Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D16346g8.322ON30130116040.0
AGL194C8.322ON2562545453e-68
SAKL0H15576g8.322ON2822535327e-66
Kwal_56.239148.322ON2652565185e-64
Ecym_42538.322ON2582565114e-63
KLTH0G12320g8.322ON2542434698e-57
TDEL0F044808.322ON2602554672e-56
Kpol_1036.688.322ON2562614654e-56
TPHA0C008208.322ON2662674612e-55
KNAG0G024408.322ON2652624578e-55
ZYRO0F10362g8.322ON2512534341e-51
KAFR0H022708.322ON2682724352e-51
YLR128W (DCN1)8.322ON2692564221e-49
NDAI0G025908.322ON2862904143e-48
CAGL0M04257g8.322ON2732704091e-47
TBLA0A039308.322ON2662684012e-46
Suva_10.2218.322ON1781813567e-41
NCAS0C032708.322ON1841873462e-39
Skud_12.1978.322ON1791823437e-39
Smik_12.1918.322ON1251291957e-18
Ecym_46987.377ON39433800.14
ZYRO0B03014g7.377ON40144780.28
TDEL0C017007.377ON39049760.51
NDAI0A006901.134ON1402146760.56
ABR211C7.377ON38950702.2
TBLA0A013501.443ON356238692.8
AER426C2.217ON898126694.4
TPHA0J013905.670ON669100669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D16346g
         (301 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 3...   622   0.0  
AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, ...   214   3e-68
SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa] ...   209   7e-66
Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W...   204   5e-64
Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa] ...   201   4e-63
KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315) ...   185   8e-57
TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa...   184   2e-56
Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 ...   183   4e-56
TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 ...   182   2e-55
KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.32...   180   8e-55
ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 a...   171   1e-51
KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON...   172   2e-51
YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {...   167   1e-49
NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON...   164   3e-48
CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} simila...   162   1e-47
TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.32...   159   2e-46
Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W...   141   7e-41
NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON...   137   2e-39
Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W...   136   7e-39
Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W...    80   7e-18
Ecym_4698 Chr4 (1366090..1367274) [1185 bp, 394 aa] {ON} similar...    35   0.14 
ZYRO0B03014g Chr2 complement(244268..245473) [1206 bp, 401 aa] {...    35   0.28 
TDEL0C01700 Chr3 (297260..298432) [1173 bp, 390 aa] {ON} Anc_7.3...    34   0.51 
NDAI0A00690 Chr1 (126791..130999) [4209 bp, 1402 aa] {ON} Anc_1....    34   0.56 
ABR211C Chr2 complement(800856..802025) [1170 bp, 389 aa] {ON} S...    32   2.2  
TBLA0A01350 Chr1 (320382..321452) [1071 bp, 356 aa] {ON} Anc_1.4...    31   2.8  
AER426C Chr5 complement(1453808..1456504) [2697 bp, 898 aa] {ON}...    31   4.4  
TPHA0J01390 Chr10 (323615..325624) [2010 bp, 669 aa] {ON} Anc_5....    30   9.8  

>KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 301
           aa] {ON} similar to uniprot|Q12395 Saccharomyces
           cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 301

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/301 (100%), Positives = 301/301 (100%)

Query: 1   MFYFIFVSSFRVKKKAIYSRQNARASDHLLVDNNPSEISSYCVFIMEKEFMNLTGCTYSV 60
           MFYFIFVSSFRVKKKAIYSRQNARASDHLLVDNNPSEISSYCVFIMEKEFMNLTGCTYSV
Sbjct: 1   MFYFIFVSSFRVKKKAIYSRQNARASDHLLVDNNPSEISSYCVFIMEKEFMNLTGCTYSV 60

Query: 61  AQEYLRKNGGRVEYALNDYYDNVDTIGGMRQSYNPSLVAIFEKYSNGVSATEWDSSGLIR 120
           AQEYLRKNGGRVEYALNDYYDNVDTIGGMRQSYNPSLVAIFEKYSNGVSATEWDSSGLIR
Sbjct: 61  AQEYLRKNGGRVEYALNDYYDNVDTIGGMRQSYNPSLVAIFEKYSNGVSATEWDSSGLIR 120

Query: 121 FIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCDTLRKMKAYLHTLEER 180
           FIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCDTLRKMKAYLHTLEER
Sbjct: 121 FIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCDTLRKMKAYLHTLEER 180

Query: 181 LETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDNKYALKISKERLNSWLEF 240
           LETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDNKYALKISKERLNSWLEF
Sbjct: 181 LETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDNKYALKISKERLNSWLEF 240

Query: 241 INSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLLIDEYYEFLEENDK 300
           INSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLLIDEYYEFLEENDK
Sbjct: 241 INSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLLIDEYYEFLEENDK 300

Query: 301 L 301
           L
Sbjct: 301 L 301

>AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, 256
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR128W (DCN1); 1-intron
          Length = 256

 Score =  214 bits (545), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 103/254 (40%), Positives = 165/254 (64%), Gaps = 9/254 (3%)

