPSSGFVIRNMDSDPVSFNNEAAYSIHNDKTPYTTRNEEIVATPIKEK 193

Query: 206 NNGAEITATNPHP---------------------SMPGSNHFSHDKSHQDLATIGTPAQM 244
             G+ +T  +  P                     S+PG +H+SH+  HQD++ + T  + 
Sbjct: 194 EPGSNVTNYDLEPGKTESLANELVPTSSHATNLASVPGKDHYSHENDHQDVSQLATRIEE 253

Query: 245 TSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGAR 304
             KE+Y NQ+L+VFILEFGIIFHSVF+GL+L+V G +EF TLFIVL FHQMFEG+GLG R
Sbjct: 254 EDKEQYLNQILAVFILEFGIIFHSVFVGLSLSVAG-EEFETLFIVLTFHQMFEGLGLGTR 312

Query: 305 IAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGI 364
           +AE +W +  ++ PWL+   FTLT+PIA+A+GIGVRHS+ PGSR ALIANG FD+IS+GI
Sbjct: 313 VAETNWPESKKYMPWLMGLAFTLTSPIAVAVGIGVRHSWIPGSRRALIANGVFDSISSGI 372

Query: 365 LIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMALLGKWA 414
           LIYTGLVELMAHEFLYS+ FKG +GLKKML A+  MC GA LMALLGKWA
Sbjct: 373 LIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYLIMCCGAALMALLGKWA 422

>TPHA0A01550 Chr1 (310086..311321) [1236 bp, 411 aa] {ON} Anc_8.325
           YLR130C
          Length = 411

 Score =  441 bits (1133), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 227/397 (57%), Positives = 271/397 (68%), Gaps = 29/397 (7%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C++ + Y+G  NMRV ALFIILIS GLGS+FPIL+S YSFIRLPD CFF+AKFFGSGVIV
Sbjct: 19  CDTQSSYNGSTNMRVLALFIILISSGLGSFFPILASTYSFIRLPDCCFFVAKFFGSGVIV 78

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYY-TNKSYGFQ 161
           AT FIHLL+PA +AL   CLGGTF +YPWAFGICLMSLF LFL E +  +  T+  +G  
Sbjct: 79  ATAFIHLLDPAVEALSNTCLGGTFTEYPWAFGICLMSLFLLFLIEIMTHHMLTHDEHG-- 136

Query: 162 NDHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVA-----NNNNGAEITATNP 216
            D  HSH                     +   D  + S  +      + N   +I A + 
Sbjct: 137 -DGGHSHGDDTSYTASSIDDKEADSIDADVRKDANDDSYDINSILNFDKNKDYDIEANHY 195

Query: 217 HPSM-------------------PGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSV 257
             SM                   PG +HFSHD  HQDL  +GTP +   KEKY  Q++SV
Sbjct: 196 EVSMEDRNNTKMDNYKISQTKSTPGQDHFSHDSEHQDLVQLGTPVEQLDKEKYMGQIVSV 255

Query: 258 FILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFT 317
            ILEFG+IFHS+F GL+LAV+G DEF TLFIVLVFHQMFEG+GLG RIAE +W K  + T
Sbjct: 256 IILEFGVIFHSIFTGLSLAVSG-DEFETLFIVLVFHQMFEGLGLGTRIAETNWPKSKKNT 314

Query: 318 PWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHE 377
           PWLLA GFT++TPIAI IGIGVR+++ PGSRTALI NG FD+IS+GILIYTGLVELMAHE
Sbjct: 315 PWLLALGFTISTPIAIGIGIGVRYTFIPGSRTALITNGIFDSISSGILIYTGLVELMAHE 374

Query: 378 FLYSDNFKGENGLKKMLWAFFTMCWGAGLMALLGKWA 414
           FL+S  F G +G KKM++A+  MC GA LMALLGKWA
Sbjct: 375 FLFSKQFSGRDGFKKMIFAYVIMCCGAALMALLGKWA 411

>TPHA0D00970 Chr4 complement(195530..196681) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  438 bits (1126), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 218/376 (57%), Positives = 276/376 (73%), Gaps = 19/376 (5%)

Query: 43  CESDNDYDGK-DNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVI 101
           C+ ++DYDG+ DN+R+ A+F++LIS GLGS+FPILSS+YS IRLP+WCFFIAKFFGSGVI
Sbjct: 23  CDIESDYDGQSDNLRILAVFMVLISSGLGSFFPILSSKYSVIRLPNWCFFIAKFFGSGVI 82

Query: 102 VATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYG-- 159
            AT FIHLLEPA D LG +CLGGTFA+YPWAFGICLMSLF LFL E V  +   K+    
Sbjct: 83  TATAFIHLLEPATDELGNDCLGGTFAEYPWAFGICLMSLFTLFLVEIVTHHLMEKNVAGV 142

Query: 160 FQNDHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITAT-NPHP 218
             N  VH H                    +++V D   + +T       +E     NP  
Sbjct: 143 TPNKVVHMH-----------DEISSSDEGFDKVDDVNELEVTNTQLTTASEDRIDFNP-- 189

Query: 219 SMPGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVT 278
            + G+NH+SH + HQD+  + +  + T KE Y +Q++S+ ILEFG+IFHS+F+GL+LAV+
Sbjct: 190 -IIGANHYSHAEHHQDIEQMNSALEETGKESYSSQIVSLLILEFGVIFHSIFVGLSLAVS 248

Query: 279 GNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIG 338
           G DEF TLF+V++FHQMFEG+GLG+RIAE +W  ++ +TPWLLA GFT+ TPIAIAIGIG
Sbjct: 249 G-DEFKTLFVVIIFHQMFEGLGLGSRIAEQNWGVRNTYTPWLLALGFTVATPIAIAIGIG 307

Query: 339 VRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFF 398
           VR+SY PGSR ALI++G FD++SAGILIYTGLVELMAHEFL+S  F+GENG KKML A+ 
Sbjct: 308 VRYSYFPGSRNALISSGIFDSLSAGILIYTGLVELMAHEFLFSKQFQGENGFKKMLLAYV 367

Query: 399 TMCWGAGLMALLGKWA 414
            MC G  LMAL+GKWA
Sbjct: 368 CMCCGCALMALIGKWA 383

>KAFR0H02250 Chr8 (429002..430141) [1140 bp, 379 aa] {ON} Anc_8.325
           YLR130C
          Length = 379

 Score =  437 bits (1125), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 219/378 (57%), Positives = 274/378 (72%), Gaps = 19/378 (5%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C + NDYDG +N+R+ ++FI+LIS  +G +FPIL+SRYSFI LP WCFFIAKFFGSGVIV
Sbjct: 15  CSTSNDYDGNNNLRILSVFILLISASIGVFFPILASRYSFINLPGWCFFIAKFFGSGVIV 74

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT FIHLLEPA++ LG++CLGGTFA+YPWAFGICLMSLF LFL E ++ Y+ NK++G  +
Sbjct: 75  ATAFIHLLEPASEELGDDCLGGTFAEYPWAFGICLMSLFFLFLVEIISHYFVNKNFGHDH 134

Query: 163 DH------VHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNP 216
            H      VH H P                  + +   E   S  +  +         + 
Sbjct: 135 GHDETGTIVH-HIPREEDEEEEDSLDED----FKKGDIESQTSPDIRTHK-------LDR 182

Query: 217 HPSMPGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALA 276
             S+ G +HFSHD +HQD + +GT  +   KE+Y NQ++++FILE GIIFHS+FIGL+LA
Sbjct: 183 LASILGKDHFSHDSTHQDPSQLGTSTEEFQKEQYLNQIVALFILESGIIFHSIFIGLSLA 242

