Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D16302g3.494ON22622611861e-167
KLTH0F14872g3.494ON2802149931e-137
SAKL0F02728g3.494ON2822149911e-136
Kwal_55.212403.494ON2832149851e-136
TDEL0D056203.494ON2792149741e-134
TPHA0D032903.494ON2852139621e-132
TBLA0D029503.494ON2822129591e-132
Kpol_1017.53.494ON2832149591e-132
Smik_6.2283.494ON2872139591e-131
CAGL0I10472g3.494ON2882089571e-131
Suva_7.4203.494ON2872139541e-131
YGR132C (PHB1)3.494ON2872139541e-131
Skud_7.4433.494ON2872139521e-130
KAFR0C019803.494ON2832139471e-130
NCAS0E007903.494ON3272139421e-128
NDAI0G009203.494ON2962099321e-127
ZYRO0D09900g3.494ON2832119281e-127
KNAG0B007903.494ON2842129231e-126
Ecym_12353.494ON2832149051e-123
AFR313C3.494ON2832158971e-122
ADL141W5.98ON3071906743e-88
YGR231C (PHB2)5.98ON3101936623e-86
Kwal_27.127475.98ON3071906605e-86
SAKL0G15510g5.98ON3081936597e-86
Smik_16.755.98ON3101936581e-85
KAFR0B042505.98ON3101936571e-85
TBLA0H022205.98ON3071906562e-85
KLTH0C01672g5.98ON3071906511e-84
Suva_7.5235.98ON3101936511e-84
Kpol_1050.615.98ON3101906502e-84
Skud_7.5655.98ON3101936493e-84
CAGL0L06490g5.98ON3131906483e-84
KNAG0A015805.98ON2881896431e-83
NDAI0D025305.98ON3161936441e-83
NCAS0F006005.98ON3131906414e-83
TPHA0A050905.98ON3101906414e-83
KLLA0E15731g5.98ON3081906405e-83
ZYRO0B15136g5.98ON3101906399e-83
TDEL0G012105.98ON3091936345e-82
NDAI0A022307.296ON816119701.7
KLTH0G09724g2.257ON107390701.8
KLLA0A01177g3.546ON63695683.4
Kwal_56.234948.238ON213091683.6
TDEL0H005207.518ON258845674.4
Suva_2.6871.52ON112838665.3
TPHA0I013002.117ON37950655.8
Kwal_33.131861.46ON41263656.4
TPHA0C011407.232ON29970656.5
NCAS0A067605.267ON187690666.6
TDEL0H029007.128ON18853647.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D16302g
         (226 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   461   e-167
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   387   e-137
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   386   e-136
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   384   e-136
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   379   e-134
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   375   e-132
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   374   e-132
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   374   e-132
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   374   e-131
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   373   e-131
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   372   e-131
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   372   e-131
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   371   e-130
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   369   e-130
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     367   e-128
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     363   e-127
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   362   e-127
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   360   e-126
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   353   e-123
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   350   e-122
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   264   3e-88
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   259   3e-86
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   258   5e-86
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   258   7e-86
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   258   1e-85
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   257   1e-85
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   257   2e-85
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   255   1e-84
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   255   1e-84
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   254   2e-84
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   254   3e-84
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   254   3e-84
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   252   1e-83
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   252   1e-83
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   251   4e-83
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   251   4e-83
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   251   5e-83
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   250   9e-83
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   248   5e-82
NDAI0A02230 Chr1 (502448..504898) [2451 bp, 816 aa] {ON} Anc_7.296     32   1.7  
KLTH0G09724g Chr7 (818249..821470) [3222 bp, 1073 aa] {ON} simil...    32   1.8  
KLLA0A01177g Chr1 (108738..110648) [1911 bp, 636 aa] {ON} weakly...    31   3.4  
Kwal_56.23494 s56 complement(568724..575116) [6393 bp, 2130 aa] ...    31   3.6  
TDEL0H00520 Chr8 complement(79507..87273) [7767 bp, 2588 aa] {ON...    30   4.4  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    30   5.3  
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    30   5.8  
Kwal_33.13186 s33 complement(111561..112799) [1239 bp, 412 aa] {...    30   6.4  
TPHA0C01140 Chr3 (261760..262659) [900 bp, 299 aa] {ON} Anc_7.23...    30   6.5  
NCAS0A06760 Chr1 complement(1333937..1339567) [5631 bp, 1876 aa]...    30   6.6  
TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 ...    29   7.2  

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  461 bits (1186), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/226 (100%), Positives = 226/226 (100%)

