Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D16280g3.493ON1691696867e-93
SAKL0F02750g3.493ON1701704314e-54
Smik_16.4023.493ON1731734193e-52
YPR149W (NCE102)3.493ON1731734105e-51
Skud_16.4443.493ON1731734012e-49
Kwal_55.212383.493ON1701703899e-48
CAGL0I10494g3.493ON1721723872e-47
CAGL0L08448g3.493ON1731733802e-46
KLTH0F14850g3.493ON1711713723e-45
KAFR0C019703.493ON1791793691e-44
Suva_16.4783.493ON1661733611e-43
NCAS0E008003.493ON1741743447e-41
TDEL0D056103.493ON1751753412e-40
YGR131W (FHN1)3.493ON1741743385e-40
NDAI0G009303.493ON1761763342e-39
Ecym_12363.493ON1691693291e-38
NDAI0B058803.493ON1821823265e-38
KNAG0B008003.493ON1821823256e-38
TPHA0D032803.493ON1841843195e-37
Suva_7.4193.493ON1741743152e-36
Smik_6.2273.493ON1741743073e-35
KNAG0A079503.493ON1821533041e-34
Kpol_1017.63.493ON1871872995e-34
KAFR0G037003.493ON1861862995e-34
TBLA0D029603.493ON1891562883e-32
AFR312W3.493ON1681692854e-32
ZYRO0D09966g3.493ON1781782864e-32
Skud_7.4423.493ON1741742803e-31
NCAS0F035603.493ON1831832734e-30
TBLA0C044903.493ON1861282701e-29
KLLA0A11066g1.431ON28242740.27
YOR186W6.93ON14481652.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D16280g
         (169 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   268   7e-93
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   170   4e-54
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   166   3e-52
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   162   5e-51
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   159   2e-49
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   154   9e-48
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   153   2e-47
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   150   2e-46
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   147   3e-45
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   146   1e-44
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   143   1e-43
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   137   7e-41
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   135   2e-40
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   134   5e-40
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   133   2e-39
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   131   1e-38
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   130   5e-38
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   129   6e-38
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   127   5e-37
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   125   2e-36
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   122   3e-35
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   121   1e-34
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   119   5e-34
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   119   5e-34
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   115   3e-32
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   114   4e-32
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   114   4e-32
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   112   3e-31
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   109   4e-30
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   108   1e-29
KLLA0A11066g Chr1 (958239..959087) [849 bp, 282 aa] {ON} similar...    33   0.27 
YOR186W Chr15 (683111..683545) [435 bp, 144 aa] {ON} Putative pr...    30   2.6  

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  268 bits (686), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 141/169 (83%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           MLSILDNSLRG                IATQDHSSSRVN            DSLYALIAN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRKTQVGVPTISQV 169
           QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRKTQVGVPTISQV
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRKTQVGVPTISQV 169

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  170 bits (431), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 93/170 (54%), Positives = 107/170 (62%), Gaps = 1/170 (0%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           MLSILDNSLR                 IATQD  S RVN            DS YA+ AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
             SA AWPI+LV+ DFLN+VFTFSAATALAVGIR  SCTN+S+   N I +GS DRCRKA
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNA-ITSGAFGTSSNRKTQVGVPTISQV 169
           QA+  FLYFSF IFL K +LS++N   +      S +R+  VGVPTISQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSGSGSRRANVGVPTISQV 170

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  166 bits (419), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 107/173 (61%), Gaps = 4/173 (2%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           ML++ DN LR                 + TQD  SSRVN            DSLY + AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           FI  LAWP++L +LDFLN+VFTF+A T LAVGIR  SC N S+   NKI +GS  RCR+A
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSS----NRKTQVGVPTISQV 169
           QA+  FLYFS AIFL K ++SI N I++GAFG+ S     R  QVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  162 bits (410), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 106/173 (61%), Gaps = 4/173 (2%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           ML++ DN LR                 + TQ   SSRVN            DSLY + AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           FI  LAWP++L +LDFLN+VFTF+A T LAVGIR  SC N S+   NKI +GS  RCR+A
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSS----NRKTQVGVPTISQV 169
           QA+  FLYFS AIFL K ++S+ N I++GAFG+ S     R  QVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  159 bits (401), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 86/173 (49%), Positives = 105/173 (60%), Gaps = 4/173 (2%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           ML+  DN LR                 + TQD +SSRVN            DSLY + AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           F   LAWP++L +LDFLN+VFTF+A T LAVGIR  SC N S+   N I +GS  RCR+A
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSS----NRKTQVGVPTISQV 169
           QA+  FLYFS AIFL K ++S+ N I++GAFG+ S     R  QVGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  154 bits (389), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 93/170 (54%), Positives = 113/170 (66%), Gaps = 1/170 (0%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           MLSILDNSLR                  AT+D+++ +VN            D+LYA+ AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           FISALAWP+++   DFLN+VFTF+AATALAV IR  SCTN  +   NK+ +GS DRCRKA
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRKT-QVGVPTISQV 169
           QAS  FLYF+F +FLVK  LS+VN  + GAF TSS RK+  VGVPTISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSSGRKSANVGVPTISQV 170

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  153 bits (387), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 101/172 (58%), Gaps = 3/172 (1%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           MLS+ DN LR                 I T+   SSRVN            DSLY + AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGN-KIAEGSKDRCRK 119
           F   LAWP++L  LDFLN+VFTF+A T LAVGIR  SC N  +     KI +GS  RCR+
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRK--TQVGVPTISQV 169
           AQA   F YFS AIFL K I+SIV+ +++GAFG    RK  T+VGVP+ISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  150 bits (380), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 102/173 (58%), Gaps = 4/173 (2%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           ML++ DN LR                 IAT+D  SSRVN            DSLY + AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           F   LAWP+IL +LDFLN+ F  +A   LAVGIR  SC N  +   NKI +GS+ RCR++
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRK----TQVGVPTISQV 169
           QA+  F +FS AIFL K I+S++N  ++GAFGT   R+     +VGVP++SQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  147 bits (372), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 110/171 (64%), Gaps = 2/171 (1%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQD-HSSSRVNXXXXXXXXXXXXDSLYALIA 59
           MLSILDNSLR                  AT   H++ +VN            DSLYA+ A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NFISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119
           NF+SALAWP+++   DFLN+VFTF+AATALAV IR  SCTN  +   N + +GS DRCRK
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRKT-QVGVPTISQV 169
           AQAS  FLYFSF IFL K  LS+VN I+ GAFG  S+R+T  VGVPTISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTGNVGVPTISQV 171

