Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D16368g8.323ON51151119890.0
Ecym_42548.323ON5294059261e-119
TDEL0F044908.323ON5104968131e-102
AGL195C8.323ON5541776422e-76
KLTH0G12298g8.323ON5001756131e-72
Kwal_56.239168.323ON4991766043e-71
SAKL0H15554g8.323ON5361756038e-71
KAFR0B057208.323ON4841685797e-68
ZYRO0F10384g8.323ON5581695794e-67
Suva_2.3068.323ON5411705732e-66
Skud_4.4048.323ON5351705704e-66
Smik_4.3898.323ON5251715695e-66
Kpol_543.638.323ON5851725702e-65
YDR145W (TAF12)8.323ON5391705635e-65
NCAS0B035708.323ON5191685591e-64
TPHA0A015608.323ON5401695349e-61
KNAG0I008908.323ON5081705311e-60
CAGL0E01397g8.323ON5751705291e-59
NDAI0J010208.323ON6381685232e-58
TBLA0A039408.323ON7521655161e-56
TBLA0H012808.323ON4051132812e-26
KLLA0B02090g6.233ON111967761.2
Kwal_47.171404.297ON12350682.8
KLTH0D15554g4.297ON12347665.5
CAGL0G09493g6.100ON140839698.5
NCAS0A113703.407ON110457699.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D16368g
         (511 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} simi...   770   0.0  
Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar t...   361   e-119
TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.3...   317   e-102
AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON} S...   251   2e-76
KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]...   240   1e-72
Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145...   237   3e-71
SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]...   236   8e-71
KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON} Anc_8...   227   7e-68
ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some s...   227   4e-67
Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa...   225   2e-66
Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W ...   224   4e-66
Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W ...   223   5e-66
Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON} (145534...   224   2e-65
YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subun...   221   5e-65
NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.3...   219   1e-64
TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {O...   210   9e-61
KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {O...   209   1e-60
CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {...   208   1e-59
NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {...   206   2e-58
TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.3...   203   1e-56
TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {O...   112   2e-26
KLLA0B02090g Chr2 (183718..187077) [3360 bp, 1119 aa] {ON} some ...    34   1.2  
Kwal_47.17140 s47 complement(269893..270264) [372 bp, 123 aa] {O...    31   2.8  
KLTH0D15554g Chr4 (1284597..1284968) [372 bp, 123 aa] {ON} simil...    30   5.5  
CAGL0G09493g Chr7 complement(902228..906454) [4227 bp, 1408 aa] ...    31   8.5  
NCAS0A11370 Chr1 complement(2251978..2255292) [3315 bp, 1104 aa]...    31   9.0  

>KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} similar
           to uniprot|Q03761 Saccharomyces cerevisiae YDR145W,
          Length = 511

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/511 (77%), Positives = 395/511 (77%)

Query: 1   MSGQAGNVQLQNLTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYS 60
           MSGQAGNVQLQNLTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYS
Sbjct: 1   MSGQAGNVQLQNLTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYS 60

Query: 61  KQRXXXXXXXXXXXXXVNNNATNVKSMDXXXXXXXXXXXXXATASSNNVTNNIKVLLTPQ 120
           KQR             VNNNATNVKSMD             ATASSNNVTNNIKVLLTPQ
Sbjct: 61  KQRQQQAQAQAGAQGAVNNNATNVKSMDQQQQQQQQQQQQQATASSNNVTNNIKVLLTPQ 120

Query: 121 QREAYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMK 180
           QREAYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMK
Sbjct: 121 QREAYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMK 180

Query: 181 IRALSAQYSTLQQKYQEDRRKFYIECSQTNADLRRYLXXXXXXXXXXXSQGTVAANAGTP 240
           IRALSAQYSTLQQKYQEDRRKFYIECSQTNADLRRYL           SQGTVAANAGTP
Sbjct: 181 IRALSAQYSTLQQKYQEDRRKFYIECSQTNADLRRYLQAQQQKANAAKSQGTVAANAGTP 240

Query: 241 GPQAGVSXXXXXXXXXXXXSLNKASSGSPPNAMAQRQNIPIQKXXXXXXXXXXXXXXXXX 300
           GPQAGVS            SLNKASSGSPPNAMAQRQNIPIQK                 
Sbjct: 241 GPQAGVSTPGTNTGTPIPTSLNKASSGSPPNAMAQRQNIPIQKTAATTATATNANPSSAA 300

Query: 301 XXXXXXXXDKSSPMXXXXXXXXXXXXXXXXXRPPIFKQPNPSIPISENVTASPTVSVSYR 360
                   DKSSPM                 RPPIFKQPNPSIPISENVTASPTVSVSYR
Sbjct: 301 AAPNNTASDKSSPMQVTTVNAAANQTAQSNTRPPIFKQPNPSIPISENVTASPTVSVSYR 360

Query: 361 SNRPTITGGSGMNAPALTTPVMTKLPPYEVDTERVMSKRKLRELVKTVXXXXXXXXXXXX 420
           SNRPTITGGSGMNAPALTTPVMTKLPPYEVDTERVMSKRKLRELVKTV            
Sbjct: 361 SNRPTITGGSGMNAPALTTPVMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETTID 420

Query: 421 XXXXXXXXXXXXXFITNVTNFACKLAKHRKSDSLDVRDIQMHLERNWNIRIPGFANDEIR 480
                        FITNVTNFACKLAKHRKSDSLDVRDIQMHLERNWNIRIPGFANDEIR
Sbjct: 421 GDVEELLLDLADDFITNVTNFACKLAKHRKSDSLDVRDIQMHLERNWNIRIPGFANDEIR 480

Query: 481 STKKWNPTPSYNQMVNAINNNKTARTHPEKK 511
           STKKWNPTPSYNQMVNAINNNKTARTHPEKK
Sbjct: 481 STKKWNPTPSYNQMVNAINNNKTARTHPEKK 511

>Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar to
           Ashbya gossypii AGL195C
          Length = 529

 Score =  361 bits (926), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 193/405 (47%), Positives = 241/405 (59%), Gaps = 30/405 (7%)

Query: 106 SNNVTNNIKVLLTPQQREAYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSL 165
           +++V +NIK+LL PQQREAY RL Q + +  +NIKGE+ FLK+NI VLD EI+NR+   +
Sbjct: 126 ASSVASNIKMLLNPQQREAYERLTQTFNESAKNIKGEYEFLKKNIEVLDTEIKNRQSEPI 185

Query: 166 SVQQLEVNRNELLMKIRALSAQYSTLQQKYQEDRRKFYIECSQTNADLRRYLXXXXXXXX 225
           +V+QLE  +NELLMK+ +L+ Q+ TL +K+QED++KFYIEC+ TN +L+++L        
Sbjct: 186 TVRQLESKKNELLMKLTSLNTQFQTLPKKFQEDKKKFYIECAATNMNLKKFLQATSQQQR 245