Query: 277 VTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIG 336
           VTG  EF TLFIVL FHQMFEG+GLG RI+E +W +  ++ PWL+   F LTT IA+AIG
Sbjct: 243 VTGA-EFKTLFIVLTFHQMFEGLGLGTRISEANWPQSKKYIPWLMGLAFALTTAIAVAIG 301

Query: 337 IGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWA 396
           IGVRHS+ PGSR ALIA+G FD+ISAGILIYTGLVELMAHEFLYS+ FKG +G K+ML+A
Sbjct: 302 IGVRHSWVPGSRNALIASGIFDSISAGILIYTGLVELMAHEFLYSNQFKGPDGFKRMLFA 361

Query: 397 FFTMCWGAGLMALLGKWA 414
           +F MC GA LMALLGKWA
Sbjct: 362 YFIMCCGAALMALLGKWA 379

>CAGL0E01353g Chr5 (127845..129146) [1302 bp, 433 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130c ZRT2
           or uniprot|P32804 Saccharomyces cerevisiae YGL255w ZRT1
          Length = 433

 Score =  437 bits (1124), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 226/415 (54%), Positives = 276/415 (66%), Gaps = 44/415 (10%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C  DND++G  N+R+ ++F++LIS  +G YFP+L+SRYSFI LP W FFIAKFFGSGVIV
Sbjct: 20  CAVDNDFNGHTNLRILSVFMVLISSAIGVYFPLLASRYSFINLPSWVFFIAKFFGSGVIV 79

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT FIHLLEPA+D+LG  CLGGTFA+YPWAFGICLM+LFALFL E V+ +Y  K+ G  +
Sbjct: 80  ATAFIHLLEPASDSLGNPCLGGTFANYPWAFGICLMALFALFLIEIVSHHYVGKTMGGGH 139

Query: 163 DH----------VHSH------FPXXXXXXXXXXXXXXXXXXYNQVVDEEN--------- 197
           +H           H H                          Y  VV   N         
Sbjct: 140 NHSHNMPTTFGQTHMHGVEDDMVDEDGSSSTHSHSHVAMDDKYGDVVKNNNYNYDDGSDD 199

Query: 198 -----------VSLTVANNNNGAEI-------TATNPHPSMPGSNHFSHDKSHQDLATIG 239
                          V N++N  +        T  +P   MPG NHFSHD+ HQD+  IG
Sbjct: 200 IESQKRPAFNVAQQKVRNDSNENDSLVGHVHNTTVDPLEHMPGHNHFSHDEVHQDITQIG 259

Query: 240 TPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGM 299
           + A    KE+Y NQL S+FILEFGI+FHSVF+GL+L+V+G DEF TLF+V+VFHQMFEGM
Sbjct: 260 SKANDQQKEQYLNQLTSLFILEFGILFHSVFVGLSLSVSG-DEFKTLFVVIVFHQMFEGM 318

Query: 300 GLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDA 359
           GLGARI E  W    R+ P+LL  G+T+TTPIAIAIGIGVRHS+ PGSR +LI NG FDA
Sbjct: 319 GLGARITECYWPHSKRWLPYLLGFGYTITTPIAIAIGIGVRHSFVPGSRRSLIVNGVFDA 378

Query: 360 ISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMALLGKWA 414
           ISAGIL+Y GLVELMAHEFL+++ FKGE+GL+ ML A+F M  GAGLMALLG+WA
Sbjct: 379 ISAGILVYAGLVELMAHEFLFTNQFKGEHGLRNMLAAYFVMALGAGLMALLGRWA 433

>TBLA0H01270 Chr8 (286413..287618) [1206 bp, 401 aa] {ON} Anc_8.325
           YLR130C
          Length = 401

 Score =  431 bits (1109), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 223/380 (58%), Positives = 272/380 (71%), Gaps = 13/380 (3%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           CE+ NDYDG+ N+R+ ++FI+LIS G+G  FPIL+S+YSFIRLP WCFFIAKFFGSGVI+
Sbjct: 27  CETSNDYDGRMNLRILSVFILLISSGIGVNFPILASQYSFIRLPKWCFFIAKFFGSGVII 86

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT F+HLLEPAADALG  CLGGTFA+YPWAFGICLMSLF LF +E ++ +  ++    ++
Sbjct: 87  ATAFVHLLEPAADALGNACLGGTFAEYPWAFGICLMSLFFLFFTEIISHHIIDQRLAKEH 146

Query: 163 DHVH--SHFPXXXXXXXXXXXXXXXXXXYN-QVVDEENVSLTVANNNNGAEITATNPHPS 219
            H H   H                     N  V+ EEN + T  ++ N  E  A +    
Sbjct: 147 GHGHDEEHAAIERVDTIECCEENSCDEEPNPMVIQEENSATTYIDSKNKDEKKAAD---- 202

Query: 220 MPGSNHFSHDKSHQ--DLA-TIGTPAQMT--SKEKYQNQLLSVFILEFGIIFHSVFIGLA 274
           +  + H  +D   +  DL  +I     MT   +E+Y NQL++V +LE G+I HSVFIGL+
Sbjct: 203 VQINEHLQYDSQEKTVDLENSISHHDGMTRAEREQYLNQLVAVMVLEAGVIVHSVFIGLS 262

Query: 275 LAVTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIA 334
           LAVTG D F TLFIVL FHQMFEG+GLG R+AE  W K  R TPWL+A  FTLTTP+A+A
Sbjct: 263 LAVTG-DNFVTLFIVLTFHQMFEGLGLGTRVAETPWPKSKRMTPWLMALAFTLTTPVAVA 321

Query: 335 IGIGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKML 394
           IG+GVR+S+ PGSRT+LIANG FDAISAGILIYTGLVELMAHEFLYS  FKGENGLK+ML
Sbjct: 322 IGLGVRNSWVPGSRTSLIANGIFDAISAGILIYTGLVELMAHEFLYSGQFKGENGLKQML 381

Query: 395 WAFFTMCWGAGLMALLGKWA 414
            A+F MC GA LMALLGKWA
Sbjct: 382 SAYFVMCCGAALMALLGKWA 401

>KNAG0A05180 Chr1 (764235..765422) [1188 bp, 395 aa] {ON} Anc_8.325
           YLR130C
          Length = 395

 Score =  419 bits (1077), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 230/389 (59%), Positives = 277/389 (71%), Gaps = 31/389 (7%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C   N+YDG+ N+R+ ++FIILIS  +GS+FPILSS+YSFIRLPDWCFF+AKFFGSGVIV
Sbjct: 21  CADTNEYDGRSNLRILSIFIILISSAMGSFFPILSSKYSFIRLPDWCFFLAKFFGSGVIV 80

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT F+HLL+PA +AL +ECL GTF  YPWAFGICLMSLF LFL E V+ Y   K++G   
Sbjct: 81  ATAFVHLLQPANEALTDECLTGTFQSYPWAFGICLMSLFLLFLMELVSHYLIAKTFG-HA 139

Query: 163 DHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENV------SLTVANNNNGA--EITAT 214
            H HS F                     +++DE +       SL    N+N A  E    
Sbjct: 140 AHDHSDF------------GNFVRKDSKELIDESDSESLHKGSLRFEVNSNSAPEEDIEE 187

Query: 215 NPH---------PSMPGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGII 265
           NPH          SMPG  H+ H   HQD A +G+P +  +KEKY NQ+++V  LEFGI+
Sbjct: 188 NPHTILGNSDKMASMPGKGHYDHAVFHQDPAQLGSPLEEPNKEKYANQIMAVLFLEFGIL 247