Query: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60
           MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL
Sbjct: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60

Query: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120
           QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS
Sbjct: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180
           IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180

Query: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAEVKLNLQTTFPRH 226
           AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAEVKLNLQTTFPRH
Sbjct: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAEVKLNLQTTFPRH 226

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  387 bits (993), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 182/214 (85%), Positives = 202/214 (94%)

Query: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60
           MSR+AD +A+IA+P+GL  SA+QYSMYDV+GG RAVIFDRL GVQQ V+GEGTHFLVPWL
Sbjct: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60

Query: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120
           QK++L+DVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVM+LP IYQNLG+DYDERVLPS
Sbjct: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180
           IGNEVLKAIVAQFDAAELITQRE VSQRIR ELS RA EF+I+LEDVSITHMTFG+EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180

Query: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214
           AVEQKQIAQQDAERAR++VE AEQER+A+VIRAE
Sbjct: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAE 214

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  386 bits (991), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 183/214 (85%), Positives = 204/214 (95%)

Query: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60
           MS++AD +ARIA+P+G+  SA+QYSMYDV+GG RAVIFDRL GVQQ VIGEGTHFLVPWL
Sbjct: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60

Query: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120
           Q++I++DVRTKPKNIATNTGTKDLQMVSLTLRVLHRP+V+QLP IYQNLG+DYDERVLPS
Sbjct: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180
           IGNEVLKAIVAQFDAAELITQREIVSQRIR ELS RA EF+I+LEDVSITHMTFG+EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180

Query: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214
           AVEQKQIAQQDAERA+FLVE+AEQER+AAVIRAE
Sbjct: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAE 214

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  384 bits (985), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 181/214 (84%), Positives = 201/214 (93%)

Query: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60
           MSR AD +A+IA+P+GL  SA+QYSMYDV+GG RAVIFDRL GVQQ V+GEGTHFL+PWL
Sbjct: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60

Query: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120
           QK++LFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVM+LP IYQNLG+DYDERVLPS
Sbjct: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180
           IGNEVLK+IVAQFDAAELITQRE VSQRIR ELS RA EF+I+LEDVSITHMTFG++FTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180

Query: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214
           AVEQKQIAQQDAERARF+VE AEQER+A+VIRAE
Sbjct: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAE 214

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  379 bits (974), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 179/214 (83%), Positives = 200/214 (93%)

Query: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60
           MSR+ + +AR+AIP+G+ VS +QYSMYDVRGG RAVIFDRL GVQ+ V+GEGTHFLVPWL
Sbjct: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60

Query: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120
           QK+I++D+RTKPK IATNTGTKD+QMVSLTLRVLHRPDV+QLP+IYQNLG+DYDERVLPS
Sbjct: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180
           IGNEVLKAIVAQFDAAELITQRE+VSQRIR ELS RA EF I+LEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180

Query: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214
           AVEQKQIAQQDAERA+FLVEKAEQ RKA+VIRAE
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAE 214

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  375 bits (962), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 178/213 (83%), Positives = 198/213 (92%)

Query: 2   SRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQ 61
           ++V D + +IA+P+G+ VS IQY+MYDV+GG RAVIFDRL GV+Q VIGEGTHFL PWLQ
Sbjct: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62

Query: 62  KSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSI 121
           K+I+FDVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDV QLP IYQNLG+DYDERVLPSI
Sbjct: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKA 181
           GNEVLKAIVAQFDAAELITQREIVS +IR ELS R++EF IKLEDVSITHMTFGQEFTKA
Sbjct: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182

Query: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214
           VEQKQIAQQDAERA+FLVE+AEQER+AAVIRAE
Sbjct: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAE 215

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  374 bits (959), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 201/212 (94%)

Query: 3   RVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQK 62
           ++A+ +A+IAIP+G+ VS + YSMYDV+GG RAVIFDR+QGV+QAV+GEGTHFLVPWLQK
Sbjct: 5   KIAEKLAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQK 64

Query: 63  SILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIG 122
           S++FD+RTKPKNI TNTGT+DLQMVSLTLR+LHRPD++QLP IYQNLG+DYDERVLPSIG
Sbjct: 65  SVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIG 124

Query: 123 NEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAV 182
           NEVLK+IVAQFDAAELITQREIVSQRIR EL+ RA+EF I+LEDVSITHMTFG EFTKAV
Sbjct: 125 NEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAV 184