Query: 48  KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGMRQSYNPSLVAIFEKYSNG 107
           +EF+ +T  T + A+ YL +N   +++AL+D+Y      GG  + Y+  LVA FE+Y+ G
Sbjct: 12  REFLAVTSATSAAAETYLERNHWSLDHALDDFYTQSGG-GGRAEQYSAELVATFERYAAG 70

Query: 108 VSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCDTL 167
            +    D+  L+R++ DLG  +ED  TLCL+++L +++LT  +SR QFL+ W  L C +L
Sbjct: 71  GAM---DTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGCSSL 127

Query: 168 RKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDNKYAL 227
             M+A +  LE RL TD  YF+++Y+YTF L  D G R L  + AI YW++FF D+ YA+
Sbjct: 128 PDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFFLDHTYAV 187

Query: 228 KISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLL 287
            +   RL SW EF+ + D      ++S D W MF +F +++P+D  L ++Y+E+A+WPL+
Sbjct: 188 TVPAPRLRSWFEFLRAGD-----HSVSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLV 242

Query: 288 IDEYYEFLEENDKL 301
           IDEYYE+++  ++L
Sbjct: 243 IDEYYEWVKGRNQL 256

>SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 282

 Score =  209 bits (532), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 106/253 (41%), Positives = 155/253 (61%), Gaps = 11/253 (4%)

Query: 49  EFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGMRQS----YNPSLVAIFEKY 104
           EFM+LT CT   A +YL +N   + YALN+YYD     GG        Y+  LV  F+KY
Sbjct: 32  EFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQ--GGFVNKKPVKYSHELVETFDKY 89

Query: 105 SNGVSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCC 164
           ++           L+++IEDLG  +ED  T+CL+++L  + + K ++ +QFL++W++  C
Sbjct: 90  ADSKRCIT--VENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSSWTEHGC 147

Query: 165 DTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDNK 224
             +  MK  L  LEE+L  D+DYF  IY+YT+ L  +E  RHL  D A EYW +FF ++ 
Sbjct: 148 KNMIHMKHELQDLEEQLHQDQDYFSHIYNYTYDLIVEESERHLNIDTAAEYWELFFHNSH 207

Query: 225 YALKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAW 284
           YA+ IS  RL +W+EF         +  ++ D W MF KFI ++P+DESL + YDEM AW
Sbjct: 208 YAVTISDSRLKTWIEFYTKKSG---RSTVTKDTWTMFLKFIIKFPDDESLIRGYDEMDAW 264

Query: 285 PLLIDEYYEFLEE 297
           PL+ DEYYE+++E
Sbjct: 265 PLVFDEYYEYMDE 277

>Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W -
           Hypothetical ORF [contig 171] FULL
          Length = 265

 Score =  204 bits (518), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 102/256 (39%), Positives = 160/256 (62%), Gaps = 20/256 (7%)

Query: 48  KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGMR---QSYNPSLVAIFEKY 104
           +EF+ LT C+  +AQ++L  N   ++YALNDYYD V   GG     + Y+P L+ +F+KY
Sbjct: 16  EEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVH--GGFTTDDRPYSPELLKVFQKY 73

Query: 105 S----NGVSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWS 160
                N ++       GL RFIEDLG+ +EDP+TLCL++++    L + +S + F+ +W 
Sbjct: 74  KSEDKNSITMI-----GLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWH 128

Query: 161 DLCCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFF 220
           D  C+    MK ++  LE++L TD  YF+SIY+YTF L  +   + L  + +I YW + F
Sbjct: 129 DRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLF 188

Query: 221 KDNK-YALKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYD 279
              K YA+K+ +ERL SW+++++ + +      +  D+W MF KF   +P++E+LK+ Y 
Sbjct: 189 SPAKPYAIKVPQERLQSWIQYLSGEVA-----KVHRDVWKMFLKFAVAFPDNEALKKGYS 243

Query: 280 EMAAWPLLIDEYYEFL 295
           E  AWPL+IDEYYE+L
Sbjct: 244 EDDAWPLVIDEYYEYL 259

>Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa]
           {ON} similar to Ashbya gossypii AGL194C 1-intron
          Length = 258

 Score =  201 bits (511), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 99/256 (38%), Positives = 156/256 (60%), Gaps = 17/256 (6%)

Query: 48  KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGMRQSYNPSLVAIFEKYS-- 105
           K+FM++T    + A+++L  N   ++YAL+D Y    +     ++Y+  L + F+ Y+  
Sbjct: 12  KQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAELYSTFQNYASE 71

Query: 106 NGVSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCD 165
           NG      D+  LI+++ DLG  +EDP+T+CL+Q+L +++LT  +  EQFL+ W+DL C 
Sbjct: 72  NG----RMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGCS 127

Query: 166 TLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDNKY 225
            L  M  Y++TL+ +L  D  YFK+IYSYTF +  D   R L  D AI YW + F D+ +
Sbjct: 128 NLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLLFLDHSF 187

