Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D16236g3.492ON87187132010.0
SAKL0F02772g3.492ON7734997652e-88
KLTH0F14828g3.492ON8363255627e-60
Skud_7.4413.492ON8074945324e-56
Kwal_55.212293.492ON7873255314e-56
Suva_7.4183.492ON8314945282e-55
YGR130C3.492ON8164925158e-54
Smik_6.2263.492ON8394945061e-52
NCAS0E008103.492ON6925044542e-46
TDEL0D056003.492ON7003104124e-41
ZYRO0D09988g3.492ON9943894165e-41
CAGL0I10516g3.492ON8135094057e-40
Ecym_12373.492ON7272923672e-35
NDAI0G009403.492ON6564363361e-31
TPHA0D042503.492ON6292802976e-27
Kpol_480.143.492ON6992732951e-26
AFR310C3.492ON6232662726e-24
KNAG0B008103.492ON7572642112e-16
KAFR0C019603.492ON5632641852e-13
KAFR0G036903.492ON3631471296e-07
TBLA0C044803.492ON802961235e-06
KNAG0A079403.492ON2751521126e-05
NCAS0F035503.492ON4411091092e-04
NDAI0B058603.492ON68199820.40
NDAI0D026005.88ON116792771.7
Kwal_26.83802.603ON20575741.9
Ecym_33202.282ON57458752.8
Suva_16.5117.535ON651147743.9
NCAS0G008805.603ON506132734.1
TDEL0B015208.484ON883106744.3
ZYRO0B04730g5.603ON57880735.3
ZYRO0B03982g7.418ON2792218735.4
Smik_14.333.58ON64246725.8
TDEL0A046905.603ON592113726.7
TDEL0A034605.482ON27298707.4
KLTH0D07150g2.542ON54090709.6
KAFR0E043404.364ON6161707010.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D16236g
         (871 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...  1237   0.0  
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   299   2e-88
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   221   7e-60
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   209   4e-56
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   209   4e-56
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   207   2e-55
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   202   8e-54
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   199   1e-52
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   179   2e-46
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   163   4e-41
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   164   5e-41
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   160   7e-40
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...   145   2e-35
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   134   1e-31
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   119   6e-27
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   118   1e-26
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...   109   6e-24
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...    86   2e-16
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    76   2e-13
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    54   6e-07
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    52   5e-06
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    48   6e-05
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    47   2e-04
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    36   0.40 
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    34   1.7  
Kwal_26.8380 s26 complement(760306..760923) [618 bp, 205 aa] {ON...    33   1.9  
Ecym_3320 Chr3 complement(613681..615405) [1725 bp, 574 aa] {ON}...    33   2.8  
Suva_16.511 Chr16 complement(876329..878284) [1956 bp, 651 aa] {...    33   3.9  
NCAS0G00880 Chr7 complement(150292..151812) [1521 bp, 506 aa] {O...    33   4.1  
TDEL0B01520 Chr2 complement(268066..270717) [2652 bp, 883 aa] {O...    33   4.3  
ZYRO0B04730g Chr2 (378912..380648) [1737 bp, 578 aa] {ON} weakly...    33   5.3  
ZYRO0B03982g Chr2 (328985..337363) [8379 bp, 2792 aa] {ON} simil...    33   5.4  
Smik_14.33 Chr14 (50872..52800) [1929 bp, 642 aa] {ON} YNL299W (...    32   5.8  
TDEL0A04690 Chr1 (831207..832985) [1779 bp, 592 aa] {ON} Anc_5.6...    32   6.7  
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    32   7.4  
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    32   9.6  
KAFR0E04340 Chr5 complement(874796..876646) [1851 bp, 616 aa] {O...    32   10.0 

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score = 1237 bits (3201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/871 (76%), Positives = 662/871 (76%)

Query: 1   MVGLNLFRKRNEIDPFAGXXXXXXXXXXXXXXXXXTNSNSILKRVTTKQQQHQEELDDNE 60
           MVGLNLFRKRNEIDPFAG                 TNSNSILKRVTTKQQQHQEELDDNE
Sbjct: 1   MVGLNLFRKRNEIDPFAGLLDDADHAAEQQQQHDLTNSNSILKRVTTKQQQHQEELDDNE 60

Query: 61  YHSPFRTAEETQRARQVRQEKFPTLSQGAVQLDPEQMGYSVVTDKSVKKAKDIIIPSGLK 120
           YHSPFRTAEETQRARQVRQEKFPTLSQGAVQLDPEQMGYSVVTDKSVKKAKDIIIPSGLK
Sbjct: 61  YHSPFRTAEETQRARQVRQEKFPTLSQGAVQLDPEQMGYSVVTDKSVKKAKDIIIPSGLK 120

Query: 121 DTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLTKPQEAIEASDNLDELDEVDPSKEPPIX 180
           DTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLTKPQEAIEASDNLDELDEVDPSKEPPI 
Sbjct: 121 DTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLTKPQEAIEASDNLDELDEVDPSKEPPIE 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVQXXXXXXXXXXXXXXXX 240
                                                    IVQ                
Sbjct: 181 DVAEALEEAEAMAEDDEEEPVDPKREPKPEAALRAFEEAEAIVQDDEEPPVDPEAEPSAA 240