Query: 183 EQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214
           EQKQIAQQDAERA+FLVEKAEQER+A+VIRAE
Sbjct: 185 EQKQIAQQDAERAKFLVEKAEQERQASVIRAE 216

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  374 bits (959), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 173/214 (80%), Positives = 200/214 (93%)

Query: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60
           MS++ D +A++A+P+G+ VS IQ+SMYDV+GG RAVIFDR+ GV+Q +IGEGTHFL+PWL
Sbjct: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60

Query: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120
           QK+I++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDV+QLP IYQNLG+DYDERVLPS
Sbjct: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180
           I NEVLKAIVAQFDAAELITQRE+VS RIRAEL +R++EF I+LEDVSITHMTFG EFTK
Sbjct: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180

Query: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214
           AVE KQIAQQDAERA+FLVEKAEQER+AAVIRAE
Sbjct: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAE 214

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  374 bits (959), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 172/213 (80%), Positives = 199/213 (93%)

Query: 2   SRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQ 61
           SR+ D++ ++A+P+G+  S IQYSMYDV+GG R VIFDR+ GV+Q V+GEGTHFLVPWLQ
Sbjct: 5   SRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSI 121
           K+I++DVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V+QLP IYQNLG+DYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKA 181
           GNEVLK+IVAQFDAAELITQREI+SQ+IR ELS RA+EF IKLEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214
           VEQKQIAQQDAERA+FLVEKAEQER+A+VIRAE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAE 217

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  373 bits (957), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 176/208 (84%), Positives = 196/208 (94%)

Query: 7   VMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILF 66
           ++ ++AIPVG+ VS +QYSMYDV+GG R VIFDRLQGV+  V+GEGTHFLVPWLQK+I++
Sbjct: 11  LITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIY 70

Query: 67  DVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVL 126
           DVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDVMQLP IYQNLG+DYDERVLPSIGNEVL
Sbjct: 71  DVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVL 130

Query: 127 KAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQ 186
           K+IVAQFDAAELITQREIVSQ+IR ELS RA+EF I+LEDVSITHMTFG EFTKAVEQKQ
Sbjct: 131 KSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQ 190

Query: 187 IAQQDAERARFLVEKAEQERKAAVIRAE 214
           IAQQDAERARFLVEKAEQER+A+VIRAE
Sbjct: 191 IAQQDAERARFLVEKAEQERQASVIRAE 218

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  372 bits (954), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 198/213 (92%)

Query: 2   SRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQ 61
           SR  D++ ++A+P+GL  S +QYSMYDV+GG R VIFDR+ GV+Q V+GEGTHFLVPWLQ
Sbjct: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSI 121
           K+I++DVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V+QLP IYQNLG+DYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKA 181
           GNEVLK+IVAQFDAAELITQREI+SQ+IR ELS RA+EF IKLEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214
           VEQKQIAQQDAERA+F+VEKAEQER+A+VIRAE
Sbjct: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAE 217

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  372 bits (954), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 172/213 (80%), Positives = 199/213 (93%)

Query: 2   SRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQ 61
           +++ DV+ ++A+P+G+  S IQYSMYDV+GG R VIFDR+ GV+Q V+GEGTHFLVPWLQ
Sbjct: 5   AKLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSI 121
           K+I++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V+QLP IYQNLG+DYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKA 181
           GNEVLK+IVAQFDAAELITQREI+SQ+IR ELS RA+EF IKLEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214
           VEQKQIAQQDAERA+FLVEKAEQER+A+VIRAE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAE 217

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  371 bits (952), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 199/213 (93%)

Query: 2   SRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQ 61
           SR+ DV+ ++A+P+G+  + IQY+MYDV+GG R VIFDR+ GV+Q V+GEGTHFLVPWLQ
Sbjct: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSI 121
           K+I++DVRTKPK+IATNTGT+DLQMVSLTLRVLHRP+V+QLP IYQNLG+DYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKA 181
           GNEVLK+IVAQFDAAELITQREI+SQ+IR ELS RA+EF IKLEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214
           VEQKQIAQQDAERA+FLVEKAEQER+A+VIRAE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAE 217

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  369 bits (947), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 172/213 (80%), Positives = 200/213 (93%)

Query: 2   SRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQ 61
           +R  +V+ ++AIP GL ++A+ YSMYDV+GG R VIFDR+ GV++AVIGEGTHFLVPWLQ
Sbjct: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62

Query: 62  KSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSI 121
           K+I++DVRTKPK+I+TNTGTKDLQMVSLTLR+LHRP+V++LP+IYQNLG+DYDERVLPSI
Sbjct: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKA 181
           GNEVLK+IVAQFDAAELITQREIVSQRIR E+S RA+EF IKLEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182