Query: 226 ALKISKERLNSWLEFINSDDSDPRKQN----ISNDIWLMFYKFIEQYPNDESLKQNYDEM 281
           A KI + RL SW  F+       R+QN    ++ D W M +KF  ++P+D++L   Y EM
Sbjct: 188 ATKIPRTRLESWFRFL-------REQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEM 240

Query: 282 AAWPLLIDEYYEFLEE 297
            AWPL++DEYY +++E
Sbjct: 241 GAWPLIMDEYYGWIKE 256

>KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315)
           [765 bp, 254 aa] {ON} similar to uniprot|Q12395
           Saccharomyces cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 254

 Score =  185 bits (469), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 146/243 (60%), Gaps = 8/243 (3%)

Query: 48  KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGMRQSYNPSLVAIFEKYSNG 107
           +EF+ LT  + S A+ YL  N   +EYALND+YD V   G   +   P L+ +F +Y  G
Sbjct: 7   EEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQG-GFTSRPPPPQLLTLFNEYKKG 65

Query: 108 VSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCDTL 167
              T   + GLIRFI DLG+ +EDP TLC++  +    L++ VS+E F+  W D  C+ L
Sbjct: 66  EEDT-ISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNLCENL 124

Query: 168 RKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFF-KDNKYA 226
           +++K  +  L+E+L  D  YF+ IYS+T+ L  +   + L  + AI YW++ F  D  YA
Sbjct: 125 QQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTDGAYA 184

Query: 227 LKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPL 286
           ++I ++RL SW  F+  + S      I +DIW MF KF   +P++++LKQ Y+E  AWP+
Sbjct: 185 IQIPQKRLCSWTAFLTRNVS-----RIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPV 239

Query: 287 LID 289
           LID
Sbjct: 240 LID 242

>TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa]
           {ON} Anc_8.322 YLR128W
          Length = 260

 Score =  184 bits (467), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 157/255 (61%), Gaps = 12/255 (4%)

Query: 49  EFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGMRQSYNP-----SLVAIFEK 103
           EF++LT C    A+++LR+N  ++EYALNDYYD +   G + + + P      L+A+++K
Sbjct: 10  EFVSLTQCESKTAKDFLRRNQWKLEYALNDYYDQMPG-GFIEEPHTPVTYPEELLALYDK 68

Query: 104 YSNGVSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLC 163
           Y       + D  G+I+ IEDL   +ED +T+CL+++L    L   +S++QFL+ W    
Sbjct: 69  YVLE-DQNKIDIDGMIQLIEDLDYKLEDLVTICLAKLLHCTRLADGISKDQFLHNWYMQG 127

Query: 164 CDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDN 223
           C TL +M+  L  L+ +L TD +Y   IY+YTF L  D+  R L  D A EYW +FF+  
Sbjct: 128 CSTLPQMRHVLDDLDTKLHTDLEYMTDIYNYTFDLALDQNKRDLDTDTAAEYWRLFFQPG 187

Query: 224 KYALKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAA 283
             A+ ++   LNSWL F++S+    +K  ++ D W M  +F +Q+P+  ++K +Y+E  A
Sbjct: 188 T-AVHVNPALLNSWLAFLDSE----QKTVVTRDTWKMLLEFFKQFPSLSAVKTSYNEADA 242

Query: 284 WPLLIDEYYEFLEEN 298
           WP +IDEYYE+LE++
Sbjct: 243 WPYIIDEYYEYLEDS 257

>Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 aa]
           {ON} (188159..188161,188259..189026) [771 nt, 257 aa]
          Length = 256

 Score =  183 bits (465), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 159/261 (60%), Gaps = 13/261 (4%)

Query: 46  MEKEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGM-----RQSYNPSLVAI 100
           + +EF+ LT C   VA +YL++N   + YALN+YYD    +G          Y   L+ I
Sbjct: 4   ITEEFIGLTNCDKKVATKYLKRNNWNLNYALNEYYDK--EVGSFLVEEEVIEYPEELIQI 61

Query: 101 FEKYSNGVSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWS 160
           F+KYSN  +    D+ G I+ I DL   +ED +T+CL++++    L+ P++++QFL+ W 
Sbjct: 62  FKKYSND-NGESIDTDGFIQLINDLDYQLEDIVTICLAELMHCKSLSLPITKDQFLSTWY 120

Query: 161 DLCCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFF 220
           +  C  L+ MK  L  L+ +L+ D  Y+  IY Y+F L  D   + + KD+AIEYW +FF
Sbjct: 121 EQGCSQLKHMKILLDDLDHKLQNDIRYYTHIYRYSFDLIRDSNEKCIEKDMAIEYWKLFF 180

Query: 221 KDNKYALKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDE 280
             +K  + I++ +LNSW+EFIN ++     ++I+ D+W    ++ ++YP  E L +NY+E
Sbjct: 181 S-SKCPITINELQLNSWIEFINVNEI----ESITRDVWERLLEYFKKYPTLEILSKNYNE 235