Query: 266 FHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGF 325
           FHSVFIGL+LAV G DEF TLFIVLVFHQMFEG+GLG RIAE  W +  R TPW+LA GF
Sbjct: 248 FHSVFIGLSLAVAG-DEFKTLFIVLVFHQMFEGLGLGTRIAETKWPENRRLTPWMLALGF 306

Query: 326 TLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFK 385
           TLTTP+AIAIG+GVRHS+ PGSR AL++NG FD+IS+GILIYTGLVELMAHEFLYS+ F 
Sbjct: 307 TLTTPVAIAIGLGVRHSFIPGSRKALVSNGVFDSISSGILIYTGLVELMAHEFLYSNQFN 366

Query: 386 GENGLKKMLWAFFTMCWGAGLMALLGKWA 414
           G +G KKM+ A+  MC+G GLMALLGKWA
Sbjct: 367 GADGFKKMILAYVIMCFGVGLMALLGKWA 395

>Ecym_4202 Chr4 (419650..420777) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii AGL143C
          Length = 375

 Score =  415 bits (1067), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 200/376 (53%), Positives = 266/376 (70%), Gaps = 36/376 (9%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           CE  N YDG+D++RV A+F+ILI+  +G+ FP+LS+ YS IRLP +CFF AK+FGSGVIV
Sbjct: 32  CEVGNSYDGQDHLRVVAIFVILITSAIGTIFPLLSTNYSRIRLPSYCFFFAKYFGSGVIV 91

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           ATGFIHLL+PA + L  ECLGG FA YPWAF IC+M+LF+LF  E    ++ +KS     
Sbjct: 92  ATGFIHLLQPANENLSNECLGGVFAQYPWAFAICMMALFSLFFVEINTHHFVHKS----- 146

Query: 163 DHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVS-LTVANNNNGAEITATNPHPSM- 220
                                      N++ +  NVS  ++ + ++  +  A +   S+ 
Sbjct: 147 ---------------------------NRLAENGNVSGKSLKDEDSQLDSKAADAPTSVL 179

Query: 221 --PGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVT 278
             PG+ HFSHD+ HQD+      A   +KE+Y NQL+S+FILEFG++FHS+ IGLALAV+
Sbjct: 180 GPPGNKHFSHDEYHQDIEQANGLATNPNKEQYSNQLISLFILEFGVVFHSILIGLALAVS 239

Query: 279 GNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIG 338
            ++EF TLF+VL+FHQMFEG+GLG RIAE SW      TPWLLA G++L TP+AIA+G+G
Sbjct: 240 SSEEFVTLFVVLIFHQMFEGLGLGTRIAEASWGSGKSLTPWLLAFGYSLATPLAIAVGLG 299

Query: 339 VRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFF 398
           ++HS+AP SR +LI NG FDAISAG+LIYTGL+ELMAHEFL+S++FKGENG  KM++ F 
Sbjct: 300 IKHSFAPESRQSLIVNGIFDAISAGVLIYTGLIELMAHEFLFSNSFKGENGYTKMMYGFI 359

Query: 399 TMCWGAGLMALLGKWA 414
            MC+GAG M+LLG+WA
Sbjct: 360 IMCFGAGSMSLLGRWA 375

>KLTH0F09064g Chr6 (779431..780516) [1086 bp, 361 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low- zinc conditions by
           the Zap1p transcription factor
          Length = 361

 Score =  401 bits (1030), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 200/375 (53%), Positives = 265/375 (70%), Gaps = 32/375 (8%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C + N++DG++ +RV ALF+I+ S  LG++FPI++S YS + LPDWCFF+AKFFGSGVI+
Sbjct: 16  CSTSNEFDGREGLRVGALFVIMASSALGAFFPIMASNYSAVSLPDWCFFVAKFFGSGVII 75

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNK---SYG 159
           ATGF+HLL+PA +AL + CL GTF DYPWAFGICLMSL+A+FL E V  +  ++   +Y 
Sbjct: 76  ATGFVHLLQPANEALTDPCLTGTFQDYPWAFGICLMSLYAIFLVEIVTHHMLSRVAPAYS 135

Query: 160 FQNDHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPS 219
                 HS                      +    ++ + L+   +     + +     S
Sbjct: 136 ATEARAHS--------------------GSDATCMDDELRLSELQD-----LRSKPQEMS 170

Query: 220 MPGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTG 279
            PGS+    D  +Q+   + + +  T  E + +Q+++VFILEFG+IFHSVFIGL+LAV+G
Sbjct: 171 KPGSDG---DAVYQEAHRVLSASSSTVTEGFLSQVVTVFILEFGVIFHSVFIGLSLAVSG 227

Query: 280 NDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGV 339
           + EF TLFIVL+FHQMFEG+GLG RIAE+SW    R+TPW+LA GF+++TPIAIAIG+GV
Sbjct: 228 S-EFITLFIVLIFHQMFEGLGLGTRIAEISWPANKRYTPWILALGFSISTPIAIAIGLGV 286

Query: 340 RHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFT 399
           RHS +  SR+ LIANGCFDAIS+GILIYTGLVELMAHEF++S  FKG  GLKKML+AF  
Sbjct: 287 RHSLSTNSRSGLIANGCFDAISSGILIYTGLVELMAHEFIFSSQFKGPGGLKKMLFAFTM 346

Query: 400 MCWGAGLMALLGKWA 414
           MC G+GLMALLG+WA
Sbjct: 347 MCAGSGLMALLGRWA 361

>CAGL0M04301g Chr13 complement(472227..473396) [1170 bp, 389 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130c ZRT2 or uniprot|P32804 Saccharomyces cerevisiae
           YGL255w ZRT1
          Length = 389

 Score =  400 bits (1027), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 202/388 (52%), Positives = 264/388 (68%), Gaps = 27/388 (6%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C ++NDY+G+ N+R+ A+FI++IS GLG+YFPILSS+YSFIRLP+WCFF+AKFFGSGVI+
Sbjct: 13  CSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCFFVAKFFGSGVII 72

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT FIHLL+PAA+AL ++CLGGTF DYPWAFGICLMSLF LFL+E VA ++ +K +    
Sbjct: 73  ATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVAHHFVDKKF---- 128

Query: 163 DHVHSH------FPXXXXXXXXXXXXXXXXXXYN------QVVDEENVSLTVANNNNGAE 210
           +H H+        P                   N       + D + +   V+ N    +
Sbjct: 129 NHSHAETDNANALPDIILKDIQISTDDLSEGMLNCAGHQDSLQDSKKIETGVSTNLKRVD 188

Query: 211 ITATNPHPSMPGSNHFSHDKSHQDLATIGTPAQMTSKEK----YQNQLLSVFILEFGIIF 266
            +         G   +  + + +      T     S+ K    Y +++  + +LEFGIIF
Sbjct: 189 DSG------FEGQYEYKRESTDETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIF 242

Query: 267 HSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFT 326
           HSVF+GL+LAV G+ EF  LFIV+ FHQMFEG+GLG RIAE  W     +TPW++A  FT
Sbjct: 243 HSVFVGLSLAVAGS-EFKVLFIVITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFT 301

Query: 327 LTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKG 386
           +T+PIAIAIGIGVRHS+ PGSR ALIANG FD+IS+GILIYTGL+ELMAHEF++S+ FKG
Sbjct: 302 ITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKG 361

Query: 387 ENGLKKMLWAFFTMCWGAGLMALLGKWA 414
           E+ L+ ML A+F MC GA LMALLG+WA
Sbjct: 362 EHSLRNMLTAYFIMCCGAALMALLGRWA 389

>AGL143C Chr7 complement(431959..433083) [1125 bp, 374 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YLR130C
           (ZRT2) and YGL255W (ZRT1)
          Length = 374