Query: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214
           VEQKQIAQQDAERARFLVEKAEQER+A+VIRAE
Sbjct: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAE 215

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  367 bits (942), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 200/213 (93%)

Query: 2   SRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQ 61
           +++ +V+ R+A+P+G+  + ++YSMYDV+GG R VIFDRL GVQ+ VIGEGTHFLVPWLQ
Sbjct: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106

Query: 62  KSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSI 121
           K++++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRP++ +LPKIYQNLG+DYDE+VLPSI
Sbjct: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKA 181
           GNEVLK+IVAQFDAAELITQREIVSQRI++ELS RADEF I+LEDVSITHMTFG EFTKA
Sbjct: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226

Query: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214
           VEQKQIAQQDAERA+FLVEKAEQER+A+VIRAE
Sbjct: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAE 259

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  363 bits (932), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 196/209 (93%)

Query: 6   DVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSIL 65
           +++ ++A+P+GL V+ + YSMYDV+GG R VIFDRL GV+  V+GEGTHFLVPWLQK+++
Sbjct: 16  NLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVI 75

Query: 66  FDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEV 125
           +DVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V +LPKIYQNLG+DYDE+VLPSIGNEV
Sbjct: 76  YDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEV 135

Query: 126 LKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQK 185
           LK+IVAQFDAAELITQREIVSQRI++ELS RA+EF ++LEDVSITHMTFG EFTKAVEQK
Sbjct: 136 LKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQK 195

Query: 186 QIAQQDAERARFLVEKAEQERKAAVIRAE 214
           QIAQQDAERA+FLVEKAEQER+A+VIRAE
Sbjct: 196 QIAQQDAERAKFLVEKAEQERQASVIRAE 224

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  362 bits (928), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 170/211 (80%), Positives = 192/211 (90%)

Query: 2   SRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQ 61
           SR+A+ +A++AIP+G+  S IQYSMYDVRGG RAVIFDRL GVQQ V+GEGTHFLVPWLQ
Sbjct: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62

Query: 62  KSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSI 121
           K++++DVRTKPK+IATNTGTKD+QMVSLTLRVLHRP V+QLP IYQNLG+DYDERVLPSI
Sbjct: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKA 181
           GNEVLKAIVA++DAAELITQRE+VS  IR ELS RA EF I+LEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182

Query: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIR 212
           VE KQIAQQDAERA+FLVEKAEQ RK +VIR
Sbjct: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIR 213

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  360 bits (923), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 195/212 (91%)

Query: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60
           MS+  +V++++AIP GL + A  Y+MYDV+GG R VIFDR+ GVQQ V+GEGTHFLVPWL
Sbjct: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60

Query: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120
           QK+I++DVR+KPK+IATNTGTKDLQMVSLTLRVLHRP+VM+LP+IYQ+LG+DYDERVLPS
Sbjct: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180
           IGNEVLK+IVAQFDAAELITQRE+VSQRIR ELS RA EF I+LEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180

Query: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIR 212
           AVEQKQIAQQDAERA+FLVEKAEQ R+A+VIR
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIR 212

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  353 bits (905), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 165/214 (77%), Positives = 193/214 (90%)

Query: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60
           MSR  + +A IA+P+G+ + A Q  +YDVRGG RAVIFDRL GVQQ V+GEGTHFL+PWL
Sbjct: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60

Query: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120
           QK++++DVRTKPKNIATNTGTKDLQ+V+LTLRVLHRPDV+ LPKIYQ LG+DYDERVLPS
Sbjct: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180
           IGNEVLKAIVAQFDAAELITQRE+VSQ+IR EL+KRA  FHIKLEDV+ITHM FG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180

Query: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214
           +VE+KQIAQQ++ERA++LV+ AEQER AAVIRAE
Sbjct: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAE 214

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  350 bits (897), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 196/215 (91%), Gaps = 3/215 (1%)

Query: 1   MSRVADVMARIAIP---VGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLV 57
           MSR+AD + R+ +P   + L  SA+Q+SMYDVRGG RA+IFDR+ GV+  V+GEGTHFL+
Sbjct: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60

Query: 58  PWLQKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERV 117
           PWLQK+I+FDVRTKP+NIATNTGTKDLQMVSLTLRVLHRPDVM L +IY+ LG DYDERV
Sbjct: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120