Query: 281 MAAWPLLIDEYYEFLEENDKL 301
           +  WP ++DEYYEFLE+  ++
Sbjct: 236 LDPWPYIMDEYYEFLEDTKRI 256

>TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 bp,
           266 aa] {ON} Anc_8.322 YLR128W
          Length = 266

 Score =  182 bits (461), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 157/267 (58%), Gaps = 20/267 (7%)

Query: 48  KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGG----MRQSYNPSLVAIFEK 103
           +EF  LT  +  VA++YL  N   + YALN++YD    +GG    + + Y   L+ +FE+
Sbjct: 6   REFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQ--ELGGFVHDVPREYPAELIELFER 63

Query: 104 YSN-----GVSATE----WDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQ 154
           Y+N     G S  E     D+ GLI+FIEDLG  +ED  TLCL+ ++  ++LT  ++R Q
Sbjct: 64  YNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQ 123

Query: 155 FLNAWSDLCCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIE 214
           FL AW +  C  ++ +K  L T+ E L +D +YF  IY+Y+F L T+E  + +  D A E
Sbjct: 124 FLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKE 183

Query: 215 YWNIFFKDNKYALKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESL 274
           YW +FF D    L I KE+L++W +F+    +   K+ I+ D W M  +F +++P     
Sbjct: 184 YWKLFFGDGT-PLHIEKEQLDNWNKFL----TISGKKTITKDEWKMILEFFKKFPTVTEF 238

Query: 275 KQNYDEMAAWPLLIDEYYEFLEENDKL 301
           K  YD M  WP ++DEY+E+LEEN KL
Sbjct: 239 KDEYDPMDPWPYIMDEYHEYLEENGKL 265

>KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.322
           YLR128W
          Length = 265

 Score =  180 bits (457), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 99/262 (37%), Positives = 150/262 (57%), Gaps = 20/262 (7%)

Query: 49  EFMNLTGCT-YSVAQEYLRKNGGRVEYALNDYYDNVDTIGGMRQSYN----------PSL 97
           +F+ LT C     A+ YLR++   V YALND+YD    +G    +Y           P L
Sbjct: 8   DFIELTQCRDRKKAERYLRESHWNVNYALNDFYDK--EVGNFFSTYKDVPQDNVVYPPEL 65

Query: 98  VAIFEKYSNGVSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLN 157
           + +F++YS     T     G+I +I DL +SI+D +T+CL+Q+L  ++L  P++REQFL 
Sbjct: 66  IHVFDQYSEAGVIT---FEGMITYIGDLSLSIDDLVTICLAQLLGWENLLAPITREQFLA 122

Query: 158 AWSDLCCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWN 217
            W    C T+ +MK  L  L  +LE D+ YFK IY YTFPL  +     L     IEYW 
Sbjct: 123 QWFLQGCSTINEMKTVLADLNGKLEKDRGYFKEIYMYTFPLLVEPDQNKLDAASTIEYWK 182

Query: 218 IFF-KDNKYALKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQ 276
           +FF ++ KY + I +E L+ W  ++     +    +++ DIW M Y+F  ++ +   +KQ
Sbjct: 183 LFFDQEKKYPMIIDQELLDPWFVYLGEQSEN---MSVTEDIWKMVYQFFNRFRSLGDVKQ 239

Query: 277 NYDEMAAWPLLIDEYYEFLEEN 298
            YDEMAAWP+LIDE+ E+L++ 
Sbjct: 240 GYDEMAAWPILIDEFIEYLQDT 261

>ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 251

 Score =  171 bits (434), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 142/253 (56%), Gaps = 10/253 (3%)

Query: 50  FMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGMRQSYNPSLVAIFEKYSNGV- 108
           F +L  C+   A++YL  +   V  ALNDYYD+        QSY+P L  +F KY+    
Sbjct: 8   FKSLAQCSDRTARDYLNTHNWDVNQALNDYYDSEH---DQDQSYSPELPQLFRKYAVVTP 64

Query: 109 SATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCDTLR 168
                D+ GLIR+I DLG  I++  T+CL+Q+L    LT  ++  QF   W    C +L 
Sbjct: 65  HGFIMDTDGLIRYIGDLGYEIDNLATICLAQLLHCQRLTDGITEGQFSYNWQQNGCTSLH 124

Query: 169 KMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDNKYALK 228
           +M   +  L+ +L TD+DY   IY+YTF L  D G++ L    A++YW +FF   +Y + 
Sbjct: 125 QMGKLVQRLDHKLRTDQDYTAQIYNYTFELALDPGAKTLETHTAVQYWTLFFATGQYPVI 184

Query: 229 ISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLLI 288
           + ++    W+ F+       ++Q+IS D W M + F  ++ N +S++ NY+E  AWP +I
Sbjct: 185 VEQQFFQLWISFVQ------QEQSISRDTWRMLFPFFNRFSNLQSVRDNYNEADAWPYII 238