Query: 241 XXXXXXXXXXXXXQGQVPPRVPLAEEEEQENPTGVYKAPEDDANEYVDPSREARPESAVR 300
                        QGQVPPRVPLAEEEEQENPTGVYKAPEDDANEYVDPSREARPESAVR
Sbjct: 241 VAVEALEEAEAIAQGQVPPRVPLAEEEEQENPTGVYKAPEDDANEYVDPSREARPESAVR 300

Query: 301 AFEEAEAIVQDDEEEPVDPKREPKPXXXXXXXXXXXXIVQDNXXXXXXXXXXXXXXXXXX 360
           AFEEAEAIVQDDEEEPVDPKREPKP            IVQDN                  
Sbjct: 301 AFEEAEAIVQDDEEEPVDPKREPKPEAAVRAFEEAEAIVQDNEEPPVDPEAEPSPEEAVE 360

Query: 361 XXXXXXXXXTENPEAISPPPDINSAPRVPFTPSGANKXXXXXXXXXXXXXXLFALFKRSK 420
                    TENPEAISPPPDINSAPRVPFTPSGANK              LFALFKRSK
Sbjct: 361 AFQEAEAIATENPEAISPPPDINSAPRVPFTPSGANKAGTAAATSGIAASGLFALFKRSK 420

Query: 421 KPESSTKVAANAAAGTVVPGDDAPVATPEDPELIVRTQEGYVSKSVYDKLQYDEDQHQAK 480
           KPESSTKVAANAAAGTVVPGDDAPVATPEDPELIVRTQEGYVSKSVYDKLQYDEDQHQAK
Sbjct: 421 KPESSTKVAANAAAGTVVPGDDAPVATPEDPELIVRTQEGYVSKSVYDKLQYDEDQHQAK 480

Query: 481 LALYSKEQDERYETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALL 540
           LALYSKEQDERYETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALL
Sbjct: 481 LALYSKEQDERYETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALL 540

Query: 541 ETNVKHINAKGDLYKQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHE 600
           ETNVKHINAKGDLYKQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHE
Sbjct: 541 ETNVKHINAKGDLYKQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHE 600

Query: 601 SKVEELTAELDNKTSALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIE 660
           SKVEELTAELDNKTSALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIE
Sbjct: 601 SKVEELTAELDNKTSALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIE 660

Query: 661 SIDNKEYLPKVNEINTEISSLLASLGLIQQEIANQKVEFSSVTXXXXXXXXXXXXXXXXX 720
           SIDNKEYLPKVNEINTEISSLLASLGLIQQEIANQKVEFSSVT                 
Sbjct: 661 SIDNKEYLPKVNEINTEISSLLASLGLIQQEIANQKVEFSSVTRRLEEERKQHEEQLLKE 720

Query: 721 XXXXXXXXXXXXXXXXTEYEKQAEEARLKHEEELANLKQTHDXXXXXXXXXXXXXXXXXX 780
                           TEYEKQAEEARLKHEEELANLKQTHD                  
Sbjct: 721 KEERERLEKERLEKQRTEYEKQAEEARLKHEEELANLKQTHDEALKEAQLQREAAAKQLE 780

Query: 781 XXXXXXXXXXXXXXXXXGEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALKSS 840
                            GEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALKSS
Sbjct: 781 EEQQRREQVERERTRLQGEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALKSS 840

Query: 841 NKKTKAAVPPANTTNSSLYDYETVEEVITVD 871
           NKKTKAAVPPANTTNSSLYDYETVEEVITVD
Sbjct: 841 NKKTKAAVPPANTTNSSLYDYETVEEVITVD 871

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  299 bits (765), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 190/499 (38%), Positives = 282/499 (56%), Gaps = 44/499 (8%)

Query: 375 AISPPPDINSAPRVPFTPSGANKXXXXXXXXXXXXXXLFALFKRSKKPESSTKVAANAAA 434
            ++ P D N APRVPF                     +FAL+ RS K             
Sbjct: 316 GLAQPIDPNKAPRVPFKAKTG----------------VFALWTRSDK------------- 346

Query: 435 GTVVPGDDAPVATPEDPELIVRTQEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYET 494
                  D P+ATP+DPE IVRT +GY+SK++YDKL+YDE  HQ +LA ++KEQ ++Y+ 
Sbjct: 347 ------QDQPLATPQDPEYIVRTDKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDA 400

Query: 495 KAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLY 554
             +EY +K+  +Q++I EL A MEQ+RL+ +EK+K+ + E S+ +L+ N  HI++K  ++
Sbjct: 401 TEKEYNDKLTLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIF 460

Query: 555 KQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKT 614
           K+TE IK Q I+++++    H+ V++EI+EL +LK +V  E  E+++K+++LTA+LD+K 
Sbjct: 461 KETENIKTQKIAERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKV 520