 Score =  398 bits (1023), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 194/378 (51%), Positives = 256/378 (67%), Gaps = 37/378 (9%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C ++N+YDG D +R+ ++FIIL++  +G++FP+L SR+S +RLP W FF AK+FGSGVIV
Sbjct: 28  CPTENEYDGSDGIRILSVFIILLASAIGTFFPMLGSRFSRVRLPTWAFFFAKYFGSGVIV 87

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           ATGFIHLL    ++L   CLGG  ++YPWAF IC+MSLF LF  E  + ++ NK+     
Sbjct: 88  ATGFIHLLLHGHESLSNPCLGGVLSEYPWAFAICMMSLFTLFFVEINSHHFVNKA----- 142

Query: 163 DHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPG 222
                                          DE+++       +   E T   P+ ++ G
Sbjct: 143 ---------------------ARSTAVAVAGDEKSI-----KEDESTEDTPPKPNTAVSG 176

Query: 223 SN------HFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALA 276
           +N      HF+HD+ HQDL    + A   ++E+Y NQL+S+FILEFG++FHSV IGL+LA
Sbjct: 177 ANSAVVSQHFAHDECHQDLEQAKSLAADPNREQYLNQLISLFILEFGVVFHSVLIGLSLA 236

Query: 277 VTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIG 336
           VT  D F TLF+VL+FHQMFEGMGLGARIAE  W    ++TPWLL  G+ L+TPIAIAIG
Sbjct: 237 VTAEDHFTTLFVVLIFHQMFEGMGLGARIAETEWGVHRKWTPWLLGLGYCLSTPIAIAIG 296

Query: 337 IGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWA 396
           +GVRHS+AP SR +LI NG FD++SAGI++YTGL+ELMAHEFL+S++FKGE G  KM+  
Sbjct: 297 LGVRHSFAPESRPSLIVNGVFDSLSAGIMLYTGLIELMAHEFLFSNSFKGEGGFNKMMQG 356

Query: 397 FFTMCWGAGLMALLGKWA 414
           F  MC GAGLMALLGKWA
Sbjct: 357 FVYMCLGAGLMALLGKWA 374

>Kpol_1006.10 s1006 complement(43032..44207) [1176 bp, 391 aa] {ON}
           complement(43032..44207) [1176 nt, 392 aa]
          Length = 391

 Score =  385 bits (990), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 197/373 (52%), Positives = 252/373 (67%), Gaps = 4/373 (1%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C ++N+Y+G  N+R+ ++F+ILIS  +GS+ P++ S      +P W FFIAKFFGSGVI+
Sbjct: 22  CAANNEYNGDLNLRILSVFMILISSAIGSFAPLILSNTKMFNVPSWFFFIAKFFGSGVII 81

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGF-Q 161
           AT FIHLL PA DAL  +CLG  F DYPW+F I L+SLF LF  E +  +Y +K+    Q
Sbjct: 82  ATSFIHLLSPATDALSNDCLGPGFTDYPWSFAIALISLFVLFFVELIVYHYMSKADRLLQ 141

Query: 162 NDHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMP 221
           +  VH H                     ++ +++ N  +   N N+  +   TN +P M 
Sbjct: 142 SPDVHYHKHSSMNSHGCTDDQSDLASKKSKNIEKVNEDIESCNINDNQDEINTNFNP-ML 200

Query: 222 GSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGND 281
           G +HFSH  +HQD      P   T  E + NQL++V   E GI+FHSVFIGL+LAV G+ 
Sbjct: 201 GKDHFSHKDTHQDRNPSNPPLNNTD-EGFYNQLVAVLFFESGIVFHSVFIGLSLAVAGS- 258

Query: 282 EFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRH 341
           EF TLF+VLVFHQMFE +GLGAR+ EV W K  R+ PWLLA GF+L TPIAIAIGIGVR+
Sbjct: 259 EFKTLFVVLVFHQMFEALGLGARLVEVEWKKDKRWMPWLLALGFSLCTPIAIAIGIGVRN 318

Query: 342 SYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMC 401
           S+ P S+ ALI NG FD+ISAGILIYTGLVEL+AHEFL+S+ FK  NG K+M+ A+F MC
Sbjct: 319 SWTPESKGALITNGIFDSISAGILIYTGLVELIAHEFLFSNQFKNPNGFKQMMLAYFVMC 378

Query: 402 WGAGLMALLGKWA 414
            GAGLMALLGKWA
Sbjct: 379 IGAGLMALLGKWA 391

>TBLA0F02390 Chr6 (588534..589817) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score =  384 bits (987), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 210/410 (51%), Positives = 259/410 (63%), Gaps = 40/410 (9%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C + NDYDG+DN+R+ A+F++LIS  +G +FPIL+SRYSFIR+P   FFIAKFFGSGVIV
Sbjct: 20  CPTQNDYDGRDNLRILAVFMLLISSSIGVFFPILASRYSFIRIPPIFFFIAKFFGSGVIV 79

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYY----TNKSY 158
           AT FIHLL+PA D L + CLGG + +YPWAFGICLM+LF +F SE +A Y+      K+ 
Sbjct: 80  ATAFIHLLQPAYDELNDPCLGGVWQEYPWAFGICLMALFLIFFSELMAHYFIERNERKNG 139

Query: 159 GFQNDHVHSHF--PXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITA--- 213
           G   D   SHF  P                      V   +  L    N++  E  A   
Sbjct: 140 GKVPDPHASHFRNPEFRGHKHGADNESGEMMEKEDQVGSPSDDLESQENDSIVERDAGAS 199

Query: 214 -----------------TNPHPSMPGSNH----------FSHDKSHQD--LATIGTPAQM 244
                             N H    G N            S D    D   A    P  +
Sbjct: 200 DEYRFYNEEEDVKRGDRENVHSVADGKNENLVFSEHNVEVSEDSEDSDGLFAAERKPEDV 259

Query: 245 TSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGAR 304
           ++ E Y  +L+SV ILE GII HS+FIGL+L+V G  EF+TLF+VL+FHQMFEG+GLG R
Sbjct: 260 SNSE-YVRELVSVMILESGIIAHSIFIGLSLSVAGK-EFDTLFVVLIFHQMFEGLGLGTR 317

Query: 305 IAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGI 364
           +AEV W    R+TPW+L A F +TTPI+ AIGIGVRHS+ PGSR+ALI NG FD+ISAGI
Sbjct: 318 VAEVEWPYSKRYTPWILGACFGVTTPISAAIGIGVRHSWVPGSRSALIVNGIFDSISAGI 377

Query: 365 LIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMALLGKWA 414
           LIYTGLVELMAHEFLY++NF+G+N LKK+L A+F MC G GLMALLGKWA
Sbjct: 378 LIYTGLVELMAHEFLYANNFEGKNSLKKLLLAYFVMCCGCGLMALLGKWA 427

>SAKL0F16346g Chr6 complement(1331198..1332337) [1140 bp, 379 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130C ZRT2 Low-affinity zinc transporter of the plasma
           membrane transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 379

 Score =  364 bits (934), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 196/382 (51%), Positives = 242/382 (63%), Gaps = 48/382 (12%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           C   + Y+G D +R+ A+FI+LIS  +GS+ P+L S+YSFIRLPDW FFIAK+FGSGVI+
Sbjct: 36  CPGGSGYNGNDGIRILAVFILLISSAIGSFSPLLGSKYSFIRLPDWFFFIAKYFGSGVII 95

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVA-RYYTNKSYGFQ 161
           ATGFIHLL  ++ +LGEECLG  F  YPWA+ ICL S+F +F  E +A R +   S    
Sbjct: 96  ATGFIHLLFHSSHSLGEECLGDGFTSYPWAYLICLASIFTVFFVELLAHRLFIKASSDSA 155