Query: 289 DEYYEFLEENDKL 301
           DE+YE+L +  ++
Sbjct: 239 DEFYEYLADKGEI 251

>KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON}
           Anc_8.322 YLR128W
          Length = 268

 Score =  172 bits (435), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 161/272 (59%), Gaps = 24/272 (8%)

Query: 46  MEKE----FMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGM---------RQS 92
           ME+E    F+  T C  ++A++YL KN   + YALND+YD+   +GG          R  
Sbjct: 5   MEEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDS--ELGGFTKEHERSNRRAV 62

Query: 93  YNPSLVAIFEKYSNGVSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSR 152
           Y   LV +F  Y +    T  D  G+I+ I+D G++IED  T+CL+ +L  ++L   + R
Sbjct: 63  YPKELVQLFRDYCS--EDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYR 120

Query: 153 EQFLNAWSDLCCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRH--LPKD 210
           + FL    +  C T+  +K  L  L E+L TD  YF +IY+++F L  D+ +R+  +  D
Sbjct: 121 DDFLQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMD 180

Query: 211 VAIEYWNIFF-KDNKYALKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYP 269
           +AIEYW +FF  ++  +++IS E L+ W +F+    +D RK+ +S DIW M  +F  ++ 
Sbjct: 181 IAIEYWKLFFLNESIQSVEISNELLSLWFQFL----ADERKKQVSKDIWQMILEFFRKFK 236

Query: 270 NDESLKQNYDEMAAWPLLIDEYYEFLEENDKL 301
           + ESLK++YDE   WP +IDE+YE+L++  KL
Sbjct: 237 DLESLKESYDENDPWPFVIDEFYEYLQDTGKL 268

>YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {ON}
            DCN1Scaffold-type E3 ligase required for cullin
           neddylation and ubiquitin ligase activation; contains a
           ubiquitin-binding domain (UBA) for ubiquitin and Nedd8
           (Rub1p) interaction and a PONY domain involved in cullin
           binding and neddylation
          Length = 269

 Score =  167 bits (422), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 92/256 (35%), Positives = 140/256 (54%), Gaps = 15/256 (5%)

Query: 50  FMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDN-----VDTIGGMRQS--YNPSLVAIFE 102
           F +LT C   V+++YL++N   + YALNDYYD       D +  +     Y   L  +FE
Sbjct: 21  FTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPVYPKELTQVFE 80

Query: 103 KYSNGVSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDL 162
            Y N      +D   L++FIE+LG ++ED  TLCL+ +L    L +P+ RE FL+ W   
Sbjct: 81  HYINN---NLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQ 137

Query: 163 CCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKD 222
            C T+  M+  + TL+ +L  D  YF  IY+Y F L  D   + +  D  I+YW +FF+ 
Sbjct: 138 GCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQP 197

Query: 223 NKYALKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMA 282
            +Y +++  + L +W  F+     D  K  IS D W M   F ++YP  + +  +YDE A
Sbjct: 198 -EYPVRMEPDLLEAWFRFLR----DEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETA 252

Query: 283 AWPLLIDEYYEFLEEN 298
           AWP +IDE+YE L++ 
Sbjct: 253 AWPFIIDEFYECLQDQ 268

>NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON}
           Anc_8.322 YLR128W
          Length = 286

 Score =  164 bits (414), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 159/290 (54%), Gaps = 52/290 (17%)

Query: 60  VAQEYLRKNGGRVEYALNDYYD--------------NVDTIGGMRQSYNPSLVAIFEKYS 105
           +A++YL +N  R+ YALN+YYD                 TI      Y   L+A+F+KYS
Sbjct: 1   MAKKYLSRNNWRLNYALNEYYDKEIGSFIGDDDDDDGCKTILPDLNKYPQELIALFKKYS 60

Query: 106 --NGVSATEW-DSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDL 162
             N  S  E+ D  GLI +I DL  ++ED +T+CL+++L  ++L   ++++QFL+ W   
Sbjct: 61  SKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQ 120

Query: 163 CCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPL------------NTDEG------- 203
            C TL +M+  L+ L+ +L  D  YF  IY+YTF L            NT+ G       
Sbjct: 121 GCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSN 180

Query: 204 -----------SRHLPKDVAIEYWNIFFKDN-KYALKISKERLNSWLEFINSDDSDPRKQ 251
                        +L  + AI YW +FF  N +Y +K++KE L+ W +F+N +    RK+
Sbjct: 181 DTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEE----RKK 236

Query: 252 NISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLLIDEYYEFLEENDKL 301
            I+ D W M  +F +++ N E +KQNYDE AAWP +IDE+YE+L++  ++
Sbjct: 237 EITKDQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286

>CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} similar
           to uniprot|Q12395 Saccharomyces cerevisiae YLR128w
          Length = 273

 Score =  162 bits (409), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 149/270 (55%), Gaps = 23/270 (8%)