Query: 226 XXXSQ-GTVAANAGT-PGPQAGVSXXXXXXXXXXXXSLNKASSGSPPNAMAQRQNIPIQK 283
                 GT ++ A T P    G              + N A+         QR N  I +
Sbjct: 246 ANTGNTGTTSSPAPTQPSGSVGTPNSAVPVSTNSVNTGNTATPQQSKQQPQQRSNSGISR 305

Query: 284 XXXXXXXXXXXXXXXXXXXXXXXXXDKSSPMXXXXXXXXXXXXXXXXXRPPIFKQPNPSI 343
                                       SP                  RP IFKQPNPSI
Sbjct: 306 ----------------------------SPTQVTPVNAAANQNSNGAARPVIFKQPNPSI 337

Query: 344 PISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTERVMSKRKLRE 403
           PI E+V+   T SVSYRSNRPTITGGS MNA ALTTPVMTKLPPYEVD+ERVMSKRKLRE
Sbjct: 338 PIPESVSPISTTSVSYRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDSERVMSKRKLRE 397

Query: 404 LVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKSDSLDVRDIQMHL 463
           LVK+V                         FITNVT+FAC+LAKHRKSD+LDVRDIQ+HL
Sbjct: 398 LVKSVGIDDGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNLDVRDIQLHL 457

Query: 464 ERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKTARTHP 508
           ERNWNIR PG++ DEIRSTKKWN TP+Y Q +  I + K A+  P
Sbjct: 458 ERNWNIRTPGYSADEIRSTKKWNSTPAYGQKMQVITSAKAAKLSP 502

 Score = 73.2 bits (178), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (78%)

Query: 3  GQAGNVQLQNLTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAY 59
          GQ GN Q+  LTP S+QQLA +  +LV+EA+R+GV T EG ELL++A+++KA+YE Y
Sbjct: 5  GQQGNGQVPQLTPPSLQQLAYKFTTLVDEAQRVGVQTPEGLELLKKASKVKAIYETY 61

>TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.323
           YDR145W
          Length = 510

 Score =  317 bits (813), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/496 (37%), Positives = 266/496 (53%), Gaps = 44/496 (8%)

Query: 20  QLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRXXXXXXXXXXXXX--- 76
           +L  + ++LVNEAK +G +T  GKELL +A++IKA+Y+ Y++QR                
Sbjct: 29  ELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNRQRQQAAQAFVQGRNGGTP 88

Query: 77  ----VNNNATNVKSMDXXXXXXXXXXXXXATASSNNVTNNIKVLLTPQQREAYNRLVQKY 132
                ++ +T                   + +S + + N IK +LTP+Q + +  L Q +
Sbjct: 89  GANPASSGSTGSVGAVNAAGSSSSGSSQQSRSSGSQLANIIKQVLTPEQNQQFEALSQNF 148

Query: 133 EDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYSTLQ 192
           +    +I+ +  FLK++I  L+QE+ +++ ++ + +QLE  + EL   ++ L+ +Y  LQ
Sbjct: 149 QARANSIRDKHTFLKQHIERLNQEV-SKQTDASAKKQLEEKKTELANNLKMLNMEYGALQ 207

Query: 193 QKYQEDRRKFYIECSQTNADLRRYLXXXXXXXXXXX------SQGTVAANAGTPGPQAGV 246
           Q++Q  ++KFY+EC++ N  L+R L                 S+G+ A  AG+PG  AG 
Sbjct: 208 QEFQNGKKKFYVECARHNPALQRLLQRSTQQQRMAQQQQVQPSEGSPAGEAGSPGA-AGN 266

Query: 247 SXXXXXXXXXXXXSLNKASSGSPPNAMAQRQNIPIQKXXXXXXXXXXXXXXXXXXXXXXX 306
           S               KA  G+P N   Q+  +P Q                        
Sbjct: 267 SA--------------KAQQGTPANITTQK--LPQQNQVRSQSTSSNTGS---------- 300

Query: 307 XXDKSSPMXXXXXXXXXXXXXXXXXRPPIFKQPNPSIPISENVTASPTVSVSYRSNRPTI 366
              ++                    +  IFKQ +P +PISE VTA     V+Y++NRPT+
Sbjct: 301 ---RAQSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTL 357

Query: 367 TGGSGMNAPALTTPVMTKLPPYEVDTERVMSKRKLRELVKTVXXXXXXXXXXXXXXXXXX 426
           TGG+ MNA AL TP MTKLPPYEVDTERVMSKRKLRELVKTV                  
Sbjct: 358 TGGTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESL 417

Query: 427 XXXXXXXFITNVTNFACKLAKHRKSDSLDVRDIQMHLERNWNIRIPGFANDEIRSTKKWN 486
                  F++NVT FAC+LAKHRKSD+LD RDIQ+HLERNWNIRIPG++ DEIRST+KWN
Sbjct: 418 LLDLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWN 477

Query: 487 PTPSYNQMVNAINNNK 502
           P PSYNQ + AIN++K
Sbjct: 478 PKPSYNQKMQAINSDK 493

>AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR145W
           (TAF12)
          Length = 554

 Score =  251 bits (642), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 120/177 (67%), Positives = 134/177 (75%)

Query: 332 RPPIFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVD 391
           RP IFKQPNPSIPI EN+T   T SVSYRSNRPTIT GS MNA ALT PVMTKLPPYEVD
Sbjct: 355 RPVIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVD 414

Query: 392 TERVMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKS 451
           +ERVMSKRKLRELVKTV                         FITNVT+FAC+LAKHRKS
Sbjct: 415 SERVMSKRKLRELVKTVGIDDGDGETTVDGDVEELLLDLADDFITNVTSFACRLAKHRKS 474

Query: 452 DSLDVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKTARTHP 508
           D+LDVRDIQ+HLERNWNIRIPG+A DEIRSTKKWNPTP+Y+Q +  I++ + A+  P
Sbjct: 475 DNLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISSARAAKLAP 531

 Score =  184 bits (466), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 140/214 (65%), Gaps = 13/214 (6%)

Query: 4   QAGNVQLQNLTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQR 63
           Q GN Q+  LTP+SM+QLA + ++LV+EA+++GV T EG ELL++A+ IKA+YE Y +Q+
Sbjct: 66  QQGNGQVPQLTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYHRQQ 125

Query: 64  XXXXXXXXXXXXXVNNNATNVKSMDXXXXXXXXXXXXXATASSNNVTNNIKVLLTPQQRE 123
                        V N A                    A   +++V +NIK+LLTPQQRE
Sbjct: 126 AQQAFQ-------VRNPA------PAGQLAAAGTGQATAPRPTSSVASNIKMLLTPQQRE 172

Query: 124 AYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRA 183
           AY +L Q + +  +NI GE+ FLK+NI VLD EI+NR+G  ++V+QLE  +NELL K+  
Sbjct: 173 AYEKLTQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVKQLETKKNELLTKLTG 232

Query: 184 LSAQYSTLQQKYQEDRRKFYIECSQTNADLRRYL 217
           L+ Q+  L +K+QED++KFYIEC+ TN +L+++L
Sbjct: 233 LNTQFQALPKKFQEDKKKFYIECAATNVNLKKFL 266

>KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]
           {ON} similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145W
          Length = 500

 Score =  240 bits (613), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 129/175 (73%)

Query: 332 RPPIFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVD 391
           R  IFKQPNPS+P+SE +T      V +RSNRPTITGGS MNA ALTTPVMTKLPPYEVD
Sbjct: 302 RQAIFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVD 361

Query: 392 TERVMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKS 451
            ERVMSKRKLRELVK+V                         FITNVT+FAC+LAKHRKS
Sbjct: 362 NERVMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKS 421

Query: 452 DSLDVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKTART 506
           D+LDVRDIQ+HLERNWNIRIPG+A DE+RST+KWNPT SYNQ +  IN+ K  +T
Sbjct: 422 DNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGINSAKVTKT 476

 Score =  180 bits (456), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 137/219 (62%), Gaps = 13/219 (5%)

Query: 3   GQAGNVQ----LQNLTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEA 58
            Q+GN Q     Q LTP S+QQ+A +     NEAKR+G+ T +G+ELL+QA+RIKA+Y+A
Sbjct: 11  AQSGNNQQGTPAQRLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDA 70

Query: 59  YSKQRXXXXXXXXXXXXXVNNNATNVKSMDXXXXXXXXXXXXXATASSNNVTNNIKVLLT 118
           Y +QR              N       + D              T + NN+++NI+ LLT
Sbjct: 71  Y-RQRQQSAQGFEQGGATSN-------TGDNTAGTPTNARSPNGTPN-NNMSSNIQNLLT 121

Query: 119 PQQREAYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELL 178
           PQQ EAY RL+Q   ++G+ IKGE+ +LK+ I +LD EI+ R+G+  +V+QLE N+ E+L
Sbjct: 122 PQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEIL 181

Query: 179 MKIRALSAQYSTLQQKYQEDRRKFYIECSQTNADLRRYL 217
            K+R  SA Y  L QK +ED++KFYIEC+ TN +L+R+L
Sbjct: 182 NKLRGFSASYLALNQKLREDKKKFYIECAATNPNLKRFL 220

>Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145W
           (TAF12) - TFIID subunit [contig 171] FULL
          Length = 499

 Score =  237 bits (604), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 133/176 (75%), Gaps = 2/176 (1%)

Query: 332 RPPIFKQPNPSIPISENVTAS-PTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEV 390
           R  IFKQPNPS+P+SE +T   PT+ V+ RSNRPTITGGS MNA ALTTPVMTKLPPYEV
Sbjct: 302 RRAIFKQPNPSVPVSETITQKMPTLMVN-RSNRPTITGGSAMNAAALTTPVMTKLPPYEV 360

Query: 391 DTERVMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRK 450
           D ERVMSKRKLRELVK+V                         FITNVT+FAC+LAKHRK
Sbjct: 361 DNERVMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRK 420

Query: 451 SDSLDVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKTART 506
           SD+LDVRDIQ+HLERNWNIRIPG+A DE+RST+KWNPT SYNQ +  IN+ + ++T
Sbjct: 421 SDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSARVSKT 476

 Score =  177 bits (448), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 130/207 (62%), Gaps = 9/207 (4%)

Query: 11  QNLTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRXXXXXXX 70
           Q  TP SMQQ+A +     NEAKRIG+ T +G+ELL+QA+ IKA+Y+AY +QR       
Sbjct: 23  QRFTPESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAY-RQRQQAAQG- 80

Query: 71  XXXXXXVNNNATNVKSMDXXXXXXXXXXXXXATASSNNVTNNIKVLLTPQQREAYNRLVQ 130
                  + NA    S                TA+ N +++NI+ LLTPQQ EAY RL+Q
Sbjct: 81  ------FDQNAPGASSAGSTSGSPATARAPNGTAT-NTISSNIQNLLTPQQNEAYGRLIQ 133

Query: 131 KYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYST 190
              ++G+ IKGE+ +LKR I +LD EI+ R G+  +V+QLE N+ E+L K++  SA Y  
Sbjct: 134 SSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASYVA 193

Query: 191 LQQKYQEDRRKFYIECSQTNADLRRYL 217
           L QK +ED++KFYIEC+ TN +L+R+L
Sbjct: 194 LNQKLREDKKKFYIECAATNPNLKRFL 220

>SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]
           {ON} some similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 536

 Score =  236 bits (603), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 128/175 (73%)

Query: 332 RPPIFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVD 391
           R  IFKQPNPS+P+SENVT     +V+YRSNRPTITGGS MNA AL TPVMTKLPPYEVD
Sbjct: 325 RQAIFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPPYEVD 384

Query: 392 TERVMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKS 451
           +ERVMSKRKLRELVK+V                         FI+NVT FAC+LAKHRKS
Sbjct: 385 SERVMSKRKLRELVKSVGVDEGDGETTIDGDVEELLLDLADDFISNVTGFACRLAKHRKS 444

Query: 452 DSLDVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKTART 506
           D+LDVRDIQ+HLERNWNIRIPG++ DEIRST+KWN T +Y Q +  IN  K  +T
Sbjct: 445 DNLDVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGINAAKAVKT 499

 Score =  169 bits (429), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 132/208 (63%), Gaps = 5/208 (2%)

Query: 10  LQNLTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRXXXXXX 69
           LQ +T AS+QQLA R  +L  EA RIGV+T EG+ELL+QAA+IKA+Y+AY+KQ+      
Sbjct: 22  LQQVTSASIQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNKQKQQAAQA 81

Query: 70  XXXXXXXVNNNATNVKSMDXXXXXXXXXXXXXATASSNNVTNNIKVLLTPQQREAYNRLV 129
                    NN     +                + S+NN ++NI+ LLTP+Q EAYN+L 
Sbjct: 82  FGQ-----TNNRPPAPAAGNPPQVAQNTQQRQNSNSANNPSSNIRTLLTPEQSEAYNKLT 136

Query: 130 QKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYS 189
           + + D  +NI+GE  +L++NI VLD EI+NR    L+V++LE  + EL+ K+R L A + 
Sbjct: 137 KTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASFQ 196

Query: 190 TLQQKYQEDRRKFYIECSQTNADLRRYL 217
            L QK+ E ++KFYIEC+ +N +L+R+L
Sbjct: 197 ALPQKFHEAKKKFYIECAASNPNLKRFL 224

>KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON}
           Anc_8.323 YDR145W
          Length = 484

 Score =  227 bits (579), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 127/168 (75%)

Query: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394
           IFKQ +P++PISE++++   + V YR NRPTI+GGS MNA AL TP+MTKLPPYE+DTER
Sbjct: 298 IFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELDTER 357