Query: 162 NDHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMP 221
           +D                                    L  A +NN +E         M 
Sbjct: 156 SD------------------------------------LEFAESNNTSEENYPKNSAVMV 179

Query: 222 GSNHFSHDKSHQDLATIGTP---AQMTSKEKYQN------QLLSVFILEFGIIFHSVFIG 272
             +    D +   L   G P    Q  S E Y+N      QL+++F+LEFG++FHSVF+G
Sbjct: 180 SKSETQQDDTSSVLDN-GLPLKDEQSESSENYKNNGSHSTQLIAIFVLEFGVLFHSVFVG 238

Query: 273 LALAVTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIA 332
           L+LAV G DEFNTLFIVL+FHQMFEG+GLGARIAE +W  K RFTPW+LA  F + TPI+
Sbjct: 239 LSLAVAG-DEFNTLFIVLIFHQMFEGLGLGARIAETNWPHKRRFTPWMLALAFAVCTPIS 297

Query: 333 IAIGIGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKK 392
           IAIGIGV+ SYAP S  +LI  G FDAISAGILIY G+VELMAHEF +   F+G   LK 
Sbjct: 298 IAIGIGVKKSYAPYSSRSLIFTGVFDAISAGILIYAGIVELMAHEFFHETTFQGPGKLKS 357

Query: 393 MLWAFFTMCWGAGLMALLGKWA 414
           MLWAFF MC GAGLM+LLGKWA
Sbjct: 358 MLWAFFIMCLGAGLMSLLGKWA 379

>NDAI0G02570 Chr7 (588135..589424) [1290 bp, 429 aa] {ON} Anc_8.325
          Length = 429

 Score =  300 bits (769), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 145/221 (65%), Positives = 174/221 (78%), Gaps = 7/221 (3%)

Query: 194 DEENVSLTVANNNNGAEITATNPHPSMPGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQ 253
           D +N+S    NN N   +T  N   S+PG +HFSHD  HQD   +GTP +   KE+Y NQ
Sbjct: 216 DRQNIS---GNNKNNDNMTRFN---SIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQ 269

Query: 254 LLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKK 313
           + +VFILEFGIIFHSVF+GL+L+V+G +EF TLFIVL FHQMFEG+GLG R+AE +W   
Sbjct: 270 MFAVFILEFGIIFHSVFVGLSLSVSG-EEFETLFIVLTFHQMFEGLGLGTRVAETNWPSN 328

Query: 314 HRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVEL 373
            R+TPWL+   FT+T+PIA+AIGIGVRHS+ PGSR ALIANG FD+IS+GILIYTGLVEL
Sbjct: 329 RRYTPWLMGLAFTITSPIAVAIGIGVRHSWIPGSRKALIANGVFDSISSGILIYTGLVEL 388

Query: 374 MAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMALLGKWA 414
           MAHEFLYS+ FKG +G KKML A+F MC GAGLMALLGKWA
Sbjct: 389 MAHEFLYSNQFKGPDGFKKMLAAYFIMCLGAGLMALLGKWA 429

 Score =  189 bits (481), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 89/126 (70%), Positives = 100/126 (79%), Gaps = 3/126 (2%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           CE  NDY+G   +R+ A+FIILIS GLG YFPILSSRYSFIRLP WCFF+AKFFGSGVIV
Sbjct: 13  CEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCFFLAKFFGSGVIV 72

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           +T FIHLL+PAA+ALG ECLGGTF +YPWAFGICLMSLF LF  E V  Y+  KS+G   
Sbjct: 73  STAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVTHYFVAKSFG--- 129

Query: 163 DHVHSH 168
           D  H H
Sbjct: 130 DEHHDH 135

>NCAS0C03250 Chr3 (638559..639848) [1290 bp, 429 aa] {ON} Anc_8.325
          Length = 429

 Score =  295 bits (754), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 166/196 (84%), Gaps = 1/196 (0%)

Query: 219 SMPGSNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVT 278
           S+PG +HF HD  HQD + IGTP +  +KE+Y NQ+++VFILEFGIIFHSVF+GL+L+V+
Sbjct: 235 SVPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHSVFVGLSLSVS 294

Query: 279 GNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIG 338
           G +EF TLFIVL+FHQMFEG+GLG R+AE +W K  R+TPWL+   FT+T+PIA+AIGIG
Sbjct: 295 G-EEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIG 353

Query: 339 VRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFF 398
           VR S+ PGSR ALIANG FD+IS+GILIYTGLVELMAHEFLYS+ FKG  GLKKML A+F
Sbjct: 354 VRKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYF 413

Query: 399 TMCWGAGLMALLGKWA 414
            MC GAGLMALLGKWA
Sbjct: 414 IMCMGAGLMALLGKWA 429

 Score =  184 bits (467), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (79%), Gaps = 3/124 (2%)

Query: 43  CESDNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIV 102
           CE  N Y+G   +R+ A+FIILIS GLG +FPI++SRYSFI LP+WCFF+AKFFGSGVIV
Sbjct: 13  CEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIV 72

Query: 103 ATGFIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           AT FIHLL+PAA+ALG  CLGGTF +YPWAFGICLMSLF LFL E V  YY  KS+G   
Sbjct: 73  ATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSFG--- 129

Query: 163 DHVH 166
           DH H
Sbjct: 130 DHDH 133

>Smik_7.6 Chr7 (15678..16796) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  253 bits (645), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 147/373 (39%), Positives = 212/373 (56%), Gaps = 44/373 (11%)

Query: 46  DNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATG 105
           +N+Y+G    R+ ++F+IL      + FP++S++   +++P + +  A++FGSGVIVAT 
Sbjct: 40  ENEYNGNLGARISSVFVILFVSTFFTMFPLISTKVKKLKIPLYAYLFARYFGSGVIVATA 99

Query: 106 FIHLLEPAADALG-EECLG--GTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           FIHL++PA  A+G   C+G  G +  Y W   I L SL   FL++  +  +  K YG  +
Sbjct: 100 FIHLMDPAYGAIGGNTCVGQTGNWGIYAWCPAIMLTSLTITFLTDLFSSVWVEKKYGLSH 159

Query: 163 DHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPG 222
           DH H                       + VV+ E VS       +    TA   H S  G
Sbjct: 160 DHTHDDVK-------------------DTVVNNEVVS-------SPENCTANGSHDSKNG 193

Query: 223 SNHFSH-DKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGND 281
             +F   D S  D+            + +Q Q  +  ILEFG+IFHSV IGL L  TG +
Sbjct: 194 VEYFEESDVSSLDVV-----------QSFQAQFYAFLILEFGVIFHSVMIGLNLGSTG-E 241

Query: 282 EFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRH 341
           EF TL+ VLVFHQ FEG+G+GAR++ + + +  R+ PW L   + LTTPI +AIG+GVR 
Sbjct: 242 EFATLYPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCIAYGLTTPICVAIGLGVRT 301

Query: 342 SYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMC 401
            Y  GS TAL+ +G  DAISAGIL+YTGLVEL+A +F++  N +    LK++ +      
Sbjct: 302 RYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIF--NPQRTKNLKELSFNVICTL 359

Query: 402 WGAGLMALLGKWA 414
           +GAG+MAL+GKWA
Sbjct: 360 FGAGIMALIGKWA 372

>YGL255W Chr7 (20978..22108) [1131 bp, 376 aa] {ON}
           ZRT1High-affinity zinc transporter of the plasma
           membrane, responsible for the majority of zinc uptake;
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 376