Query: 48  KEFMNLTGCT-YSVAQEYLRKNGGRVEYALNDYYDNVDTIGGMRQ--------SYNPSLV 98
           K F +LT CT    A+ YL  N   + YALN+YYD    +GG  +         Y   LV
Sbjct: 11  KTFQSLTSCTDEGKAKRYLSANNWNINYALNEYYDK--EVGGFTEDHMIRHQFKYPDELV 68

Query: 99  AIFEKYSNGVSATEWDS---SGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQF 155
           ++F  Y+  +      S    GLI +I+DLG ++ED +T+ L+  L   +L  P++ +QF
Sbjct: 69  SLFGHYAALIEEDGTQSITPDGLIDYIQDLGYNLEDLVTISLAHFLQCKNLENPITEKQF 128

Query: 156 LNAWSDLCCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEY 215
           L  W +  C TL +M+ YL   E +L  D  YF +IY+Y+F LN  +    +  D+AIEY
Sbjct: 129 LYFWYNEGCYTLEQMRHYLEDCERKLCNDWKYFTTIYNYSFDLNASKQGV-VETDIAIEY 187

Query: 216 WNIFFKDNKYAL----KISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPND 271
           W +FF++N+  L    K+ +  L+ W +F+     D  K+ I  D W M   F +++P+ 
Sbjct: 188 WKLFFEENRTKLSGIIKVDQAHLDLWCKFL----QDEHKKLIHKDTWQMLLLFFKKFPSL 243

Query: 272 ESLKQNYDEMAAWPLLIDEYYEFLEENDKL 301
           +++K  Y+E  AWP  IDE+YE+LEE + L
Sbjct: 244 DAIKTEYNEADAWPYTIDEFYEYLEERNVL 273

>TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.322
           YLR128W
          Length = 266

 Score =  159 bits (401), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 86/268 (32%), Positives = 151/268 (56%), Gaps = 24/268 (8%)

Query: 48  KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGG------------MRQSYNP 95
           KEFM+L     S AQ+YL++N  R+EYALND+YDN   IG             +   Y  
Sbjct: 9   KEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDN--EIGSFLIQDLARDNKILGIEYVR 66

Query: 96  SLVAIFEKYS--NGVSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSRE 153
            L  ++  Y+  +GV  TE    GL++ ++DLG +++  +TLCL++++     T P+   
Sbjct: 67  PLTELYNHYAIDSGVLGTE----GLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLS 122

Query: 154 QFLNAWSDLCCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAI 213
            F+++     C +L  +K  L+  + +L+T+ +Y+  IY   F L  +EG + +  + A 
Sbjct: 123 NFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQ 182

Query: 214 EYWNIFFKDNKYALKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDES 273
           EYW++FF    Y +K+  ++   W +++    S+   + I+ D W M  +F +++P+   
Sbjct: 183 EYWDLFFACQNYPIKVQSDQYQQWFKYL----SNANIKEITKDQWAMLLRFFKKFPSLSE 238

Query: 274 LKQNYDEMAAWPLLIDEYYEFLEENDKL 301
           L++ Y E +AWP + DEYYE+LE+N+K+
Sbjct: 239 LQRKYSEDSAWPYIFDEYYEYLEDNNKI 266

>Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W
           (REAL)
          Length = 178

 Score =  141 bits (356), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 74/181 (40%), Positives = 105/181 (58%), Gaps = 5/181 (2%)

Query: 117 GLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCDTLRKMKAYLHT 176
            LI+FIEDLG ++ED  TLCL  +L    L +P+ RE FL+AW    C TL  MK  +  
Sbjct: 3   SLIKFIEDLGYNLEDLATLCLVHLLGYKKLEEPLDRETFLSAWFMQGCSTLPNMKKCVKG 62

Query: 177 LEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDNKYALKISKERLNS 236
           L+ +L  D  YF  IY YTF L  D   + +  + AI+YW + F+  +Y + +    L +
Sbjct: 63  LDAKLHEDLQYFTEIYDYTFHLILDTNRKDIDTEEAIQYWTLLFQ-PEYPIHMEPGLLEA 121

Query: 237 WLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLLIDEYYEFLE 296
           W  F++    D  K+ I+ D W M  +F +QYP   S+  +YDE AAWP +IDE+YEFL 
Sbjct: 122 WFRFLH----DEGKRTITKDAWHMLLQFFKQYPTIRSIIDDYDEAAAWPFIIDEFYEFLR 177

Query: 297 E 297
           +
Sbjct: 178 D 178

>NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON}
           Anc_8.322 YLR128W
          Length = 184

 Score =  137 bits (346), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 67/187 (35%), Positives = 115/187 (61%), Gaps = 7/187 (3%)

Query: 117 GLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCDTLRKMKAYLHT 176
           GL+ ++ DLG+ +ED +T+CL+ +L   ++   ++R+QFL  W    C  + +MK  L  
Sbjct: 3   GLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLVD 62