Query: 395 VMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKSDSL 454
           VMSKRKLRELVKT+                         F+TNVT+FACKLAKHRKSD+L
Sbjct: 358 VMSKRKLRELVKTIGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACKLAKHRKSDNL 417

Query: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNK 502
           + +DIQ+HLERNWNIRIPG++ DEIRST+KWNPT SYNQ + +IN +K
Sbjct: 418 ETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSINIDK 465

 Score =  124 bits (311), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 114/200 (57%), Gaps = 5/200 (2%)

Query: 18  MQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRXXXXXXXXXXXXXV 77
           + +L+ R KSLV EAK++G  T EGKEL+ QA+++KALY+ Y+KQ+              
Sbjct: 28  LMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNKQKQEAMAQAQARNNNA 87

Query: 78  NNNATNVKSMDXXXXXXXXXXXXXATASSNNVTNNIKVLLTPQQREAYNRLVQKYEDDGQ 137
           N    N  S                + SS      I+  LTP+Q + Y++LVQ ++    
Sbjct: 88  NTANVNSSSSANSTEANTSGR----SGSSAQFATLIRQALTPEQNQQYDKLVQNFQTRAN 143

Query: 138 NIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYSTLQQKYQE 197
           NIK +  FLK+NI  L QEI  ++ ++ + +QL+  R EL+  ++A+S +Y+ LQQ+Y  
Sbjct: 144 NIKDKHTFLKQNIDRLVQEIE-KQTDAAAKKQLDEKRIELMTNLKAISVEYTNLQQQYNN 202

Query: 198 DRRKFYIECSQTNADLRRYL 217
            ++ FYIEC++ N DL+R L
Sbjct: 203 GKKAFYIECAKKNPDLQRLL 222

>ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 558

 Score =  227 bits (579), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 106/169 (62%), Positives = 124/169 (73%)

Query: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394
           IFKQ +P +PISENVT      V+Y+SNRPT+TGG+ MNA  L TP +TKLPPYEVDTER
Sbjct: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428

Query: 395 VMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKSDSL 454
           VMSKRKLRELVKTV                         F+TNVT FAC+LAKHRKSD+L
Sbjct: 429 VMSKRKLRELVKTVGIDDGDGETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKSDNL 488

Query: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKT 503
           D RDIQ+HLERNWNIRIPG++ DEIRST+KWNP+ SYNQ + +IN +KT
Sbjct: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKT 537

 Score =  100 bits (250), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 64/209 (30%), Positives = 114/209 (54%), Gaps = 10/209 (4%)

Query: 18  MQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRXXXXXXXXXXXXXV 77
           + +L  + + LV E+K +G +T+ GKELL QA++IKA+Y  YS+QR              
Sbjct: 39  LLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSRQRQQAAQAYEQARNGA 98

Query: 78  NNNATNVKSMDXXXXX---------XXXXXXXXATASSNNVTNNIKVLLTPQQREAYNRL 128
               +  +S                        +T   + + N IK +LTP+Q + Y+ L
Sbjct: 99  AAGGSTPQSAGSGVSTVPAGSQSTGGSSSSGGQSTGGGSQLANIIKQVLTPEQNQQYDNL 158

Query: 129 VQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQY 188
           +Q ++    NI+ + NFL++++  L+QEI N++    + +QLE  + ELL  +++L+ +Y
Sbjct: 159 LQTFQTRTNNIRDKHNFLEQHLEGLNQEI-NKKTEPAAKKQLEDKKMELLTNLKSLNMEY 217

Query: 189 STLQQKYQEDRRKFYIECSQTNADLRRYL 217
           S L+Q++   ++KFY+EC++ N  L+R L
Sbjct: 218 SVLRQEFTNGKKKFYVECARHNPALQRLL 246

>Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa]
           {ON} YDR145W (REAL)
          Length = 541

 Score =  225 bits (573), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 107/170 (62%), Positives = 124/170 (72%)

Query: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394
           IFKQ  P+IPISEN++      V YRSNRPTITGGS MNA AL TPV TKLPPYE+DT+R
Sbjct: 356 IFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQR 415

Query: 395 VMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKSDSL 454
           VMSKRKLRELVKTV                         F+TNVT FAC+LAKHRKSD+L
Sbjct: 416 VMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFACRLAKHRKSDNL 475

Query: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKTA 504
           + RDIQ+HLERNWNIRIPG++ DEIRST+KWNP+ SYNQ +  IN++K A
Sbjct: 476 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVA 525

 Score =  102 bits (253), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 117/205 (57%), Gaps = 8/205 (3%)

Query: 18  MQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRXXXXXXXXXXXXXV 77
           + ++  + K+LV+EA+ +G  T  GKEL+ QAA+IK++Y+A++++R             V
Sbjct: 38  LLEMTVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNRRR--QQAAQAYKNASV 95

Query: 78  NN---NATNVKSM--DXXXXXXXXXXXXXATASSNNVTNNIKVLLTPQQREAYNRLVQKY 132
            N   NA N  S+  +             A ++SN  +N IK +LT ++ + Y +L Q +
Sbjct: 96  GNTTPNAGNPVSLPTEKPPSLSQQQQQQQARSNSNKFSNMIKQVLTSEENQQYEKLWQNF 155

Query: 133 EDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYSTLQ 192
           +    ++K +  FLK+NI  L QE+ N++ +  + +QLE  +NELL   + L  +Y+ L 
Sbjct: 156 QVRATSMKEKDTFLKQNIDRLVQEV-NKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLL 214

Query: 193 QKYQEDRRKFYIECSQTNADLRRYL 217
           + +Q  ++ FY+EC++ N  L+++L
Sbjct: 215 KGFQNSKKTFYVECARHNPALQKFL 239

>Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W
           (REAL)
          Length = 535

 Score =  224 bits (570), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 105/170 (61%), Positives = 124/170 (72%)

Query: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394
           IFKQ  P+IPISEN++      V+YRSNRPT+TGGS MNA AL TPV TKLPPYE+DT+R
Sbjct: 350 IFKQTEPAIPISENISTKAPAPVAYRSNRPTVTGGSAMNASALNTPVTTKLPPYEMDTQR 409

Query: 395 VMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKSDSL 454
           VMSKRKLRELVKTV                         F+TNVT FAC+LAKHRKSD+L
Sbjct: 410 VMSKRKLRELVKTVGIDEGDGETVIDGDVEDLLLDLADDFVTNVTAFACRLAKHRKSDNL 469

Query: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKTA 504
           + RDIQ+HLERNWNIRIPG++ DEIRST+KWNP+ SYNQ +  I ++K A
Sbjct: 470 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNITSDKVA 519

 Score =  108 bits (271), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/217 (31%), Positives = 117/217 (53%), Gaps = 11/217 (5%)

Query: 11  QNLT--PASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYS---KQRXX 65
           QNLT  P  +Q++  + ++L+ EA+ +G  T  GKEL+ QAA+IK +Y+A +   +++  
Sbjct: 29  QNLTLQPRQLQEMTAKFRALLIEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRRQQA 88