 Score =  251 bits (642), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 142/371 (38%), Positives = 209/371 (56%), Gaps = 38/371 (10%)

Query: 47  NDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATGF 106
           N+Y+G    R+ ++F+IL      + FP++S++   +R+P + +  AK+FGSGVIVAT F
Sbjct: 41  NEYNGNLGARISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF 100

Query: 107 IHLLEPAADALG-EECLG--GTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQND 163
           IHL++PA  A+G   C+G  G +  Y W   I L SL   FL++  +  +  + YG  +D
Sbjct: 101 IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVWVERKYGLSHD 160

Query: 164 HVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPGS 223
           H H                       + VV       +  +N NG   TA   H +  G 
Sbjct: 161 HTHDEIK-------------------DTVVRNTAAVSSENDNENG---TANGSHDTKNGV 198

Query: 224 NHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEF 283
            ++    +            M   + +Q Q  +  ILEFG+IFHSV IGL L   G DEF
Sbjct: 199 EYYEDSDA----------TSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVG-DEF 247

Query: 284 NTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSY 343
           ++L+ VLVFHQ FEG+G+GAR++ + + +  R+ PW L   + LTTPI +AIG+GVR  Y
Sbjct: 248 SSLYPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIGLGVRTRY 307

Query: 344 APGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWG 403
             GS TAL+ +G  DAISAGIL+YTGLVEL+A +F++  N +    L+++ +      +G
Sbjct: 308 VSGSYTALVISGVLDAISAGILLYTGLVELLARDFIF--NPQRTKDLRELSFNVICTLFG 365

Query: 404 AGLMALLGKWA 414
           AG+MAL+GKWA
Sbjct: 366 AGIMALIGKWA 376

>Suva_7.6 Chr7 (15340..16458) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  250 bits (638), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 142/372 (38%), Positives = 209/372 (56%), Gaps = 42/372 (11%)

Query: 46  DNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATG 105
           +N+Y+G    R+ ++F+I +     + FP++S R    ++P + +  AK+FGSGVIVAT 
Sbjct: 40  ENEYNGNLGARISSIFVIFVVSTFFTLFPLISLRVKRFKIPLYAYLFAKYFGSGVIVATA 99

Query: 106 FIHLLEPAADALG-EECLG--GTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           FIHL++PA  A+G   C+G  G ++ Y W   I L SLF  FL++  +  +  + YG  +
Sbjct: 100 FIHLVDPAYSAIGGNSCVGQTGDWSLYAWCPAIMLTSLFFTFLTDLFSSVWVERKYGVAH 159

Query: 163 DHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPG 222
           DH H                             + +  TV N+       A N       
Sbjct: 160 DHTH-----------------------------DTIKDTVVND-------AANTSDENGT 183

Query: 223 SNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDE 282
           +N    DK+  +       + + + + +Q+Q  +  ILEFG+IFHSV IGL L  TG +E
Sbjct: 184 ANRSYDDKNKVEYFEESDASTLDTVQSFQSQFYAFLILEFGVIFHSVMIGLNLGSTG-EE 242

Query: 283 FNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHS 342
           F TL+ VLVFHQ FEG+G+GAR++ + + K  R+ PW L   + LTTPI +AIG+G+R  
Sbjct: 243 FATLYPVLVFHQSFEGLGMGARLSGIEFPKSKRWWPWALCIAYGLTTPICVAIGLGIRTK 302

Query: 343 YAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCW 402
           Y  GS TA + +G  DAISAGILIYTGLVEL+A +FL+  N      +K++ +      +
Sbjct: 303 YVSGSYTASVVSGVLDAISAGILIYTGLVELLARDFLF--NPHRTKDMKELSFNVLCTLF 360

Query: 403 GAGLMALLGKWA 414
           GAG+MAL+GKWA
Sbjct: 361 GAGIMALIGKWA 372

>Skud_7.12 Chr7 (25081..26199) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  249 bits (635), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 144/372 (38%), Positives = 210/372 (56%), Gaps = 44/372 (11%)

Query: 47  NDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATGF 106
           N+Y+G    R+ ++F+IL      + FP++S +   +R+P + +  AK+FGSGVI+AT F
Sbjct: 41  NEYNGNLGARISSVFVILFVSTFFTMFPLISKKVKKLRIPLYAYLFAKYFGSGVILATAF 100

Query: 107 IHLLEPAADALG-EECLG--GTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQND 163
           IHL++PA  A+G   C+G  G +  Y W   I L SL   FL++  +  +  + YG  +D
Sbjct: 101 IHLMDPAYGAIGGNTCVGQTGNWGIYSWCPAIMLTSLTFTFLTDLFSSVWVERKYGVSHD 160

Query: 164 HVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPGS 223
           H H                       +++ D       V +  +G   TA+  H S  G 
Sbjct: 161 HTH-----------------------DEIKDTVVNDAAVCSTEHG---TASGSHESKNGV 194

Query: 224 NHFSH-DKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDE 282
            +F   D S  D+            + +Q Q  +  ILEFG+IFHSV IGL L   G +E
Sbjct: 195 EYFEESDASSMDVV-----------QSFQAQFYAFLILEFGVIFHSVMIGLNLGSVG-EE 242

Query: 283 FNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHS 342
           F+TL+ VLVFHQ FEG+G+GAR++ + + +  R+ PW L   + LTTPI +AIG+GVR  
Sbjct: 243 FSTLYPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIGLGVRTR 302

Query: 343 YAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCW 402
           Y  GS TAL+ +G  DAISAGIL+YTGLVEL+A +F++  N      LK++ +      +
Sbjct: 303 YNSGSYTALVVSGILDAISAGILLYTGLVELLARDFIF--NPDRTKNLKELSFNVLCTLF 360

Query: 403 GAGLMALLGKWA 414
           GAG+MAL+GKWA
Sbjct: 361 GAGIMALIGKWA 372

>KLTH0C00374g Chr3 complement(32017..33147) [1131 bp, 376 aa] {ON}
           similar to uniprot|P32804 Saccharomyces cerevisiae
           YGL255W ZRT1 High-affinity zinc transporter of the
           plasma membrane responsible for the majority of zinc
           uptake transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 376

 Score =  243 bits (620), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 136/371 (36%), Positives = 212/371 (57%), Gaps = 37/371 (9%)

Query: 47  NDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATGF 106
           N Y G    R+ ++F+IL      + FP++++R   +++P + +  A++FG+GVIVAT F
Sbjct: 40  NSYSGSLGARISSIFVILFMSTFFTLFPVIAARSKRLKVPKYVYLFARYFGTGVIVATAF 99

Query: 107 IHLLEPAADALG-EECLG--GTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQND 163
           IHLL+PA   +G + C+G  G ++ Y +   I L ++F++F+ +  +  Y  + +G  + 
Sbjct: 100 IHLLDPAYGEIGPQSCVGMSGNWSKYSFCPAIILFTVFSIFIVDLASDVYVKRRFGITHG 159

Query: 164 HVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPGS 223
           H                         N +V  +  +      NN  +I + N      G 
Sbjct: 160 H--------------------GDEIENAIVKRQEAT------NNNVDIESHNL-----GH 188

Query: 224 NHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEF 283
           +  S DKS +    +   +     + +++Q+ +  ILEFG+IFHSV IGL L  T +DEF
Sbjct: 189 SADSDDKSKKSYDVVSNASTEIVTQSFESQIGAFLILEFGVIFHSVMIGLNLGTT-DDEF 247

Query: 284 NTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSY 343
           +TL+ VLVFHQ FEG+G+GAR++ + + K   + P+ L   + LTTPI +AIG+GVR +Y
Sbjct: 248 STLYPVLVFHQSFEGLGIGARLSAIEFPKNKWWWPYALCVAYGLTTPICVAIGLGVRTTY 307