Query: 177 LEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFF--KDNKYALKISKERL 234
           L ++L +DK YF  IY+YTF L TD   + L  + A+ YW +F   K+ ++ +++    L
Sbjct: 63  LNDKLHSDKQYFIDIYNYTFGLITDP-DKDLEVETAVAYWKLFLQPKEGEFPVRVDPTLL 121

Query: 235 NSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLLIDEYYEF 294
           N W +F++ ++    K+ I+ D W M   F +++PN   +K+ YDE AAWP +IDEYYE+
Sbjct: 122 NLWFQFLDEEN----KKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEY 177

Query: 295 LEENDKL 301
           L++ + +
Sbjct: 178 LQDTNHI 184

>Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W
           (REAL)
          Length = 179

 Score =  136 bits (343), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 72/182 (39%), Positives = 103/182 (56%), Gaps = 5/182 (2%)

Query: 117 GLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCDTLRKMKAYLHT 176
            L++FIEDLG S+ED  TLCL  +L   +L +P+ RE FL+ W    C TL  M+  +  
Sbjct: 3   SLVKFIEDLGYSLEDLATLCLVDLLGYKNLEEPLKRETFLSTWFMQGCSTLPDMQGCIKR 62

Query: 177 LEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDNKYALKISKERLNS 236
           L+ +L  D  Y+  +Y Y F L  D   +++  D AI+YW +FF+   Y + I    L S
Sbjct: 63  LDVKLHEDLQYYTQVYDYAFRLILDSNRKNIDIDDAIQYWTLFFQ-PVYPVHIESNLLES 121

Query: 237 WLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLLIDEYYEFLE 296
           W  F+     D  K  IS D W M   F +QY   +S+   YDE AAWP +IDE+YE+L+
Sbjct: 122 WFHFLR----DEGKTLISKDTWHMLLLFFQQYLTIQSIIDGYDETAAWPFIIDEFYEYLQ 177

Query: 297 EN 298
           ++
Sbjct: 178 DH 179

>Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W
           (REAL)
          Length = 125

 Score = 79.7 bits (195), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 71/129 (55%), Gaps = 5/129 (3%)

Query: 170 MKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDNKYALKI 229
           M+  +  L+ +L  +  YF  IY+YTF L  D   + +  +  I+YW +FF+  +Y + I
Sbjct: 1   MQECMKRLDIKLRQNLQYFTLIYNYTFHLLLDSYRKDIDINECIQYWKLFFRP-EYPVSI 59

Query: 230 SKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLLID 289
            +  L +W  F++    D  K  I+ D W M   F ++Y     +  +YDE AAWP +ID
Sbjct: 60  EQNLLEAWFRFLH----DEGKMMINKDTWQMLLVFFKKYSTVREIMDDYDESAAWPFIID 115

Query: 290 EYYEFLEEN 298
           E+YE+L++ 
Sbjct: 116 EFYEYLQDQ 124

>Ecym_4698 Chr4 (1366090..1367274) [1185 bp, 394 aa] {ON} similar
          to Ashbya gossypii ABR211C
          Length = 394

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query: 48 KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYY 80
          ++FM LT C+  VA +++ K+ G +E A+N YY
Sbjct: 7  QQFMTLTNCSADVATQFINKSNGDLEDAINKYY 39

>ZYRO0B03014g Chr2 complement(244268..245473) [1206 bp, 401 aa]
          {ON} similar to uniprot|P34223 Saccharomyces cerevisiae
          YBL058W SHP1 UBX (ubiquitin regulatory X) domain-
          containing protein that regulates Glc7p phosphatase
          activity and interacts with Cdc48p interacts with
          ubiquitylated proteins in vivo and is required for
          degradation of a ubiquitylated model substrate
          Length = 401

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 48 KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYY-DNVDTIGGMR 90
          ++FM L  C ++ AQEYL++ G   E ALN YY    D+ GG R
Sbjct: 10 QQFMALANCPFNTAQEYLQEFGDLGE-ALNAYYAAEADSEGGKR 52

>TDEL0C01700 Chr3 (297260..298432) [1173 bp, 390 aa] {ON}
          Anc_7.377 YBL058W
          Length = 390

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 48 KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYY-DNVDTIGGMRQSYNP 95
          ++FM L  C+ +VAQ+YL + G   E ALN YY    D   G R  + P
Sbjct: 10 QQFMALANCSLAVAQKYLEEFGDLTE-ALNAYYAAESDPTSGERARHTP 57

>NDAI0A00690 Chr1 (126791..130999) [4209 bp, 1402 aa] {ON} Anc_1.134
           YCR038C
          Length = 1402

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 68/146 (46%), Gaps = 39/146 (26%)

Query: 30  LVDNNPS-----EISSYCVFIMEKEFMNLT-GCTYSVAQEYLRKNGGRVEYAL-NDYYDN 82
           LV+NNPS     EI ++ + ++ +E + ++  C+Y + ++Y        +YA  N +  N
Sbjct: 556 LVENNPSGCELLEIITHQIILLLRELLYISKSCSYIIREKY--------QYAYENTFESN 607