Query: 66  XXXXXXXXXXXVNNNATNVKSMDXXXX-----XXXXXXXXXATASSNNVTNNIKVLLTPQ 120
                       N N +N+ S+                   A  +SN  +N IK +LTP+
Sbjct: 89  AQAYKNASMGNANPNPSNLASLPTDKAPNPSQQQQQQQQQQARNNSNKFSNMIKQVLTPE 148

Query: 121 QREAYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMK 180
           + + Y +L Q ++    +IK    FLK+N+  L+QEI N++ +  + QQLE  +NELL  
Sbjct: 149 ENQEYEKLWQNFQVRHTSIKEREAFLKQNVDRLEQEI-NKQTDEGTKQQLEEKKNELLND 207

Query: 181 IRALSAQYSTLQQKYQEDRRKFYIECSQTNADLRRYL 217
            + L  +Y+ L   YQ  ++ FY+EC++ N  L ++L
Sbjct: 208 WKVLKIEYTKLFNSYQNSKKTFYVECARHNPALHKFL 244

>Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W
           (REAL)
          Length = 525

 Score =  223 bits (569), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 125/171 (73%)

Query: 332 RPPIFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVD 391
           +  IFKQ  P+IPISEN++A     V+YRSNRPTITGGS MNA AL TP  TKLPPYE+D
Sbjct: 337 KSAIFKQTEPAIPISENISAKAPAPVAYRSNRPTITGGSAMNASALNTPAATKLPPYEMD 396

Query: 392 TERVMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKS 451
           T+RVMSKRKLRELVKTV                         F+TNVT F+C+LAKHR+S
Sbjct: 397 TQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRRS 456

Query: 452 DSLDVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNK 502
           D+L+ RDIQ+HLERNWNIRIPG++ DEIRST+KWNP+ SYNQ + +I ++K
Sbjct: 457 DNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQSITSDK 507

 Score =  104 bits (260), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 112/214 (52%), Gaps = 10/214 (4%)

Query: 13  LTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYS---KQRXXXXXX 69
           L P  +Q++  +  +L+ EA+ +G  T  GKEL+ QAA+IK +Y+A +   +++      
Sbjct: 33  LQPRQLQEMTAKFTALLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRRQQAAQAY 92

Query: 70  XXXXXXXVNNNATNVKSMDXXXXXXXXXXXXXATA------SSNNVTNNIKVLLTPQQRE 123
                   N+N+ N  +M                       +SN  ++ IK +LTP++ +
Sbjct: 93  RNASMGNTNSNSNNPVTMSTEKTSNSSQQHQQQHQQQQTRNNSNKFSSMIKQVLTPEENQ 152

Query: 124 AYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRA 183
            Y +L Q ++    +IK +  FLK+NI  L+QEI N++    + QQL+  +NELL   + 
Sbjct: 153 EYEKLWQNFQARHTSIKEKETFLKQNIDRLEQEI-NKQTEEGAKQQLQEKKNELLNDWKV 211

Query: 184 LSAQYSTLQQKYQEDRRKFYIECSQTNADLRRYL 217
           L  +Y+ L   YQ  ++ FY+EC++ N  L ++L
Sbjct: 212 LKIEYTKLFNSYQNSKKTFYVECARHNPALHKFL 245

>Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON}
           (145534..147291) [1758 nt, 586 aa]
          Length = 585

 Score =  224 bits (570), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 101/172 (58%), Positives = 126/172 (73%)

Query: 332 RPPIFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVD 391
           +  IFKQ +PS+PISE++T     +VSY SNRP++TGG+ MNA  L TP +TKLPPYE+D
Sbjct: 394 KSAIFKQSDPSVPISESITVKAPEAVSYISNRPSLTGGTAMNASVLNTPTITKLPPYEID 453

Query: 392 TERVMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKS 451
           TERVMSKRKLREL+K+V                         F+TNVT+FAC+LAKHRKS
Sbjct: 454 TERVMSKRKLRELIKSVGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRKS 513

Query: 452 DSLDVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKT 503
           DSL+ RDIQ+HLERNWNIRIPG++ DEIRST+KW PT SY+Q + +INN K+
Sbjct: 514 DSLEARDIQLHLERNWNIRIPGYSGDEIRSTRKWIPTQSYSQKMQSINNEKS 565

 Score =  111 bits (278), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 113/207 (54%), Gaps = 14/207 (6%)

Query: 24  RLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRXX--------XXXXXXXXXX 75
           + K LVNEAKR+G +T+ GKELL QA+ +KA+Y+ Y+KQR                    
Sbjct: 33  KFKELVNEAKRVGQNTQRGKELLIQASNLKAVYDNYNKQRQALINQQQQQQAGSSQTPAG 92

Query: 76  XVNNNATNVKSMDXXXXXXXXXXXXXATASSN-----NVTNNIKVLLTPQQREAYNRLVQ 130
             NN      S                TA +N      + + IK +LTP++ + Y++L+Q
Sbjct: 93  TTNNADAASSSSAPAAAGASGANGTRKTAVANASGGSQLADLIKQVLTPEENQQYDKLLQ 152

Query: 131 KYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYST 190
            ++    +IK +  FLK++I  L QEI N++ +  + +QLEVNR ELL  +R L+ +YS 
Sbjct: 153 NFQSRASSIKDQHTFLKQHIDRLSQEI-NQQTDEAAKKQLEVNRAELLTNLRTLNTEYSN 211

Query: 191 LQQKYQEDRRKFYIECSQTNADLRRYL 217
           L +  +  ++ FY+EC++ N +L+R L
Sbjct: 212 LYEDIKNKKKAFYVECARQNPELQRLL 238

>YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subunit
           (61/68 kDa) of TFIID and SAGA complexes, involved in RNA
           polymerase II transcription initiation and in chromatin
           modification, similar to histone H2A
          Length = 539

 Score =  221 bits (563), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 103/170 (60%), Positives = 124/170 (72%)

Query: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394
           IFKQ  P+IPISEN++      V+YRSNRPTITGGS MNA AL TP  TKLPPYE+DT+R
Sbjct: 354 IFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSAMNASALNTPATTKLPPYEMDTQR 413

Query: 395 VMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKSDSL 454
           VMSKRKLRELVKTV                         F+TNVT F+C+LAKHRKSD+L
Sbjct: 414 VMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRKSDNL 473

Query: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKTA 504
           + RDIQ+HLERNWNIRIPG++ DEIRST+KWNP+ +YNQ + +I ++K A
Sbjct: 474 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQSITSDKVA 523

 Score = 99.4 bits (246), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 120/220 (54%), Gaps = 7/220 (3%)

Query: 1   MSGQAGNVQLQNLTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYS 60
           ++G   N+ LQ   P  +Q++A + ++L+ EA+ +G  T  GKEL+ QAA+IK +Y+A +
Sbjct: 24  ITGAQQNMVLQ---PRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALT 80