Query: 344 APGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWG 403
              S T  + +G  DAISAGIL+YTGLVEL+A +F++ +N    N + K+L+      WG
Sbjct: 308 DGNSYTVNVVSGVLDAISAGILMYTGLVELLARDFIFDEN--RTNDISKLLFMVNCTLWG 365

Query: 404 AGLMALLGKWA 414
           AGLMALLGKWA
Sbjct: 366 AGLMALLGKWA 376

>ZYRO0F02200g Chr6 (178997..180142) [1146 bp, 381 aa] {ON} similar
           to uniprot|P32804 Saccharomyces cerevisiae YGL255W ZRT1
           High-affinity zinc transporter of the plasma membrane
           responsible for the majority of zinc uptake
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 381

 Score =  232 bits (592), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 132/375 (35%), Positives = 211/375 (56%), Gaps = 42/375 (11%)

Query: 46  DNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATG 105
           +N+Y+G    R+ ++F+IL++    + FP+++ + S++R+  + +  A+ FG+GVI+AT 
Sbjct: 43  ENEYNGNLGARISSIFVILVTSSALTLFPLIAKKVSWLRVHKYVYLFARSFGTGVILATA 102

Query: 106 FIHLLEPAADALGE-ECLG--GTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           FIHL++PA   +G   C+   G ++ Y W   I L +++  FL +     Y  + YG  +
Sbjct: 103 FIHLMDPAYQEIGGFSCVAQVGNWSLYSWCPAIMLTTVYFTFLVDLFGGVYVERKYGIAH 162

Query: 163 DHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPG 222
              H H                       V D+ ++     +N N   +  ++       
Sbjct: 163 SEDHDH--------------AMDAVIAPHVHDDSHL-----HNMNKETVDDSS------- 196

Query: 223 SNHFSHDKSHQDLATIGTPAQMTSKEK---YQNQLLSVFILEFGIIFHSVFIGLALAVTG 279
                   S +D   +   +   + EK   ++++  +  +LEFG++FHSV IGL L  TG
Sbjct: 197 -------LSKKDSVDVSVRSSQDTLEKVISFKSEFSAFLVLEFGVLFHSVMIGLNLGTTG 249

Query: 280 NDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGV 339
            DEF+TL+ VLVFHQ FEG+G+GAR++ + +    R+ P++L   + LTTPIAIAIG+GV
Sbjct: 250 -DEFSTLYPVLVFHQAFEGLGIGARLSAIDFPHNKRWWPYVLCMAYGLTTPIAIAIGLGV 308

Query: 340 RHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFT 399
           R SY   S    + +G  DAISAGIL+YTGLVEL+A +FL+  N +    L+++++  F 
Sbjct: 309 RKSYQSNSYAVNVVSGVLDAISAGILLYTGLVELLARDFLF--NRQRAKTLRELIFNLFC 366

Query: 400 MCWGAGLMALLGKWA 414
           + WG GLMALLGKWA
Sbjct: 367 LSWGVGLMALLGKWA 381

>TDEL0D06550 Chr4 (1177932..1179077) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  226 bits (576), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/374 (35%), Positives = 207/374 (55%), Gaps = 37/374 (9%)

Query: 46  DNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATG 105
           +N+Y+G    R+ ++F+IL+     + +P+++ R  ++++  W +  A+ FG GVI+AT 
Sbjct: 40  ENEYNGWMGARISSIFVILVLSTCCTLYPVVAKRVKWLKINKWFYSFARNFGIGVIIATA 99

Query: 106 FIHLLEPA-ADALGEECLG--GTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           FIHLL+PA A+  G  C+G  G ++ Y W   I L+++F  FL++  +  Y  K YG  +
Sbjct: 100 FIHLLDPAYAEIGGLSCVGMTGNWSIYAWCPAIMLLTIFLTFLTDLFSAVYVEKKYGKTH 159

Query: 163 DHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPG 222
            H                             D + +  T+ +     +    +       
Sbjct: 160 QH-----------------------------DFDEIEQTIVSPAEPVQDFERSQVEEDCD 190

Query: 223 SNHFSH--DKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGN 280
            +H S+  DK   D  T       T+   ++++  +  ILEFG++FHSV IGL L   G 
Sbjct: 191 HDHHSNTKDKKSIDTFTDSDVDSTTADMSFKSEFAAFLILEFGVLFHSVMIGLNLGSVG- 249

Query: 281 DEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVR 340
           +EF+TL+ VLVFHQ FEG+G+GAR++ + + +  R+ P+ L   + LTTPI +AIG+GVR
Sbjct: 250 EEFSTLYPVLVFHQSFEGLGIGARLSAIDFPQNKRWWPYALCLAYGLTTPICVAIGLGVR 309

Query: 341 HSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTM 400
            +Y   S    + +G  DAISAG+LIYTGLVE++A ++L+  N      L+ + +   +M
Sbjct: 310 TTYNGESYVVNVVSGVLDAISAGVLIYTGLVEMLARDYLF--NPHRTKDLRLLSFNVMSM 367

Query: 401 CWGAGLMALLGKWA 414
            WGAGLMALLGKWA
Sbjct: 368 LWGAGLMALLGKWA 381

>Kwal_14.824 s14 complement(65415..66539) [1125 bp, 374 aa] {ON}
           YGL255W (ZRT1) - high-affinity zinc transport protein
           [contig 245] FULL
          Length = 374

 Score =  225 bits (573), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/356 (35%), Positives = 198/356 (55%), Gaps = 47/356 (13%)

Query: 46  DNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATG 105
           +N+Y+G    R+ ++F+I     L + FP++++R   IR+P + +  A++FG+GVIVAT 
Sbjct: 39  ENEYNGSMGARISSIFVIFFVSTLFTLFPVVAARVKSIRIPKYVYLFARYFGTGVIVATA 98

Query: 106 FIHLLEPAADALG-EECLGGT--FADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQN 162
           FIHLL+PA   +G + C+G T  +ADY W   I L+++F +FL +  +  Y  + +G  +
Sbjct: 99  FIHLLDPAYGEIGGDSCVGKTGHWADYSWCPAIVLLTIFIIFLVDLASDVYVKRRFGVAH 158

Query: 163 DHVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPG 222
           +H                           V+++  V                + H  +  
Sbjct: 159 NH-------------------------GDVIEDAVVK------------RQGDAHEDLES 181

Query: 223 SNHFSH----DKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVT 278
            N+  H    DKS +    I   +   + E +++Q  +  ILEFG+IFHSV IGL L   
Sbjct: 182 HNNHMHADSDDKSKKSYDVISDASSEIATESFESQFAAFLILEFGVIFHSVMIGLNLGTV 241

Query: 279 GNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIG 338
           G DEF+ L+ VLVFHQ FEG+G+GAR++ +++ K   + P+ L   + L TPI +AIG+G
Sbjct: 242 G-DEFSVLYPVLVFHQSFEGLGIGARLSSIAFPKGKAWWPYALCITYGLATPICVAIGLG 300

Query: 339 VRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKML 394
           VR SY   S T  I +G  DAISAGILIYTGLVEL+A +F++ +  K  N + +++
Sbjct: 301 VRTSYNGNSFTVNIVSGVLDAISAGILIYTGLVELLARDFIFDE--KRTNDIPRLI 354

>KLTH0A07722g Chr1 (650427..651605) [1179 bp, 392 aa] {ON} similar
           to uniprot|P32804 Saccharomyces cerevisiae YGL255W ZRT1
           High-affinity zinc transporter of the plasma membrane
           responsible for the majority of zinc uptake
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 392