Query: 615 SALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEI 674
             + E   K+ E    I  L ++K  +E E ++A+ELH+++   +ESI NKEYLPK+N I
Sbjct: 521 EKIQELNDKQMEITGLIAELNQKKLEIETETRDAEELHKESTGILESIKNKEYLPKINAI 580

Query: 675 NTEISSLLASLGLIQQEIANQKVEFSSVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 734
           ++++++LL SL LI+QE ANQK EF+++T                               
Sbjct: 581 DSQVATLLGSLTLIKQENANQKTEFAAITKRLEEERKAHEEKLRREEEERKRLEEERLQK 640

Query: 735 XXTEYEKQAEEARLKHEEELANLKQTHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 794
              E E +AE+ARLKHEEEL  +K+ H+                                
Sbjct: 641 QREELEAKAEDARLKHEEELRQIKEEHE-------KALNDANVQLAKEKEEREVVEREKT 693

Query: 795 XXXGEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALK-SSNKKTKAAVPPANT 853
              GEKAI+ Q+R    D  L+ E  EK R+QAEA  A E A K S+ KK+  + P  N 
Sbjct: 694 RLAGEKAIQEQERAQEADLALKQELMEKRRKQAEAVDAAEQARKISTQKKSVLSNPSQNL 753

Query: 854 TN-SSLYDYETVEEVITVD 871
           T  SSLYDYETVEE+ITVD
Sbjct: 754 TRESSLYDYETVEEIITVD 772

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 87/151 (57%), Gaps = 14/151 (9%)

Query: 4   LNLFRKRNEIDPFAGXXXXXXXXXXXXXXXXXTNSNSILKRVTTKQQQHQEELDDNEYHS 63
           +++F+K+ ++DPFA                      + L++V T +++ +EE D   Y S
Sbjct: 1   MSIFKKKQQVDPFAHLLQPEQPQEQP----------NFLRKVVTNKKKEEEEKD---YSS 47

Query: 64  PFRTAEETQRARQVRQEKFPTLSQGAVQLDPEQMGYSVVTDKSVKKAKDIIIPSGLKDTE 123
           PFR+ +E   A+ V+ +KFPT+S  +       +GY V+ D + ++AKDI +P  LK+T+
Sbjct: 48  PFRSQQELIAAKNVKAKKFPTVSATSGTASAADLGYKVI-DSAKRRAKDISVPRYLKNTD 106

Query: 124 AEQKVRLTALEKKEKQLRYWRKSQKIVDLTK 154
            +Q+ +L  LE KE  L+Y + SQKIVD+ K
Sbjct: 107 EKQRKKLDKLEFKENHLQYLKDSQKIVDVRK 137

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  221 bits (562), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 125/325 (38%), Positives = 198/325 (60%), Gaps = 37/325 (11%)

Query: 379 PPDINSAPRVPFTPSGANKXXXXXXXXXXXXXXLFALFKRSKKPESSTKVAANAAAGTVV 438
           P DI   PRVPF                     +FAL+ RS K                 
Sbjct: 348 PKDIKETPRVPFATG------------------IFALWTRSDK----------------- 372

Query: 439 PGDDAPVATPEDPELIVRTQEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQE 498
                PVA+P DPE IV+  +GY+SK++YD L+Y+E  H+ ++  Y+KE D +YE KA E
Sbjct: 373 --RGQPVASPNDPEFIVKFDKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANE 430

Query: 499 YEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTE 558
           YE+++ S++++IAEL+A ME ++ +  EK+++ + + S  +++ N +H ++K  ++K+TE
Sbjct: 431 YEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETE 490

Query: 559 EIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSALN 618
            +K   + +KE  E   + V++E++EL  L+ E+  EN+EH+ +V+ELTAELD K +A+ 
Sbjct: 491 NMKAAKVEEKEGVEAKQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQ 550

Query: 619 ESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTEI 678
           E   ++ E  A I  L+++K  L  E   A E H  NV+ +ESI+NKEYLPK+N I+T+I
Sbjct: 551 ELNTQQAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKI 610

Query: 679 SSLLASLGLIQQEIANQKVEFSSVT 703
           S LL SL +++QE AN K EF++V+
Sbjct: 611 SELLTSLTVVKQETANHKTEFAAVS 635

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 69/118 (58%), Gaps = 7/118 (5%)

Query: 40  SILKRVTTKQQQHQEELDDNEYHSPFRTAEETQRARQVRQEKFPTLSQGAVQLDPEQMGY 99
             L +V +K+Q+       + Y+SPFRT++    A++ + +KFPT+S          MGY
Sbjct: 26  GFLHKVVSKEQEQ------SAYNSPFRTSQSLAAAQKRKMQKFPTVSASVSAHSSSDMGY 79

Query: 100 SVVTDKSVKKAKDIIIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLTKPQE 157
            V+ D + ++AKDI +P  L+  +  Q+ RL  LE+KE  L+Y + SQ+IVD+   Q+
Sbjct: 80  KVI-DAARRRAKDIAVPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVDVRGGQD 136