Query: 61  --KQRXXXXXXXXXXXXXVNNNATNVKSMDXXXXXXXXXXXXXATA-SSNNVTNNIKVLL 117
             ++R              ++N  ++ + +              T  +SN  +N IK +L
Sbjct: 81  LNRRRQQAAQAYNNTSNSNSSNPASIPTENVPNSSQQQQQQQQQTRNNSNKFSNMIKQVL 140

Query: 118 TPQQREAYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNEL 177
           TP++ + Y +L Q ++    +IK +  +LK+NI  L+QEI N++ +    QQL+  + EL
Sbjct: 141 TPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEI-NKQTDEGPKQQLQEKKIEL 199

Query: 178 LMKIRALSAQYSTLQQKYQEDRRKFYIECSQTNADLRRYL 217
           L   + L  +Y+ L   YQ  ++ FY+EC++ N  L ++L
Sbjct: 200 LNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPALHKFL 239

>NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.323
           YDR145W
          Length = 519

 Score =  219 bits (559), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 99/168 (58%), Positives = 124/168 (73%)

Query: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394
           IFKQ +P +P+S+ ++    ++V YRSNRPT+TGGS M+A AL TPVMTKLPPYE+DTER
Sbjct: 335 IFKQSDPMVPVSDTISTKQPIAVPYRSNRPTMTGGSAMSASALNTPVMTKLPPYELDTER 394

Query: 395 VMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKSDSL 454
           VMSKRKLRELVK++                         FITNVT+FAC+LAKHRKSD+L
Sbjct: 395 VMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDMADDFITNVTSFACRLAKHRKSDNL 454

Query: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNK 502
           + RDIQ+HLERNW+IRIPG++ DEIRS +KWNP  +YNQ +  INN+K
Sbjct: 455 EARDIQLHLERNWDIRIPGYSADEIRSIRKWNPAQTYNQKLQQINNDK 502

 Score =  116 bits (291), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 124/220 (56%), Gaps = 9/220 (4%)

Query: 3   GQAGNVQLQNLTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQ 62
           GQ  N+ LQ   P  +++L  + K+LVNEAK +G +T+ GKELL QA+++KA+Y+ Y++Q
Sbjct: 14  GQPRNIILQ---PNQIRELTAKFKALVNEAKEVGENTQRGKELLIQASKLKAMYDNYNRQ 70

Query: 63  RXXXXXXXXXXXXXV-----NNNATNVKSMDXXXXXXXXXXXXXATASSNNVTNNIKVLL 117
           R             V     N+N T   S               + +SS  + N ++ +L
Sbjct: 71  RQQQLQQQQAVNNKVQNPSNNDNVTTNNSF-ASPSSPPTSGSTISNSSSTQLANIMRQVL 129

Query: 118 TPQQREAYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNEL 177
           T +Q   +++L Q +      +K +  FLK+NI  L QEI  +  N  + +QLE  R EL
Sbjct: 130 TDEQNANFDKLDQTFRSRASALKDKHTFLKQNIERLTQEINKQADNVNARKQLEEKRGEL 189

Query: 178 LMKIRALSAQYSTLQQKYQEDRRKFYIECSQTNADLRRYL 217
           L  ++A++ +++TL QKYQ  ++ FYIEC++TN DL++ L
Sbjct: 190 LRNLKAITMEHNTLYQKYQNGKKAFYIECAKTNPDLQKLL 229

>TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {ON}
           Anc_8.323 YDR145W
          Length = 540

 Score =  210 bits (534), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 94/169 (55%), Positives = 125/169 (73%)

Query: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394
           IFKQ +P++PIS+NVT  PT  + Y+SNRP++TGG+ M+A AL  P +T LPPYE+DTER
Sbjct: 354 IFKQSDPTVPISDNVTLEPTELIPYKSNRPSLTGGAAMSAAALNVPPLTTLPPYEIDTER 413

Query: 395 VMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKSDSL 454
           VM+KRKLREL+K V                         F+TNVT+FAC+LAKHRKS++L
Sbjct: 414 VMAKRKLRELIKNVGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRKSENL 473

Query: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKT 503
           + RDIQ+HLERNWNIRIPG++ DEIRST+KW PT +++Q + +INN+K+
Sbjct: 474 ESRDIQLHLERNWNIRIPGYSGDEIRSTRKWLPTQAFSQKLQSINNDKS 522

 Score = 97.8 bits (242), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 121/247 (48%), Gaps = 41/247 (16%)

Query: 12  NLTPASMQQ------------LADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAY 59
           N TPAS  Q            L ++ K LVNEAK +G +T  GKELL QA+++KA+YE +
Sbjct: 12  NATPASSAQAKLALQQKQLIELTNKFKQLVNEAKAVGENTPRGKELLIQASKLKAIYENF 71

Query: 60  SKQRXXXXXXXXXXXXXV----------------NNNATNVKSMDXXXXXX--------- 94
           +KQR                              N NA+NV + +               
Sbjct: 72  TKQRQAQIQQLQQQQLQQQQLQQQQQQTQNAIRPNTNASNVSNANIVNQSTPVGATPVST 131

Query: 95  --XXXXXXXATASSNNVTNNIKVLLTPQQREAYNRLVQKYEDDGQNIKGEFNFLKRNISV 152
                    ++ SS  + N IK +LT +Q + Y+ LV+ +     +IK +  FLK+NI  
Sbjct: 132 TSSTPNTNTSSNSSTQIANIIKQILTAEQNQQYDNLVKNFLAKRTSIKDKHAFLKQNIDK 191

Query: 153 LDQEIRNRRGNSLSVQQ--LEVNRNELLMKIRALSAQYSTLQQKYQEDRRKFYIECSQTN 210
           L QEI N   N+    +  LE+ RNEL+  ++ LS ++S + ++++ D++ FY+EC++ N
Sbjct: 192 LTQEINNNSNNNDVNVKKNLEIKRNELITNLKQLSLEFSKIHEEFKNDKKTFYVECAKQN 251

Query: 211 ADLRRYL 217
             L++ L
Sbjct: 252 PALQKLL 258

>KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {ON}
           Anc_8.323 YDR145W
          Length = 508

 Score =  209 bits (531), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 95/170 (55%), Positives = 120/170 (70%)

Query: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394
           IFK+  PS+PI E++       V+Y+ NRPTITGGSGMNAPAL TPV  K+P YE DT+R
Sbjct: 323 IFKESEPSVPIPESIDTVQPAQVAYKVNRPTITGGSGMNAPALNTPVNVKIPVYEADTDR 382

Query: 395 VMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKSDSL 454
           V+SKRKLRELV+TV                         F+++VT FAC+LAKHR SDSL
Sbjct: 383 VLSKRKLRELVRTVGVDEGDGETVMDGDVEQLLLDLADDFVSDVTAFACRLAKHRGSDSL 442