Query: 118 LPSIGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQE 177
           LPSIGNEVLKAIVAQF+A+ELITQRE+VSQ+IR EL++RA EF+I+LEDVSITHMTFGQE
Sbjct: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180

Query: 178 FTKAVEQKQIAQQDAERARFLVEKAEQERKAAVIR 212
           FTKAVEQKQIAQQ+++RA+F+VE+AEQER+AAVIR
Sbjct: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIR 215

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  264 bits (674), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 119/190 (62%), Positives = 158/190 (83%)

Query: 25  SMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGTKDL 84
           S+++V GGHRA+++ RL GVQQ+V GEGTHF++PWL+  +L+DVR+KP+ +++ TGT DL
Sbjct: 57  SLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGTNDL 116

Query: 85  QMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RPDV  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQRES 176

Query: 145 VSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEKAEQ 204
           VS+ IR  L +RA  F+I L+DVSIT+MTF  EFT AVE KQ+AQQDA+RA F VEKA+Q
Sbjct: 177 VSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEKAKQ 236

Query: 205 ERKAAVIRAE 214
           E+++ +++A+
Sbjct: 237 EKQSMIVKAQ 246

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  259 bits (662), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 156/193 (80%)

Query: 22  IQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGT 81
           I  ++++V GGHRA+++ R+ GV   +  EGTHF+ PWL   I++DVR KP+N+A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 82  KDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RPDV+QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 142 REIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEK 201
           RE VS+ IR  L +RA +F+I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 202 AEQERKAAVIRAE 214
           A QE++  V+RA+
Sbjct: 234 ARQEKQGMVVRAQ 246

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  258 bits (660), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 117/190 (61%), Positives = 156/190 (82%)

Query: 25  SMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGTKDL 84
           S+++V GGHRA+++ RL GVQ  +  EGTHF +PWL+  I++DVR KP+N+A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RPDV QLP +++ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEKAEQ 204
           VS+ IR  L +RA +F++ L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERKAAVIRAE 214
           E++  V++A+
Sbjct: 237 EKQGMVVKAQ 246

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  258 bits (659), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 158/193 (81%)

Query: 22  IQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGT 81
           +  ++++V GGHRA+++ R+ G+QQ +  EGTHF VPWL+  I++DVR KP+N+A+ TGT
Sbjct: 55  VNSALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGT 114

Query: 82  KDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 115 KDLQMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 174

Query: 142 REIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEK 201
           RE VS+ IR  L +RA +F+I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 175 RERVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 234

Query: 202 AEQERKAAVIRAE 214
           A QE++  V++A+
Sbjct: 235 ARQEKQGMVVKAQ 247

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  258 bits (658), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 156/193 (80%)

Query: 22  IQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGT 81
           I  ++++V GGHRA+++ R+ GV   +  EGTHF+ PWL   I++DVR KP+N+A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGT 113

Query: 82  KDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RPDV+QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 142 REIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEK 201
           RE VS+ IR  L +RA +F+I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 202 AEQERKAAVIRAE 214
           A QE++  V++A+
Sbjct: 234 ARQEKQGMVVKAQ 246

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  257 bits (657), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 119/193 (61%), Positives = 157/193 (81%)

Query: 22  IQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGT 81
           +Q S+++V GGHRA+++ R+ GV   +  EGTHF++PWL+  I++DVR KP+N+A+ TGT
Sbjct: 53  LQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGT 112

Query: 82  KDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RPDV  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 113 KDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 172

Query: 142 REIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEK 201
           RE VS+ IR  L +RA +F+I L+DVSIT MTF  EFT+AVE KQIAQQDA+RA F+V+K
Sbjct: 173 REKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDK 232

Query: 202 AEQERKAAVIRAE 214
           A QE++  V++A+
Sbjct: 233 ARQEKQGMVVKAQ 245

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  257 bits (656), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 154/190 (81%)

Query: 25  SMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGTKDL 84
           S+++V GGHRA+++ RL GV   +  EGTHF++PWLQ  I++DVR KP+N+A+ TGTKDL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 85  QMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RPD+  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 145 VSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEKAEQ 204
           VS+ IR  L +RA +F+I L+DVSIT MTF  EFT AVE KQIAQQDA+RA FLV++A Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 205 ERKAAVIRAE 214
           E++  V++A+
Sbjct: 235 EKQGMVVKAQ 244

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  255 bits (651), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 117/190 (61%), Positives = 155/190 (81%)