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  209 bits (532), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 160/494 (32%), Positives = 254/494 (51%), Gaps = 36/494 (7%)

Query: 379 PPDINSAPRVPFTPSGANKXXXXXXXXXXXXXXLFALFKRSKKPESSTKVAANAAAGTVV 438
           P D + AP+VPF                     +FAL+K    P SS+        G   
Sbjct: 344 PIDPSKAPKVPF-----------KERPKKERTGIFALWKS---PTSSSA----QKGGVTA 385

Query: 439 PGDDAPVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQ 497
           P +  PVATPE+PELIV+T+E GY+SK+VYDK+ YDE  HQA LA    ++  +Y+  + 
Sbjct: 386 PSN--PVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATST 443

Query: 498 EYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQT 557
            Y E++Q +Q +I E++  M+ +R E  EK+++ +    + +++ N  H N K  ++K T
Sbjct: 444 GYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDT 503

Query: 558 EEIKNQTISDKEDKEVAHQT-VQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSA 616
           E +KNQ + +K D+ +  QT V+SEIDEL   K  V KE  +  + +  L+ +LD +   
Sbjct: 504 ENMKNQKLQEK-DEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFK 562

Query: 617 LNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINT 676
           +N+   K+ +   EI AL+++K  L  + +E ++LH++NV  +ES++NKEYLP++N+I+ 
Sbjct: 563 INQINLKQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDN 622

Query: 677 EISSLLASLGLIQQEIANQKVEFSSVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 736
           ++S+LL  + +I+QE AN+K E S++T                                 
Sbjct: 623 QVSTLLNKMTIIRQENANEKTELSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQR 682

Query: 737 TEYEKQAEEARLKHEEELANLKQTHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 796
            E E+QA +A+L HE+++  +KQT++                                  
Sbjct: 683 QELEEQAHQAQLDHEQQITQVKQTYN-------DQLTELQDKLAAEEKELEAVKRERTRL 735

Query: 797 XGEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVE--NALKSSNKKTKAAVPPANTT 854
            GEKAIE Q R    D+ L+ E   K  +QAE   A E  N   S + K +  VP     
Sbjct: 736 QGEKAIEEQTRQKSSDEALKQEILGKQHKQAEGLHAAEKHNIPNSHSPKNEILVPK---- 791

Query: 855 NSSLYDYETVEEVI 868
           + SLY+Y T E+V+
Sbjct: 792 DDSLYEYHTEEDVM 805

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 55/102 (53%), Gaps = 9/102 (8%)

Query: 60  EYHSPFR--TAEETQRAR----QVRQEKFPTLSQGAV--QLDPEQMGYSVVTDKSVKKAK 111
           E+ SPFR       Q  R      + +KFPT+S  +   +  P+ +GY  +  K+ K+AK
Sbjct: 52  EWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIP-KNAKRAK 110

Query: 112 DIIIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLT 153
           DI  P+ L   E  Q   LT LE KEK L+Y ++ QKI DLT
Sbjct: 111 DIRFPTYLTKNEERQYQLLTELELKEKHLKYLKECQKITDLT 152

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  209 bits (531), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 122/325 (37%), Positives = 191/325 (58%), Gaps = 37/325 (11%)

Query: 379 PPDINSAPRVPFTPSGANKXXXXXXXXXXXXXXLFALFKRSKKPESSTKVAANAAAGTVV 438
           P +I   PRVPF                     +FAL+ RS K                 
Sbjct: 320 PKNIKDTPRVPFATG------------------IFALWTRSDK----------------- 344

Query: 439 PGDDAPVATPEDPELIVRTQEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQE 498
                PVA+P+DPE IV+  +GY+SK++YD L+Y+E  H+ ++  Y+KE  ++Y+ KAQE
Sbjct: 345 --RGQPVASPDDPEFIVKFDKGYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQE 402

Query: 499 YEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTE 558
           YE+ + S++++IAEL+A MEQ++L+  +K+ +   E S  ++E+N KH N K  ++K+TE
Sbjct: 403 YEDHLTSLKSQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETE 462

Query: 559 EIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSALN 618
             K   I +K         V++E +EL   + E    NQE  S+++ELT +LD+K SA+ 
Sbjct: 463 NSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQ 522

Query: 619 ESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTEI 678
           E   ++ E  A I ALE++K  L  +   A ELH  N++ +E I NK+YLPK+N ++++I
Sbjct: 523 ELNDQQAEIQASIDALEQQKDTLVADATAADELHNSNIAILEGISNKDYLPKINALDSQI 582

Query: 679 SSLLASLGLIQQEIANQKVEFSSVT 703
           S LL+SL L++QE ANQ  EF++V+
Sbjct: 583 SQLLSSLALVKQETANQHTEFAAVS 607

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 68/113 (60%), Gaps = 7/113 (6%)