Query: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKTA 504
           + RD+Q+HLERNWNIR+PG+A DEIRST+KWN T +Y+Q +NAI  ++TA
Sbjct: 443 EARDVQLHLERNWNIRLPGYATDEIRSTRKWNGTSAYHQKLNAIAQDRTA 492

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 109/199 (54%), Gaps = 9/199 (4%)

Query: 20  QLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRXXXXXXXXXXXXXVNN 79
           +LA R K  V EAKR+G  T+ GK+LL +AA+IKA+Y++    R               +
Sbjct: 32  ELAQRFKLFVGEAKRVGETTEAGKQLLVRAAKIKAVYDSV---RGASAGAAAQSQQRTAD 88

Query: 80  NAT-NVKSMDXXXXXXXXXXXXXATASSNNVTNNIKVLLTPQQREAYNRLVQKYEDDGQN 138
            AT NV +                  ++  +   ++  LTP+Q + Y+++   +++  ++
Sbjct: 89  GATGNVATA----PAAAGGGGGAGNTAATQLAMAMRQALTPEQVQQYDKIATNFQNKAKS 144

Query: 139 IKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYSTLQQKYQED 198
           I+ + N+LK+NI  L  EI N++ +  + QQL   RNELL  +R L+ ++++L+  +Q  
Sbjct: 145 IRDKHNYLKQNIDKLTAEI-NKQQDRSAKQQLAEKRNELLRSVRQLTVEHNSLKVNFQLS 203

Query: 199 RRKFYIECSQTNADLRRYL 217
           R+ FY+EC++ N  L++ L
Sbjct: 204 RKNFYVECAKLNPKLQQIL 222

>CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {ON}
           similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145w TAF61
          Length = 575

 Score =  208 bits (529), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 120/170 (70%)

Query: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394
           IFK  +P++PI++ V+  P   +++RSNRPTI+ GS MNA AL TPVMT LPPYE+DT+R
Sbjct: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445

Query: 395 VMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKSDSL 454
           VMSKRKLRELVK++                         F+TNVT FAC+LAKHRKSD+L
Sbjct: 446 VMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKSDNL 505

Query: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKTA 504
           +  DIQ+HLERNWNIRIPG++ DEIRS  KWN +P+Y Q + +IN +K A
Sbjct: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADKQA 555

 Score =  101 bits (251), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 113/223 (50%), Gaps = 8/223 (3%)

Query: 2   SGQAGNVQLQNLTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSK 61
           SG  G      +    +Q+L  R K LV EAK++G  T  GKELL QAA++KA+YE Y++
Sbjct: 19  SGSGGPPSKSAIQQKQIQELTARFKQLVTEAKKVGETTPRGKELLLQAAKLKAVYENYTR 78

Query: 62  QRXXXXXXXXXXXXXVNNNATNVKSMDXXXXXXXXXXXXXATASSN-------NVTNNIK 114
           ++              N NA                    A+ S N        + N IK
Sbjct: 79  RQQALARAQQLQQQGSNTNAAASSGSSTTGTTGTANSSGSASTSGNNSSNSSAQLANIIK 138

Query: 115 VLLTPQQREAYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNR 174
            +LTP+Q + Y +L+Q ++     IK +  F+K+NI  L  EI N++ +  + +QL   +
Sbjct: 139 QVLTPEQNQQYEQLLQNFQVRASAIKDKHTFIKQNIDRLVVEI-NKQTDEEAKKQLNEKK 197

Query: 175 NELLMKIRALSAQYSTLQQKYQEDRRKFYIECSQTNADLRRYL 217
            ELL  I+A+  ++  LQQ+ Q  ++ FY+EC++ N  L+R L
Sbjct: 198 TELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNPALQRLL 240

>NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {ON}
           Anc_8.323 YDR145W
          Length = 638

 Score =  206 bits (523), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 120/168 (71%)

Query: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394
           +FK   P + IS+ ++    +SV YRSNRP++TGGS MNA ALTTPV TKLPPYE+DTER
Sbjct: 439 MFKPAEPIVNISDTISTKQPISVPYRSNRPSLTGGSAMNASALTTPVATKLPPYEIDTER 498

Query: 395 VMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKSDSL 454
           VMSKRKLRELVK++                         F+TNVT+FAC+LAKHR SDSL
Sbjct: 499 VMSKRKLRELVKSIGVDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRNSDSL 558

Query: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNK 502
           + RDIQ+HLE+NWNIRIPG++ DEIRS +KW+P  +YNQ +  INN+K
Sbjct: 559 EPRDIQLHLEKNWNIRIPGYSADEIRSIRKWHPIQNYNQKLQHINNDK 606

 Score = 97.1 bits (240), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 111/233 (47%), Gaps = 31/233 (13%)

Query: 13  LTPASMQQLADRLKSLVNEAKRIGVD-TKEGKELLRQAARIKALYEAYS----------- 60
           L P  + +L+++ K+LVNEAK++G D ++ GKELL QA++IKA+Y+ Y+           
Sbjct: 36  LQPNQVIELSNKFKALVNEAKQLGGDNSQRGKELLIQASKIKAIYDTYNRQRQAAAAAAA 95

Query: 61  --------KQRXXXXXXXXXXXXXVNNNATNVKSMDXXXXXXXXXXXXXATASSNNVTNN 112
                    Q               NNN                      T SS N  N 
Sbjct: 96  AQARVQAQVQVQSSDVNKELPTSTANNNNIGATPSANTPTPNSIPISNSNTPSSLNANNG 155

Query: 113 -----------IKVLLTPQQREAYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRR 161
                      +K +LTP+Q + Y++LV  ++     IK + +F+K+NI  L QE+    
Sbjct: 156 NRLSSNQLASIMKQVLTPEQNQEYDKLVSTFQTRAAAIKEKHSFVKQNIERLSQELNKPN 215

Query: 162 GNSLSVQQLEVNRNELLMKIRALSAQYSTLQQKYQEDRRKFYIECSQTNADLR 214
            +     QLE  + EL   IRA++ +++TL Q++Q  ++ FY+EC++ N  L+
Sbjct: 216 LDPNLKTQLENKKTELFNTIRAITVEHNTLHQQFQTGQKTFYVECAKNNPALQ 268

>TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.323
           YDR145W
          Length = 752

 Score =  203 bits (516), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 118/165 (71%)

Query: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394
           IFKQ  P +PISE++T     ++ YR+NRPT+TGG+ MN   L TPV+TKLPPYE+DT+R
Sbjct: 566 IFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQR 625

Query: 395 VMSKRKLRELVKTVXXXXXXXXXXXXXXXXXXXXXXXXXFITNVTNFACKLAKHRKSDSL 454
           VM KRKL+E+V++V                         F+T+VT FACK+AKHRKSDSL
Sbjct: 626 VMLKRKLKEVVRSVGVDDGDGETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSL 685

Query: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAIN 499
           DV DIQ+HLE+NWNIRIP ++ D IRS++KWNPT SYNQ +N++N
Sbjct: 686 DVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKLNSLN 730