Query: 25  SMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGTKDL 84
           S+++V GGHRA+I+ RL GVQ  +  EGTHF +PW +  I++DVR KP+N+A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP+V QLP +++ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEKAEQ 204
           VS+ IR  L +RA +F+I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERKAAVIRAE 214
           E++  V++A+
Sbjct: 237 EKQGMVVKAQ 246

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  255 bits (651), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 153/193 (79%)

Query: 22  IQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGT 81
           +  ++++V GGHRA+++ RL GV   +  EGTHF+ PW+   I++DVR KP+N+A+ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGT 113

Query: 82  KDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RPDV QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 142 REIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEK 201
           RE VS+ IR  L +RA  F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 202 AEQERKAAVIRAE 214
           A QE++  V++A+
Sbjct: 234 ARQEKQGMVVKAQ 246

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  254 bits (650), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 155/190 (81%)

Query: 25  SMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGTKDL 84
           ++++V GGHRA+++ R+ GV   +  EGTHF++PWL+  +++DVR KP+N+A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 85  QMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RPDV QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 145 VSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEKAEQ 204
           VS+ IR  L  RA  F++ L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 205 ERKAAVIRAE 214
           E++  V++A+
Sbjct: 240 EKQGMVVKAQ 249

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  254 bits (649), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 117/193 (60%), Positives = 154/193 (79%)

Query: 22  IQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGT 81
           +  ++++V GGHRA+++ R+ GV   +  EGTHF+ PWL   I++DVR KP+N+A+ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 82  KDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RPDV QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQ 173

Query: 142 REIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEK 201
           RE VS+ IR  L +RA  F+I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 202 AEQERKAAVIRAE 214
           A QE++  V++A+
Sbjct: 234 ARQEKQGMVVKAQ 246

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  254 bits (648), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 156/190 (82%)

Query: 25  SMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGTKDL 84
           ++++V GGHRA+++ R+ GV Q +  EGTH ++PW++  I++DVR KP+N+A+ TGTKDL
Sbjct: 59  ALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKPRNVASLTGTKDL 118

Query: 85  QMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 178

Query: 145 VSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEKAEQ 204
           VS+ IR  L +RA  F+I L+DVSIT+MTF  EFT+AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDAQRAAFIVDKARQ 238

Query: 205 ERKAAVIRAE 214
           E++  V++A+
Sbjct: 239 EKQGMVVKAQ 248

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  252 bits (643), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 115/189 (60%), Positives = 154/189 (81%)

Query: 25  SMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGTKDL 84
           ++++V GGHRA+++ R+ GV   +  EGTHF++PWL+  I++DVR KP+N+A+ TGTKDL
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 85  QMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RPDV QLP +Y+ LG DYD+RVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 145 VSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEKAEQ 204
           VS+ IR  L +RA  F+I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 205 ERKAAVIRA 213
           E++  V++A
Sbjct: 215 EKQGMVVKA 223

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  252 bits (644), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 117/193 (60%), Positives = 154/193 (79%)

Query: 22  IQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGT 81
           +  ++++V GGHRA+++ R+ GV   +  EGTHF +PW++  I++DVR KP+N+A+ TGT
Sbjct: 59  LNSALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASLTGT 118

Query: 82  KDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 119 KDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 178

Query: 142 REIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEK 201
           RE VS+ IR  L  RA+ F+I L+DVSIT MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 179 REKVSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 238

Query: 202 AEQERKAAVIRAE 214
           A QE++  V+RA+
Sbjct: 239 ARQEKQGMVVRAQ 251

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  251 bits (641), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 115/190 (60%), Positives = 152/190 (80%)

Query: 25  SMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGTKDL 84
           S+++V GGHRA+++ R+ GV   +  EGTHF++PW++  I++DVR KP+N+A+ TGTKDL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 85  QMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 145 VSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEKAEQ 204
           VS+ IR  L  R+  F+I L+DVSIT MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 205 ERKAAVIRAE 214
           E++  V+RA+
Sbjct: 239 EKQGMVVRAQ 248

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  251 bits (641), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 155/190 (81%)

Query: 25  SMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGTKDL 84
           ++++V GGHRA+++ R+ GV   +  EGTHF++PW++  +++DVR KP+N+A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 85  QMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 145 VSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEKAEQ 204
           VS+ IR  L  RA +F+I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 205 ERKAAVIRAE 214
           E++  V++A+
Sbjct: 238 EKQGMVVKAQ 247

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  251 bits (640), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 156/190 (82%)