Query: 38  SNSILKRVTTKQQQHQEELDDNEYHSPFRTAEETQRARQVRQEKFPTLSQGAVQLDPEQM 97
           S   L++V TK+Q+      D  Y SPFRT++    A++ + ++FPT+S  +      +M
Sbjct: 23  SKGFLRKVVTKEQE------DATYSSPFRTSQSQVEAQKRKVQRFPTVSASSGGNSSAEM 76

Query: 98  GYSVVTDKSVKKAKDIIIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIV 150
           G+ V+ D + K+AKDI +P  L+  +  Q+ RL  LE+KE  L+Y + SQKIV
Sbjct: 77  GFKVI-DAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIV 128

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  207 bits (528), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 161/494 (32%), Positives = 254/494 (51%), Gaps = 35/494 (7%)

Query: 379 PPDINSAPRVPFTPSGANKXXXXXXXXXXXXXXLFALFKRSKKPESSTKVAANAAAGTVV 438
           P D + AP+VPF                      FAL+K      S T  +A   A T  
Sbjct: 367 PIDPSKAPKVPF-----------QERPQKERTGFFALWK------SPTSSSAKKGAATA- 408

Query: 439 PGDDAPVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQ 497
           P +  PVATPE+PELIV+T+E GY+SK+VYDK+ YDE  HQA L      +  +Y+ K  
Sbjct: 409 PLN--PVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNT 466

Query: 498 EYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQT 557
           EY+EK+Q +Q +I E++  M+Q+R E  +K+++ +    + +++ N +H N K  ++K T
Sbjct: 467 EYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDT 526

Query: 558 EEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSAL 617
           E +K Q + +K +       V+SEIDEL   K  V KE  +  + +  L+ +LD +   +
Sbjct: 527 ENMKKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKI 586

Query: 618 NESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTE 677
           N+   K+ +   EI  LE++K  L  + +E ++LH++NV  +ES++NKEYLP++N+I+T+
Sbjct: 587 NQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQ 646

Query: 678 ISSLLASLGLIQQEIANQKVEFSSVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT 737
           IS+LL  + +I+QE AN++   S++T                                  
Sbjct: 647 ISTLLNQMTIIRQENANERTHLSAITKKLEDERRAHEEQLKLEAEERKRKEENLLEKQRQ 706

Query: 738 EYEKQAEEARLKHEEELANLKQTHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 797
           E E+QA +A L+HEE++  +K+T++                                   
Sbjct: 707 ELEEQAHQAELEHEEQITQVKKTYN-------DQLTELQDKLAAEEEELEAVKRERTKLQ 759

Query: 798 GEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALK--SSN-KKTKAAVPPANTT 854
           GEKAIE Q R    D+ L+    +K  +QA    A EN +   SSN +++K AVP     
Sbjct: 760 GEKAIEEQTRQKNADEILKQTILDKQHKQATGLHAAENRVNTPSSNLQESKRAVP----K 815

Query: 855 NSSLYDYETVEEVI 868
           N SLY+Y T E+V+
Sbjct: 816 NDSLYEYHTEEDVM 829

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 55/102 (53%), Gaps = 9/102 (8%)

Query: 60  EYHSPFR----TAEETQR--ARQVRQEKFPTLSQGA--VQLDPEQMGYSVVTDKSVKKAK 111
           ++ SPFR    +  +  R      +  KFPT+S  +   +  P+ +GY  +  K VK+AK
Sbjct: 50  DWVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIP-KDVKRAK 108

Query: 112 DIIIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLT 153
           DI  P+ L   E  Q   LT LE KEK L+Y +K QKI DLT
Sbjct: 109 DIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQKITDLT 150

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  202 bits (515), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 163/492 (33%), Positives = 260/492 (52%), Gaps = 36/492 (7%)

Query: 381 DINSAPRVPFT-PSGANKXXXXXXXXXXXXXXLFALFKRSKKPESSTKVAANAAAGTVVP 439
           D + AP+VPF  PS   +              +FAL+K    P SS+   +  AA    P
Sbjct: 355 DPSKAPKVPFQEPSRKERTG------------IFALWKS---PTSSSTQKSKTAA----P 395

Query: 440 GDDAPVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLA-LYSKEQDERYETKAQ 497
            +  PVATPE+PELIV+T+E GY+SK+VYDK+ YDE  HQA LA L +KE+D +Y+ K +
Sbjct: 396 SN--PVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKD-KYDAKNK 452

Query: 498 EYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQT 557
           EY+EK+Q +Q +I E++  M+ +R E  EK+++ +    + +++ N +H N K  + K T
Sbjct: 453 EYKEKLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDT 512

Query: 558 EEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSAL 617
           E +KNQ + +K +       V+SEID+L   K  V KE  +  + +  L+ +LD +   +
Sbjct: 513 ENMKNQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKI 572

Query: 618 NESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTE 677
           N+   K+ +   EI  LE++K  L  + +E ++LH++NV  +ES++NKEYLP++N+I+ +
Sbjct: 573 NQINLKQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQ 632