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 69/109 (63%)

Query: 109 VTNNIKVLLTPQQREAYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQ 168
           + N IK LLTP+Q + Y++LV  ++    NIK + +FLK++IS    E+      +L   
Sbjct: 230 LANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDRV 289

Query: 169 QLEVNRNELLMKIRALSAQYSTLQQKYQEDRRKFYIECSQTNADLRRYL 217
           +LE  + EL+  ++A+S QY+TL Q++Q  ++ FYI C++ N +L+R L
Sbjct: 290 KLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLL 338

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 8/65 (12%)

Query: 7   NVQLQNLTP---ASMQQ-----LADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEA 58
           N++   LTP   A +QQ     L  + K LVNEAK++G +T  GKELL QA +IK +Y+ 
Sbjct: 42  NIRGHQLTPNQSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDN 101

Query: 59  YSKQR 63
           ++KQR
Sbjct: 102 FNKQR 106

>TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {ON}
           Anc_8.323 YDR145W
          Length = 405

 Score =  112 bits (281), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 74/113 (65%), Gaps = 1/113 (0%)

Query: 388 YEVDTERVMSKRKLRELVKTVXXXXXXXXXXXXX-XXXXXXXXXXXXFITNVTNFACKLA 446
           YE+++ERV+SKRKLRELV++V                          F++N+T+F+C+L+
Sbjct: 274 YELNSERVLSKRKLRELVRSVSIDEHDEKDLSIDGDVEELLLDMADEFVSNITSFSCRLS 333

Query: 447 KHRKSDSLDVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAIN 499
           +HR S+ ++ RDIQ+H+ERNWNIR+PGF  DEI+S KKW  +  Y   +N++N
Sbjct: 334 RHRNSNMVNKRDIQLHVERNWNIRVPGFNADEIKSAKKWQSSNVYMHYLNSVN 386

 Score = 72.8 bits (177), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 103/201 (51%), Gaps = 4/201 (1%)

Query: 18  MQQLADRLKSLVNEAKRIGVDTKE-GKELLRQAARIKALYEAYSKQRXXXXXXXXXXXXX 76
           + +LA+  K+L+ +AK  G DT E GKELL +A ++K L+   S +              
Sbjct: 15  LNELAENFKNLIKDAKLNGGDTTEKGKELLIKATKVKKLFTQLSNKYKNDSSSNDSTLSR 74

Query: 77  VNNNATNVKSMDXXXXXXXXXXXXXATASSNNVTNNIKVLLTPQQREAYNRLVQKYEDDG 136
            N+N++                      S++N++  IK  LTP+Q E+Y  L++ ++   
Sbjct: 75  SNSNSSLKNMNTPPSTSSNNSSSTPMVRSNSNLSMMIKNALTPEQNESYETLLKDFQIRA 134

Query: 137 QNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYSTLQQKYQ 196
             IK E + +K  I  + + + ++  N    + L   RNE L +++ LS  Y+ L Q++Q
Sbjct: 135 AKIKREHSDVKEKIDNISKLLNSKTNNQ---EALTAKRNEYLFQLKKLSKDYTELHQQFQ 191

Query: 197 EDRRKFYIECSQTNADLRRYL 217
            +++ FY++ ++ N++L++ L
Sbjct: 192 NEKKNFYLKSAKQNSELQKVL 212

>KLLA0B02090g Chr2 (183718..187077) [3360 bp, 1119 aa] {ON} some
            similarities with uniprot|P53125 Saccharomyces cerevisiae
            YGL133W ITC1 Component of the ATP-dependent Isw2p-Itc1p
            chromatin remodeling complex required for repression of
            a-specific genes repression of early meiotic genes during
            mitotic growth and repression of INO1
          Length = 1119

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 8/67 (11%)

Query: 135  DGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALS-------AQ 187
            D  +I+GE   + ++I  LD   + R+   L ++QLE  R+ELL K +AL        A+
Sbjct: 945  DESDIEGELEKIAQDIMALDDSSKTRKI-LLKLEQLEAQRDELLAKKKALDGKETENGAK 1003

Query: 188  YSTLQQK 194
             S LQ+K
Sbjct: 1004 MSRLQRK 1010

>Kwal_47.17140 s47 complement(269893..270264) [372 bp, 123 aa] {ON}
           YKL192C (ACP1) - mitochondrial acyl carrier protein
           [contig 212] FULL
          Length = 123

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 435 ITNVTNFACKLAKHRKSDSLDVRDIQMHLERNWNIRIPGFANDEIRSTKK 484
           ITN T+FA  L      DSLD  ++ + +E  ++I IP    DEI+S K+
Sbjct: 66  ITNDTHFAKDLGL----DSLDTVELLVAIEEEFDIEIPDKVADEIKSVKE 111

>KLTH0D15554g Chr4 (1284597..1284968) [372 bp, 123 aa] {ON} similar
           to uniprot|P32463 Saccharomyces cerevisiae YKL192C ACP1
           Mitochondrial matrix acyl carrier protein involved in
           biosynthesis of octanoate which is a precursor to lipoic
           acid activated by phosphopantetheinylation catalyzed by
           Ppt2p
          Length = 123

 Score = 30.0 bits (66), Expect = 5.5,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 435 ITNVTNFACKLAKHRKSDSLDVRDIQMHLERNWNIRIPGFANDEIRS 481
           ITN T+FA  L      DSLD  ++ + +E  ++I IP    DEI+S
Sbjct: 66  ITNDTHFAKDLGL----DSLDTVELLVAIEEEFDIEIPDKVADEIKS 108

>CAGL0G09493g Chr7 complement(902228..906454) [4227 bp, 1408 aa]
           {ON} similar to uniprot|Q08562 Saccharomyces cerevisiae
           YOR191w RIS1
          Length = 1408

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 6/39 (15%)

Query: 167 VQQLEVNRNELLMKIRALSAQYSTLQQKYQEDRRKFYIE 205
           V+QLE  + E+ MK R  S       +KY E+R+KFY+E
Sbjct: 393 VEQLEKAKTEIQMKTRDKS------NEKYIEERKKFYVE 425

>NCAS0A11370 Chr1 complement(2251978..2255292) [3315 bp, 1104 aa]
           {ON} Anc_3.407 YPR095C
          Length = 1104

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 334 PIFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTP---VMTKLPP 387
           P F  P P  PI+   ++S   ++S   N  + + GS M  P LTTP    +T LPP
Sbjct: 379 PQFGVPPPIKPITARRSSSIVNALSSFVNLRSTSVGSSMKQPPLTTPNVRSLTDLPP 435

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.126    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,010,920
Number of extensions: 1500966
Number of successful extensions: 4735
Number of sequences better than 10.0: 42
Number of HSP's gapped: 4839
Number of HSP's successfully gapped: 67
Length of query: 511
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 397
Effective length of database: 40,409,475
Effective search space: 16042561575
Effective search space used: 16042561575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)