Query: 83  VDTI----------------GGMRQSYN---PSLVAIFEKYSNGVSATEWDSSG--LIRF 121
           +D +                G + Q  N   P+ +++  + SN   +  + S+G  LI  
Sbjct: 608 LDPLLSFVSELVSCIKIFVTGSLTQKLNELKPNYISLPSEKSN---SPRYSSTGEKLIII 664

Query: 122 IEDLGISIEDPITLCLSQMLCIDDLT 147
           + ++G  I   IT C + +  I DLT
Sbjct: 665 LSNMGTLIATTITSCNNYLRLIGDLT 690

>ABR211C Chr2 complement(800856..802025) [1170 bp, 389 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YBL058W
          (SHP1)
          Length = 389

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 48 KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIG---GMRQSYN 94
          ++FM LT  +  VA++YL ++   +E ALN +Y N    G   G R SY+
Sbjct: 7  QQFMMLTNSSAEVARKYLGEHEDDLEDALNGFYANQQRPGSVEGQRNSYS 56

>TBLA0A01350 Chr1 (320382..321452) [1071 bp, 356 aa] {ON} Anc_1.443
           YCR027C
          Length = 356

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 96/238 (40%), Gaps = 21/238 (8%)

Query: 70  GRVEYALNDYYDNVDTIGGMRQSYNPSLVAIFEKYSNGVSATEWDSSGLIRFIEDLGISI 129
           GR +  +    +N+    G+ QS N + + + E  SN      +    L++ I+  GI+ 
Sbjct: 83  GRNDNTIGTIPNNISNTSGIGQSSNSNNI-LMENLSN-----SYHEGQLVQIIDLGGITS 136

Query: 130 EDPITLC----LSQMLCIDDLTKPVSREQFLNAWSDLCCDTLRKMKAYLHTLEERLETDK 185
           +  I L     ++ ++ + ++    S E     W+ L   +   +   L+ L++     K
Sbjct: 137 DSFINLKNLVDINGIMLVYNVINRSSFESIKLIWNKLLDQS--GIIELLYKLQKSYSESK 194

Query: 186 DYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDNKYALKISKERLNSW----LEFI 241
             FK I      +      R +P D  I    + FK+ +   K+  E LN      +E  
Sbjct: 195 VKFKPIILPVVIVGNKIDLRDIPNDKNIRDTKVTFKEGQAITKLLCESLNKRIAKEIEKG 254

Query: 242 NSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLLIDEYYEFLEEND 299
           N   S  + +N  N    +   FIE      S K N +   ++ L++ + Y+   +ND
Sbjct: 255 NKSKSTSKTKNTINLPIQLDVGFIET-----SAKLNINVNESFSLILKKIYKNFNKND 307

>AER426C Chr5 complement(1453808..1456504) [2697 bp, 898 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL137C
          Length = 898

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 53/126 (42%), Gaps = 9/126 (7%)

Query: 75  ALNDYYDNVDTIGGMRQSYNPSLVAIFEKYSNGVSATEWDSSGLIRFIED----LGISIE 130
            LN  + N D+ G  R SY    +A +EK   G++  +  S+ L RF  D    +G   +
Sbjct: 519 GLNPLFLNADSKGLYRVSYES--LACYEKLKKGITEGKLSSTDLYRFFTDIDAIIGSRYQ 576

Query: 131 DPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCDTLRKMKAYLHTLEERLETDKDYFKS 190
            PI L     +        V    + +  + +   TL++++  L T    L +  DY  +
Sbjct: 577 KPIHLQGLHSVLAHMAVLGVDIGNYFHGLA-IGLRTLQRLELSLMTYRGMLRS--DYLST 633

Query: 191 IYSYTF 196
           +Y   F
Sbjct: 634 VYQPLF 639

>TPHA0J01390 Chr10 (323615..325624) [2010 bp, 669 aa] {ON} Anc_5.670
           YKR078W
          Length = 669

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 45/100 (45%), Gaps = 12/100 (12%)

Query: 129 IEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCDTLRKMKAYLHTLEERLETDKDYF 188
           +ED I    +  L  DD   P  R Q LNA   L    L K+K +   LE+  +T+   F
Sbjct: 576 VEDNIRSLKNSSLTTDD--NP--RIQELNAKKSLTTTRLNKIKRHFINLEKISKTEIRAF 631

Query: 189 KSIYSYTFPLNTDEGSRHLPKDVA-----IEYWNIFFKDN 223
             +Y+     N D+ + ++   +      IE W  F+K+N
Sbjct: 632 DMMYATE---NMDKITTYIELSIGCQQKVIELWQTFYKNN 668

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,423,387
Number of extensions: 1808953
Number of successful extensions: 5218
Number of sequences better than 10.0: 54
Number of HSP's gapped: 5325
Number of HSP's successfully gapped: 54
Length of query: 301
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 192
Effective length of database: 40,982,805
Effective search space: 7868698560
Effective search space used: 7868698560
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)