 Score =  222 bits (566), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 134/372 (36%), Positives = 210/372 (56%), Gaps = 44/372 (11%)

Query: 47  NDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATGF 106
           ++Y G  N R+ ++F+IL      +  P++ ++   I++P  C+  A++FG+GVI+AT F
Sbjct: 61  SEYQGSLNARISSIFVILFVSTSFTLLPVIFTKVKGIKVPKACYLFARYFGTGVIIATAF 120

Query: 107 IHLLEPAADALGE-ECLG--GTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQND 163
           IHL+E +  ++G   C+G  G +ADY W  GI L ++F +FL + ++  Y  + +G    
Sbjct: 121 IHLMEHSYMSIGSNSCVGSSGRWADYSWCSGIVLTTVFVVFLVDLLSEVYIERKFGISCS 180

Query: 164 HVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNN-NGAEITATNPHPSMPG 222
           H                               + V   +++NN    E  A    P +  
Sbjct: 181 H------------------------------GDLVEGAISDNNPRLKENDAETGSPVISN 210

Query: 223 SNHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDE 282
            +  S+D         G  +++  K  +++Q+ +  ++EFGIIFHSV IGL L  TG +E
Sbjct: 211 KDDVSYD------VVSGVNSEIAVK-PFESQIGAFLVMEFGIIFHSVMIGLELGTTG-EE 262

Query: 283 FNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHS 342
           F+ L+ V+VFHQ FEG+G+GAR+  +++ +  ++ P+ L   +  TTPIAIAIG+GVR S
Sbjct: 263 FSILYPVIVFHQSFEGLGIGARLISIAFPEGKKWWPYALCILYGATTPIAIAIGLGVRMS 322

Query: 343 YAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCW 402
           Y   S    I +G  DAI+AGILIYTGLVEL+A +F++  N + +N LKK+ +       
Sbjct: 323 YNAHSFKMSIISGVLDAIAAGILIYTGLVELLARDFMFDPN-RTKN-LKKLTFMIICTFS 380

Query: 403 GAGLMALLGKWA 414
           GAGLMALLG+WA
Sbjct: 381 GAGLMALLGRWA 392

>Kwal_23.6522 s23 (1624044..1625213) [1170 bp, 389 aa] {ON} YGL255W
           (ZRT1) - high-affinity zinc transport protein [contig
           18] FULL
          Length = 389

 Score =  220 bits (560), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 136/371 (36%), Positives = 213/371 (57%), Gaps = 44/371 (11%)

Query: 47  NDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATGF 106
           ++Y G    R+ ++F++L      +  PI+ ++   +++P +C+  A++FG+GVIV+T F
Sbjct: 60  SEYQGSLPARISSIFVLLFVSTSFTLLPIVLNKIKGVKVPRYCYLFARYFGTGVIVSTAF 119

Query: 107 IHLLEPAADALGE-ECLG--GTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQND 163
           IHL+E +  ++G   C+G  G +ADY W   I ++++F +FL + ++  Y  + YG    
Sbjct: 120 IHLMEHSYMSIGSNSCVGMTGHWADYTWCSCIVMVTVFVIFLVDLLSDVYIERKYGLTGG 179

Query: 164 HVHSHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPGS 223
           H  S                           EE ++  V  + N  E  +      M  S
Sbjct: 180 HGDS--------------------------IEEAIT-DVHKDENDVECASGE----MTKS 208

Query: 224 NHFSHDKSHQDLATIGTPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEF 283
           +  S D       T+   +  +S + +++Q+ + F+LEFGIIFHSV IGL L  TG+ EF
Sbjct: 209 DDASFD-------TLFCASSGSSIKSFESQIGAFFVLEFGIIFHSVMIGLELGTTGS-EF 260

Query: 284 NTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSY 343
           + L+ V+VFHQ FEG+GLGAR+  + + +  ++ P+ L   + +TTPIA+AIG+GVR +Y
Sbjct: 261 SVLYPVIVFHQSFEGLGLGARLMSIKFPEGKKWWPYALCGLYGITTPIAVAIGLGVRLTY 320

Query: 344 APGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWG 403
              S T  I +G  DAISAGILIYTGLVEL+A +F+++ N + ++  K  L  F T+  G
Sbjct: 321 NAHSFTMSIISGILDAISAGILIYTGLVELLAKDFIFNPN-RTKDMTKLSLMIFATLS-G 378

Query: 404 AGLMALLGKWA 414
           AGLMA LGKWA
Sbjct: 379 AGLMAFLGKWA 389

>ZYRO0D17732g Chr4 complement(1471224..1472423) [1200 bp, 399 aa]
           {ON} similar to uniprot|P32804 Saccharomyces cerevisiae
           YGL255W ZRT1 High-affinity zinc transporter of the
           plasma membrane responsible for the majority of zinc
           uptake transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 399

 Score =  199 bits (506), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 124/378 (32%), Positives = 206/378 (54%), Gaps = 36/378 (9%)

Query: 50  DGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATGFIHL 109
           +G    R+ ++F+I I+    S FP+++ +  ++R+  + +  A+ FG+GVIV+T +IHL
Sbjct: 45  NGVTGARISSIFVIFITSTALSLFPVVAQKVPWLRIHRYVYQFARSFGTGVIVSTSYIHL 104

Query: 110 LEPAADALG-EECLG--GTFADYPWAFGICLMSLFALFLSECVARYYTNKSYGFQNDHVH 166
           ++PA   +G   C+   G ++ Y W   I L ++FA FL +  +  Y  + YG  ++   
Sbjct: 105 MDPAYQEIGGYSCIAQTGNWSIYSWCPAIMLTTVFATFLVDLFSAVYVERKYGVVHEENG 164

Query: 167 SHFPXXXXXXXXXXXXXXXXXXYNQVVDEENVSLTVANNNNGAEITATNPHPSMPGSNHF 226
                                  N +      S     +NN  E+ +  P+   P S   
Sbjct: 165 DEVA-------------------NAITHAAKKSNQSPVDNNQMELESL-PNSGNPYSGVQ 204

Query: 227 SHDKSHQDLATIGTPAQMTSKEKYQNQ----------LLSVFILEFGIIFHSVFIGLALA 276
           + D + + ++T      ++   + +N+          L +  +LE G++FHSV IGL L 
Sbjct: 205 TMDNNDEKISTDTQSYALSESSRSENEQDVERRFRADLGAFMVLEAGLLFHSVMIGLNLG 264

Query: 277 VTGNDEFNTLFIVLVFHQMFEGMGLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIG 336
             G DEF+TL+ VLVFHQ FEG+G+GAR+  +++ +   + P+ L   + LTTPI +AIG
Sbjct: 265 TIG-DEFSTLYAVLVFHQSFEGLGIGARLCAITFPRDKWWWPYALCLAYGLTTPICVAIG 323

Query: 337 IGVRHSYAPGSRTALIANGCFDAISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWA 396
           +GVR SY+  S +  + +G  D+ISAGIL+YTGLVEL+A ++++  N      L+++ + 
Sbjct: 324 LGVRKSYSSNSYSVNVVSGILDSISAGILMYTGLVELLARDYMF--NAHRTKDLRELFFN 381

Query: 397 FFTMCWGAGLMALLGKWA 414
             ++  GAGLMALLGKWA
Sbjct: 382 VASILTGAGLMALLGKWA 399

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,785,960
Number of extensions: 1575277
Number of successful extensions: 5031
Number of sequences better than 10.0: 43
Number of HSP's gapped: 5090
Number of HSP's successfully gapped: 69
Length of query: 414
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 302
Effective length of database: 40,638,807
Effective search space: 12272919714
Effective search space used: 12272919714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)