Query: 25  SMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGTKDL 84
           ++++V GGHRA+++ R+ GVQ  +  EGTHF++PW++  +++DVR KP+N+++ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 85  QMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP+V  LP IY+ LG+DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 145 VSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEKAEQ 204
           VS+ IR  L +RA  F+I L+DVSIT+MTF  EFT +VE KQIAQQDA++A F+V+KA Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 205 ERKAAVIRAE 214
           E++  +++A+
Sbjct: 238 EKQGMIVKAQ 247

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  250 bits (639), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 115/190 (60%), Positives = 154/190 (81%)

Query: 25  SMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGTKDL 84
           ++++V GGHRA+++ R+ GV   +  EGTH L+PW +  +++DVR KP+N+A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 85  QMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RPDV QLP IY+ LG+DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 145 VSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEKAEQ 204
           VS+ IR  L +RA  F+I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 205 ERKAAVIRAE 214
           E++  V++A+
Sbjct: 240 EKQGLVVKAQ 249

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  248 bits (634), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 153/193 (79%)

Query: 22  IQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPKNIATNTGT 81
           +  ++++V GGHRA+++ R+ GV   +  EGTH ++PWL+  +++DVR KP+N+A+ TGT
Sbjct: 56  LNSALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGT 115

Query: 82  KDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RP+V QLP IY+ LG DY ERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 116 KDLQMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQ 175

Query: 142 REIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEK 201
           RE VS+ IR  L +RA  F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+K
Sbjct: 176 REKVSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 235

Query: 202 AEQERKAAVIRAE 214
           A QE++  V++A+
Sbjct: 236 ARQEKQGMVVKAQ 248

>NDAI0A02230 Chr1 (502448..504898) [2451 bp, 816 aa] {ON} Anc_7.296
          Length = 816

 Score = 31.6 bits (70), Expect = 1.7,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 55/119 (46%), Gaps = 14/119 (11%)

Query: 73  KNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQ 132
           KN  T   ++D Q +S    ++ R D M LP    NL + Y E+ +   G E +  ++A 
Sbjct: 299 KNFTTLLDSRDHQKISALFTLMQR-DFMLLP----NLSVAY-EQYIKQTGEEAISELIAS 352

Query: 133 FDAAELITQREIVSQRIRAEL-SKRADEFHIKLEDV-----SITHMTFGQE--FTKAVE 183
             AA + +  E + +   A + S    E+  KL D+     SIT   F  +  F KA++
Sbjct: 353 HKAAVMNSSNENIKKNPNAAINSLPPKEYIKKLLDIYAIFRSITTECFKNDSIFAKALD 411

>KLTH0G09724g Chr7 (818249..821470) [3222 bp, 1073 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112W HOS4
           Subunit of the Set3 complex which is a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity potential Cdc28p substrate
          Length = 1073

 Score = 31.6 bits (70), Expect = 1.8,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 44/90 (48%), Gaps = 18/90 (20%)

Query: 135 AAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAV------EQKQIA 188
           A E   +RE   QR++AE S R      K +          QEF + +       +++IA
Sbjct: 776 AVETTEERE---QRLKAEESYRQKRLLNKKKK--------EQEFLQKIAEDERKREEEIA 824

Query: 189 QQDAERARFL-VEKAEQERKAAVIRAEVKL 217
           +QDAERA+ L  EKA+Q  +    R E +L
Sbjct: 825 RQDAERAKKLEEEKAKQAEREIQKRTEAEL 854

>KLLA0A01177g Chr1 (108738..110648) [1911 bp, 636 aa] {ON} weakly
           similar to uniprot|P53075 Saccharomyces cerevisiae
           YGL228W SHE10 Putative glycosylphosphatidylinositol
           (GPI)-anchored protein of unknown function
           overexpression causes growth arrest
          Length = 636

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 15/95 (15%)

Query: 76  ATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLP-----SIGNEVLKAIV 130
           A+NT   + Q+++  +  ++  + +  PK  + +  D +   LP      +  E   A  
Sbjct: 364 ASNTSQTNFQIITKAIMDVNCTESVD-PKTNKTIWFDQNNTQLPKYMTRELMREYFSAAH 422

Query: 131 AQFDAAELITQREIVSQRIRAELSKRADEFHIKLE 165
           +QFDA         +SQ IRA L K ADE +  +E
Sbjct: 423 SQFDA---------LSQEIRAHLRKLADEVNDHVE 448

>Kwal_56.23494 s56 complement(568724..575116) [6393 bp, 2130 aa] {ON}
            YER172C (BRR2) - putative ATP-dependent RNA helicase
            [contig 176] FULL
          Length = 2130