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  146 bits (369), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 102/179 (56%), Gaps = 10/179 (5%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQD-HSSSRVNXXXXXXXXXXXXDSLYALIA 59
           ML + DN LR                 I TQ+ H +SRVN            DS+Y + A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119
           NF   LAWP++L +LDFLN+ FTFSAATALAVGIR  SC N S+   NKI  GS  RCR+
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNR--------KTQV-GVPTISQV 169
           AQA   FLYFS AIF+ K I+S +N   +GAF + S+R         T V GVP ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  143 bits (361), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 102/173 (58%), Gaps = 11/173 (6%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           ML+ +DN LR                 + TQ  +SSR+N            DSLY + AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           F   LAWP+IL SLDFLN+VFTF+A       IR  SC N ++ + N I +GS +RCR+A
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSS----NRKTQVGVPTISQV 169
           QA+  FLYFS AIFL K ++S+ N I++GAFG+ S     R  QVGVPTISQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  137 bits (344), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 96/174 (55%), Gaps = 5/174 (2%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           ML + DN LR                 + T+ H++SR+N            DS+Y + AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           F   LA P +   LDFLN+ FTF A T LA GIR  SC ++ + + NKI +G K+RCR++
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRK-----TQVGVPTISQV 169
           QA   F YFS AIFL K I+S +N I +GAF     R+      ++GVP+ISQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  135 bits (341), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 104/175 (59%), Gaps = 6/175 (3%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           ML+I+DN+LR                 I+++D  SSRVN            DS Y ++AN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
                AWP+IL +LDFLN+ FTFSAATALAVGIR  SC N  +   N I +GS  RCR A
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFG-----TSSNRKT-QVGVPTISQV 169
           QAS  F YFSF IFL K I+S++  IT+G F      TS  RK+ QVGVPTISQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  134 bits (338), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 101/174 (58%), Gaps = 5/174 (2%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           MLS  DN +R                 I TQ   SSRVN            DSLY  +AN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           F ++L +P IL+ LDFLN++FTF AATALAVGIR  SC N ++   NKI +GS  RC ++
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTS---SNRKT--QVGVPTISQV 169
           QA+  F YFS  +FL+K  ++ +  + +G FG++   S R+   Q+G+PTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  133 bits (334), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 98/176 (55%), Gaps = 7/176 (3%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           MLS+ DN LR                 + TQ   +SR+N            DS + ++AN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           F   L++P IL +LDFLN+ FTF A T LA GIR  SC N S+   NKI +GS +RCR++
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFG---TSSNRK----TQVGVPTISQV 169
           QA   F YFS  IFL+K  +S ++ I +GAF    TS  R+     +VGVP+ISQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  131 bits (329), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 109/169 (64%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           MLSILDNSLR                 I  Q+ S SRVN            DSLY+++AN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           FISALAWPI+L++ D LN +FTF+AATAL   I   SC+N  F  GN I+EG + RCRK 
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRKTQVGVPTISQV 169
           QAS+VFL+FSF IFL K +LS +N +++GAF + S RKT  GVPTISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGRKTGGGVPTISQV 169

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  130 bits (326), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 76/182 (41%), Positives = 101/182 (55%), Gaps = 13/182 (7%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           MLS +DN LR                 + TQ ++SSR+N            DS + +  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FISALA-WPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119
              ALA WPI+L   DFLN+VFTF+A T LAV IR  SC N+ + + N I +GS++RCR 
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTS------SNRKT------QVGVPTIS 167
           +QA+  F YFS  IFL K I+S +N  ++G FG+       S R+T      +VGVPTIS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 168 QV 169
           QV
Sbjct: 181 QV 182

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  129 bits (325), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 96/182 (52%), Gaps = 13/182 (7%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           ML + DN LR                 I TQ    SRVN            D LY L+AN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           F   LAWP+IL +LDFLN+ FT +A   LAVGIR  SC N  +   N I +GS++RCR +
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNR-------------KTQVGVPTIS 167
           QA+T F +FS  IF+ K ++S +N  ++GAF T+S++                 GVP+IS
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 168 QV 169
           QV
Sbjct: 181 QV 182

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  127 bits (319), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 99/184 (53%), Gaps = 15/184 (8%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           ML + DN LRG                +ATQ+  SSRVN            D+ Y  +AN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  FIS-ALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119
             S  LAWPIIL   DFLN+ FTF+A T LAVG R  SCTN S+   N I +GS DRCRK
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSS--------------NRKTQVGVPT 165
           AQA+T F YFSF IFL K I+S +N  T+GA G+ S                  Q+GVP 
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 166 ISQV 169
           ISQV
Sbjct: 181 ISQV 184

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  125 bits (315), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 98/174 (56%), Gaps = 5/174 (2%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           MLS+ DN +R                 I++Q   SSRVN            DS Y  +AN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
             S+L +P+I+  LDFLN++FTF A TALAVGIR  SC+N ++   NKI +GS  RC +A
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 QASTVFLYFSFAIFLVKFILSI---VNAITSGAFGTSSNRKT--QVGVPTISQV 169
           +A+ VF YFS  +FL+K ++SI   V     G   +   R+   Q+G+PTISQV
Sbjct: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  122 bits (307), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 98/174 (56%), Gaps = 5/174 (2%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           MLS  DN +R                 I+TQ   SSRVN            DSLY  +AN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           F S+L +P IL++LD LN++FTF AATALAVGIR  SC N ++   NKI + S  RC ++
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSS-----NRKTQVGVPTISQV 169
           QA+  F YFS  +FL+K  ++    I +G FG +S       + Q+GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQLGVPTISQV 174