Query: 678 ISSLLASLGLIQQEIANQKVEFSSVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT 737
           ISSLL  + +I+QE AN+K + S++T                                  
Sbjct: 633 ISSLLNEVTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQ 692

Query: 738 EYEKQAEEARLKHEEELANLKQTHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 797
           E E+QA +A+L HE+++  +KQT++                                   
Sbjct: 693 ELEEQAHQAQLDHEQQITQVKQTYN-------DQLTELQDKLATEEKELEAVKRERTRLQ 745

Query: 798 GEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALKSSNKKTK-AAVPPANTTNS 856
            EKAIE Q R    D+ L+ E   +  +QAE   A EN    +++  K  +V P    + 
Sbjct: 746 AEKAIEEQTRQKNADEALKQEILSRQHKQAEGIHAAENHKIPNDRSQKNTSVLPK---DD 802

Query: 857 SLYDYETVEEVI 868
           SLY+Y T E+V+
Sbjct: 803 SLYEYHTEEDVM 814

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 71/158 (44%), Gaps = 15/158 (9%)

Query: 6   LFR-KRNEIDPFAGXXXXXXXXXXXXXXXXXTNSNSILKRVTTKQQQHQEELDDNEYHSP 64
           LF   R E DPF                    +    L++V + + + +EE     + SP
Sbjct: 2   LFNINRQEDDPFTQLINQSSANTQNQQAHQQESPYQFLQKVVSNEPKGKEE-----WVSP 56

Query: 65  FRTAEETQR------ARQVRQEKFPTLSQGAV--QLDPEQMGYSVVTDKSVKKAKDIIIP 116
           FR      R          +  KFPT+S  +   +  P+ +GY  +  K+ K+AKDI  P
Sbjct: 57  FRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIP-KNAKRAKDIRFP 115

Query: 117 SGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLTK 154
           + L   E  Q   LT LE KEK L+Y +K QKI DLTK
Sbjct: 116 TYLTQNEERQYQLLTELELKEKHLKYLKKCQKITDLTK 153

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  199 bits (506), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 156/494 (31%), Positives = 248/494 (50%), Gaps = 36/494 (7%)

Query: 379 PPDINSAPRVPFTPSGANKXXXXXXXXXXXXXXLFALFKRSKKPESSTKVAANAAAGTVV 438
           P D + AP+VPF                     +FAL+K S    +         + T  
Sbjct: 376 PIDPSKAPKVPF-----------QERPRKGKTGIFALWKSSTSSSAQ-------KSNTAA 417

Query: 439 PGDDAPVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQ 497
           P +  PVATPE PELIV+T+E GY+SK+VYDK+ YDE  HQA L      +  +Y+ K +
Sbjct: 418 PSN--PVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNK 475

Query: 498 EYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQT 557
           EYEEK+Q +Q +I E++  M+ +R E  EK+++ +    + +++ N  H N K  ++K T
Sbjct: 476 EYEEKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDT 535

Query: 558 EEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSAL 617
           E +KNQ + +K         V+S+IDEL   K  V K+  +  + +  L+ +LD +   +
Sbjct: 536 ENMKNQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKI 595

Query: 618 NESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTE 677
           N+   K+ +   EI +LE++K  L  + +E ++LH++NV  +ES++N+EYLP++N+I+ +
Sbjct: 596 NQINLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQ 655

Query: 678 ISSLLASLGLIQQEIANQKVEFSSVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT 737
           IS+LL  + +I+QE AN+K + S++T                                  
Sbjct: 656 ISTLLNEMTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQ 715

Query: 738 EYEKQAEEARLKHEEELANLKQTHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 797
           E E+QA +A+L HEE++  +K+T++                                   
Sbjct: 716 ELEEQARQAQLDHEEQITQVKKTYN-------DQLTELQDKLAAEEKELETVKREKTRLQ 768

Query: 798 GEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALKSSN---KKTKAAVPPANTT 854
           GEKAIE Q R    D+ L+ E   K  +QAE   A E   K  N   +K K  VP     
Sbjct: 769 GEKAIEEQTRQRNADEALKQEILSKQHKQAEGLHAAER-YKIPNDHPQKNKNVVPK---- 823

Query: 855 NSSLYDYETVEEVI 868
           + SLY+Y T E+V+
Sbjct: 824 DDSLYEYHTEEDVM 837

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 72/159 (45%), Gaps = 16/159 (10%)

Query: 6   LFR-KRNEIDPFAGXXXXXXXXXXXXXXXXXTNSNSILKRVTTKQQQHQEELDDNEYHSP 64
           LF   R   DPF                    N    L++V + + + +EE     + SP
Sbjct: 2   LFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEE-----WISP 56

Query: 65  FR-----TAEETQR--ARQVRQEKFPTLSQGAV--QLDPEQMGYSVVTDKSVKKAKDIII 115
           FR     + +   R      +  KFPT+S  +   +  P+ +GY  +  K+ K+AKDI  
Sbjct: 57  FRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIP-KNAKRAKDIRF 115