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 40/91 (43%), Gaps = 5/91 (5%)

Query: 89   LTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQREIVSQR 148
            L +R+L  P +  +P  Y +     D+  L    +++  + + +  +  L+   E     
Sbjct: 944  LYVRMLKSPALYGVPDTYTS-----DDPTLLRYRDQLAHSALKELHSNHLVVYDEQKGTV 998

Query: 149  IRAELSKRADEFHIKLEDVSITHMTFGQEFT 179
            I  EL + A  F+IK   +S+ + T    FT
Sbjct: 999  ISTELGRIASHFYIKYHSMSMYNKTLNSHFT 1029

>TDEL0H00520 Chr8 complement(79507..87273) [7767 bp, 2588 aa] {ON}
            Anc_7.518 YLR454W
          Length = 2588

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 4/45 (8%)

Query: 58   PWLQKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQL 102
            PWL   + +D    P+ +A+N   K+L  VSL   V  RP +  +
Sbjct: 2115 PWLSLDLCYD----PEPLASNAVVKELSAVSLYDNVSQRPTLYNM 2155

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 30.0 bits (66), Expect = 5.3,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 27/38 (71%)

Query: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIRAEVKLNL 219
           +E+++  Q++ ERAR L+EK E +RK   ++ ++ +++
Sbjct: 579 LERRKRKQEEKERARKLLEKEELKRKQEELKKQIDIDI 616

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 26/50 (52%)

Query: 80  GTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAI 129
           G +   +  +  + L R D+   P +Y++L ++    VLP  GN +LK +
Sbjct: 274 GCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGNRILKEL 323

>Kwal_33.13186 s33 complement(111561..112799) [1239 bp, 412 aa] {ON}
           YCL029C (BIK1) - Microtubule-binding protein [contig
           121] FULL
          Length = 412

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 3/63 (4%)

Query: 107 QNLGIDYDERVLPSIGNEVLKAIVAQFDAAELITQREIVSQR--IRAELSKRADEFHIKL 164
           QN+ +D +ER  PS  +  L+A V Q  + EL   + +VS++  +  E+    D++ +KL
Sbjct: 131 QNMEVDTEERRTPSTSSRELEARVQQ-QSQELSQYKRVVSEQRVVLEEIQPAIDDYEVKL 189

Query: 165 EDV 167
           + +
Sbjct: 190 QQM 192

>TPHA0C01140 Chr3 (261760..262659) [900 bp, 299 aa] {ON} Anc_7.232
           YER055C
          Length = 299

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/70 (22%), Positives = 34/70 (48%)

Query: 142 REIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERARFLVEK 201
           ++++ + I +  +K  +++  KLE+ ++  MT   ++     +   A   A+    LVE 
Sbjct: 115 KQLIGKTIVSSFTKLTEDYFAKLENTTVDKMTTKVKYVSGSVEASCALGVADAIVDLVES 174

Query: 202 AEQERKAAVI 211
            E  R A +I
Sbjct: 175 GETMRAAGLI 184

>NCAS0A06760 Chr1 complement(1333937..1339567) [5631 bp, 1876 aa] {ON}
            Anc_5.267
          Length = 1876

 Score = 30.0 bits (66), Expect = 6.6,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 43/90 (47%)

Query: 123  NEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAV 182
            +E+LK +    + A +++    +S   + ELSKR DE   K++ ++    +   E T+ +
Sbjct: 1578 SELLKQVEHYSNLANVLSNERDISDASQKELSKRHDELLAKVQTLTANIESLTNEKTQLI 1637

Query: 183  EQKQIAQQDAERARFLVEKAEQERKAAVIR 212
             Q +  +    +     EK+  E+ +  IR
Sbjct: 1638 SQVEQLRTSIGKTTDDFEKSLNEKDSISIR 1667

>TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567
          bp, 188 aa] {ON} Anc_7.128 YIL009C-A
          Length = 188

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query: 51 EGTHFLVPWLQKSI------LFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRP 97
          + T FL+PW++KSI        D+R    N       KDL+   L+ R+L  P
Sbjct: 13 KDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSPRILRNP 65

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.135    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,314,231
Number of extensions: 717722
Number of successful extensions: 2285
Number of sequences better than 10.0: 64
Number of HSP's gapped: 2346
Number of HSP's successfully gapped: 64
Length of query: 226
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 120
Effective length of database: 41,326,803
Effective search space: 4959216360
Effective search space used: 4959216360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)