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  121 bits (304), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 95/153 (62%), Gaps = 13/153 (8%)

Query: 30  TQDHSSSRVNXXXXXXXXXXXXDSLYALIANFISALAWPIILVSLDFLNWVFTFSAATAL 89
           TQ   SSR+N            DS Y ++ANF   L+WP++L +LDFLN+VFT +A   L
Sbjct: 30  TQHGHSSRINYCMFTAAYGITTDSFYGVVANFWEPLSWPLLLGALDFLNFVFTLTAGCVL 89

Query: 90  AVGIRGGSCTNDSFTSGNKIAEGSKDRCRKAQASTVFLYFSFAIFLVKFILSIVNAITSG 149
           AVGIR  SC N ++ + NKI +GS++RCR+AQA+  F +FS AIFL KFI+S+VN  T+G
Sbjct: 90  AVGIRAHSCKNVAYRNKNKIVQGSENRCRQAQAAVAFFFFSMAIFLAKFIMSLVNIFTNG 149

Query: 150 AFGT----------SSNRKTQ---VGVPTISQV 169
            FG+          S  ++TQ    GVP IS V
Sbjct: 150 PFGSAGSSPMGSRFSKRKRTQGVPQGVPNISTV 182

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  119 bits (299), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 80/187 (42%), Positives = 103/187 (55%), Gaps = 18/187 (9%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           MLS+ DN +R                 +AT+   SSRVN            DS Y ++AN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  -FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119
            + +  AWPIIL + DFLN+ FTF+A T L+VGIR  SC N ++   NKI +GS DRCRK
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSS----NRK-------------TQVG 162
           AQAS  F YFSF IF VK ++S +N +++GA G S+     R+              QVG
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 163 VPTISQV 169
           VP ISQV
Sbjct: 181 VPNISQV 187

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  119 bits (299), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 84/186 (45%), Positives = 103/186 (55%), Gaps = 17/186 (9%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIAT-QDHSSSRVNXXXXXXXXXXXXDSLYALIA 59
           ML+I DNSLR                 + T Q H+S+RVN            DS+Y L A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119
           NF   LAWPIIL   DFLN+VF F+A T LAVGIR  +C N+++ + NKI  GS+ RCR 
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGA------FGTSSNRK----------TQVGV 163
           AQA+  F YFS AIFLVK + SI+ AI+ G       FG  S RK          T  GV
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTSTGV 180

Query: 164 PTISQV 169
           PT+S+V
Sbjct: 181 PTVSEV 186

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  115 bits (288), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 83/156 (53%), Gaps = 2/156 (1%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQD-HSSSRVNXXXXXXXXXXXXDSLYALIA 59
           ML + DN  R                 + T+  H SSRVN            DS Y ++A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NFI-SALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCR 118
           N +    A+P IL + DFLN+VFTF+A T LAVGIR  SCTN  +   N I +GS+ RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 KAQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTS 154
           +AQA   F YFS  +FLVK ++++V   T G  G +
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQT 156

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  114 bits (285), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 84/169 (49%), Positives = 99/169 (58%), Gaps = 1/169 (0%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           MLSILDNSLR                 I  Q +S SRVN            DS Y+++AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           FISA AWPII ++LD LN +FTF+AATAL   I   SC+N  F  GN I+E S DRCRK 
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRKTQVGVPTISQV 169
           QAS+ FL+FSF IFL K + S +N I S    +S   K   GVPTISQV
Sbjct: 121 QASSTFLFFSFFIFLAKAVFSGLN-IFSSGAFSSGGSKRGGGVPTISQV 168