Query: 116 PSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLTK 154
           P+ L   E  Q   LT LE KEK L+Y +K QKI DLTK
Sbjct: 116 PTYLTQNEERQYQLLTELELKEKHLQYLKKCQKITDLTK 154

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  179 bits (454), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 146/504 (28%), Positives = 245/504 (48%), Gaps = 46/504 (9%)

Query: 373 PEAISPPPDINSAPRVPFTPSGANKXXXXXXXXXXXXXXLFALFKRSKKPESSTKVAANA 432
           P  + PP D   AP VPF+ +  N+                    +SKK   + +  +N 
Sbjct: 229 PNVVEPPIDPALAPMVPFSLATPNQ--------------------KSKKETEAPEKPSN- 267

Query: 433 AAGTVVPGDDAPVATPEDPELIVRT-QEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDER 491
                      PVA+P + E IV+T Q GY+SK+VYDK+QYDE QH+  LA Y  +Q+E+
Sbjct: 268 -----------PVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEK 316

Query: 492 YETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKG 551
           YE K QEY++ +Q +  +++EL+  +E+  L+ +EK+ +   +  + + +     IN K 
Sbjct: 317 YEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKM 376

Query: 552 DLYKQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELD 611
            ++ +T++IK + +S+KE+    +  V+  IDEL   K++V  E     + +  + +ELD
Sbjct: 377 KIFNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELD 436

Query: 612 NKTSALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKV 671
            K   +++    +     +I AL  +K  L+ EI + + +H  NV  +ES+DNKEYLPK+
Sbjct: 437 AKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKL 496

Query: 672 NEINTEISSLLASLGLIQQEIANQKVEFSSVTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 731
           N+I+ EI+ LL  + +++QE AN+KV+ + +T                            
Sbjct: 497 NDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERRAHEEQLQLEAEERKRQEENL 556

Query: 732 XXXXXTEYEKQAEEARLKHEEELANLKQTHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 791
                 E E +A   ++ H++E+  LK  ++                             
Sbjct: 557 LGKQRDELEAKANTMQVNHQQEIDALKNDYE-------TKLEEFKNQLKQEQDQLDQVKR 609

Query: 792 XXXXXXGEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVE-----NALKSSNKKTKA 846
                 GEKA++ Q+R    D  L+ E  EK  +QAEA SA +     + L +  ++   
Sbjct: 610 QKTRLEGEKALDEQKRQKDADDVLKNEIFEKQHKQAEAFSAAQLKGRKHPLAALAREITG 669

Query: 847 AVPPANTTNSSLYDYETVEEVITV 870
              P++  N SLYDYET E+V+ V
Sbjct: 670 EAKPSSKDN-SLYDYETEEDVMYV 692

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 73/133 (54%), Gaps = 14/133 (10%)

Query: 38  SNSILKRV-----TTKQQQHQEELDDNE------YHSPFRTAEETQRARQVRQEKFPTLS 86
           ++S L+RV     +T Q+Q ++++  +E      Y SPFR        +  +  +FPT+S
Sbjct: 39  TSSFLQRVVSTTSSTTQKQPKKKIAASEAKAMSDYASPFRAEYSNVNVQNEKTRRFPTVS 98

Query: 87  QGA--VQLDPEQMGYSVVTDKSVKKAKDIIIPSGLKDTEAEQKVRLTALEKKEKQLRYWR 144
             +     +P+Q G++ +  K    AKDI  P+ L + E  Q+  L  LEKKEK L+Y +
Sbjct: 99  ATSNYTLKNPKQKGFTTIK-KGQNFAKDIYFPNYLTENEQRQQAELLILEKKEKDLKYLQ 157

Query: 145 KSQKIVDLTKPQE 157
            SQ I+DLTK QE
Sbjct: 158 DSQNIIDLTKKQE 170

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  163 bits (412), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 103/310 (33%), Positives = 171/310 (55%)

Query: 449 EDPELIVRTQEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQEYEEKIQSIQA 508
           E+PE +V+T++GY++K +YDK+   + QH   +A Y K++ ++++ K  E   KI S++A
Sbjct: 346 ENPEHVVKTKDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRA 405

Query: 509 EIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTEEIKNQTISDK 568
           +I E+  +M Q+R + + K+++ + E ++   E    HI  K  ++K TE IK+Q +S+K
Sbjct: 406 QIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEK 465

Query: 569 EDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSALNESLAKKDETN 628
           +        VQ EIDEL + K++V +E Q+    +EEL+A +D K + L E   K+  T 
Sbjct: 466 DSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNTQ 525

Query: 629 AEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTEISSLLASLGLI 688
            EI  L+++K  +  +I++    H +N   IE   NK YLPK+NE++ +IS LL  L  I
Sbjct: 526 EEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTI 585

Query: 689 QQEIANQKVEFSSVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTEYEKQAEEARL 748
           +Q  AN++ E S++T                                  E E +A+EAR 
Sbjct: 586 RQHCANERTELSAITKKLDKERLEHEEKLKLEAENRRRKEEDLLGKQRKELEAKAQEARE 645