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  114 bits (286), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 99/178 (55%), Gaps = 9/178 (5%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDH-SSSRVNXXXXXXXXXXXXDSLYALIA 59
           ML++ DN LR                 I ++ H  +SRVN            DS Y ++A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119
           N     A+P+IL  LDFLN+VFTF+AATALAVGIR  SCTN  +   NKI +GS  RCR+
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGA--------FGTSSNRKTQVGVPTISQV 169
           AQA   F YF+F IFL K ++S ++ +++GA              ++  VGVPTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  112 bits (280), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 99/174 (56%), Gaps = 5/174 (2%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           MLS  DN +R                 + TQ + SSRVN            DS Y  +AN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120
           F S+L +P IL+ LDFLN++FTF+AATALAVGIR  SC N ++   N I +GS  RC ++
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFG--TSSNR---KTQVGVPTISQV 169
           QA+  F YFS  +FL+K  +S+   + +G FG  T   R   + Q+GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  109 bits (273), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 101/183 (55%), Gaps = 14/183 (7%)

Query: 1   MLSILDNSLRGXXXXXXXXXXXXXXXXIATQDHSSSRVNXXXXXXXXXXXXDSLYALIAN 60
           MLS +DN+LR                 ++TQ+H SSRVN            DS + + AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FISALA-WPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119
            I  L+ WPIIL   DFLN+VFTF+A T LAVGIR  SC N  +   NKI +GS  RCR 
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTS---SNRKTQ----------VGVPTI 166
           +QA+  F YF+  +FL K I+S ++  ++GAFG+    S RK +           GVPTI
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSFMSRRKRRSGAGVGGTTGGGVPTI 180

Query: 167 SQV 169
           S+V
Sbjct: 181 SEV 183

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  108 bits (270), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 73/128 (57%), Gaps = 1/128 (0%)

Query: 29  ATQDHSSSRVNXXXXXXXXXXXXDSLYALIANF-ISALAWPIILVSLDFLNWVFTFSAAT 87
           + +   S RVN            DS YA+ ANF  S  AWPI+L S DFLN+ FTF+A T
Sbjct: 30  SEKRPHSPRVNYCMFAAPFALVTDSFYAIPANFWPSPFAWPILLWSFDFLNFTFTFTAGT 89

Query: 88  ALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKAQASTVFLYFSFAIFLVKFILSIVNAIT 147
            L+VGIR  SC N  +   NKI +GS +RCR AQAS  F YFSF I+LV+ + S +    
Sbjct: 90  VLSVGIRTHSCLNKHYLFSNKITQGSTERCRLAQASIAFYYFSFFIYLVQLVKSSLLMWE 149

Query: 148 SGAFGTSS 155
           +G F    
Sbjct: 150 NGLFKPEE 157

>KLLA0A11066g Chr1 (958239..959087) [849 bp, 282 aa] {ON} similar to
           uniprot|P25617 Saccharomyces cerevisiae YCR016W
          Length = 282

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 93  IRGGSCTNDSFTSGNKIAEGSKDRCRKAQASTVFLYFSFAIF 134
           IRGG+   DS ++GNK+A+ SKDR R+  A    L     + 
Sbjct: 49  IRGGNA--DSKSTGNKVAKKSKDRKREKLAKEDRLKKKETVL 88

>YOR186W Chr15 (683111..683545) [435 bp, 144 aa] {ON} Putative
           protein of unknown function; proper regulation of
           expression during heat stress is sphingolipid-dependent
          Length = 144

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 88  ALAVGIRGGSCTNDS---FTSGNKIAEGSKDRCRKAQASTVFLYFSFAIFLVKFILSIVN 144
           ++ +G+ G S   D+   F   N   + + +  R       F +F F +F+   +L I  
Sbjct: 49  SIKLGLMGNSRPEDAASIFQDKNIPHDLTTEEFRLQLVCMAFSWFIFGLFIACLLLCITL 108

Query: 145 AITSGAFGTSSNRKTQVGVPT 165
            +TS   G + N+ T+V VP+
Sbjct: 109 VLTSRYPGENENKATEV-VPS 128

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.133    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,916,606
Number of extensions: 360360
Number of successful extensions: 907
Number of sequences better than 10.0: 44
Number of HSP's gapped: 874
Number of HSP's successfully gapped: 44
Length of query: 169
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 67
Effective length of database: 41,785,467
Effective search space: 2799626289
Effective search space used: 2799626289
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 61 (28.1 bits)