Query: 749 KHEEELANLK 758
           KHE+E+  LK
Sbjct: 646 KHEQEMQKLK 655

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 54/95 (56%), Gaps = 3/95 (3%)

Query: 55  ELDDNEYHSPFRTAEETQRARQVRQEKFPTLSQGAVQLD--PEQMGYSVVTDKSVKKAKD 112
           ++ + +Y SPFR  +E   A++ R ++FPT S  +  ++  PE++GY  +     K+AKD
Sbjct: 34  DVGERDYVSPFRDEQEVLSAQRRRTQRFPTTSAASAYVNARPEELGYKKIG-AGEKRAKD 92

Query: 113 IIIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQ 147
           I  P  L++ E +Q   L  LE KE  LRY +  Q
Sbjct: 93  ISFPVYLEEIEKKQLELLRELEVKEAHLRYLKDCQ 127

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  164 bits (416), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 119/389 (30%), Positives = 203/389 (52%), Gaps = 32/389 (8%)

Query: 377 SPPPDINSAPRVPFTPSGANKXXXXXXXXXXXXXXLFALFKRSKKPESSTKVAANAAAGT 436
           SPP D  + PRV   P    K              +F++F R KK   S   A N     
Sbjct: 448 SPPVDYAAVPRVVTFPEVEKKRS------------IFSIFGRKKK---SQNRAPN----- 487

Query: 437 VVPGDDAPVATPEDPELIVRT-QEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETK 495
                  P+ATPE+PE++V+T +EG++SK+VYDK++Y+  +H   L  +   + +RYE K
Sbjct: 488 -------PLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEK 540

Query: 496 AQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYK 555
             +Y+ +++ ++ E+ +L+  M++++ +  E ++++    S+  LE+  ++I  K  ++ 
Sbjct: 541 QVDYDNRLEELKKEVEKLEESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFH 600

Query: 556 QTEEIKNQTISDKEDKEVAHQT--VQSEIDELLLLKDEVAKENQEHESKVEELTAELDNK 613
           +T+ I++Q   DKE  E+ H+   VQ EI  L   KD + +E     +++ + +A LD K
Sbjct: 601 ETKAIQDQ--KDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAK 658

Query: 614 TSALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNE 673
             +L+    K  +T A+I  L  +KA LE+E+   +E H +N   +E   NKEYLPKV+E
Sbjct: 659 MYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHE 718

Query: 674 INTEISSLLASLGLIQQEIANQKVEFSSVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 733
           I+ +IS+LL  L +I+QE AN+K++  S+T                              
Sbjct: 719 IDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHEEQLKLEAEERERKEKDLLG 778

Query: 734 XXXTEYEKQAEEARLKHEEELANLKQTHD 762
               E+E  A   + +HEEEL  +KQ ++
Sbjct: 779 KQREEHEAVAAGLKKQHEEELRKMKQDYE 807

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 58/97 (59%), Gaps = 3/97 (3%)

Query: 59  NEYHSPFRTAEETQRARQVRQEKFPTLSQGAV--QLDPEQMGYSVVTDKSVKKAKDIIIP 116
            E+ SPFR     + A + R ++FPT+S  +V  ++ P+++GY  +  +  ++AKDI  P
Sbjct: 67  GEFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTM-GRGSRRAKDIQFP 125

Query: 117 SGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLT 153
             L++ EA Q   LT +E +E++L Y + SQ + D T
Sbjct: 126 IYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYT 162

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  160 bits (405), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 142/509 (27%), Positives = 236/509 (46%), Gaps = 71/509 (13%)

Query: 375 AISPPPDINSAPRVPFT--PSGANKXXXXXXXXXXXXXXLFALFKRSKKPESSTKVAANA 432
            +  P   +  PR+P+T  P    K                + FKR            N 
Sbjct: 363 TVETPQPYDKVPRIPYTEQPESGKK--------------FSSFFKR------------ND 396

Query: 433 AAGTVVPGD----------DAPVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKL 481
            AG  V  D          D P+ATPE+PELI +T+E GY+SK +YDK+ YDE  H+  L
Sbjct: 397 NAGHPVITDVPVIPDQSQLDFPIATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWL 456

Query: 482 ALYSKEQDERYETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLE 541
             + K +  +Y+ K +EY  +++ +Q EI  ++  ME ++ E  +K+++ +    + + E
Sbjct: 457 KGFKKSEKAKYDDKMEEYNNELEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFE 516

Query: 542 TNVKHINAKGDLYKQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHES 601
            N  H   K  ++K+TE IKNQ I  K++    H  VQ EI +L   K EV +E  +  +
Sbjct: 517 RNTLHNEQKNKIFKETENIKNQKIQQKKEILDKHAVVQDEITQLNDRKKEVREEFDKWTT 576

Query: 602 KVEELTAELDNKTSALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIES 661
            +  L  +LD K   + +   K+DET  EI+ LE +K   + +I  A++ H++    +ES
Sbjct: 577 NMTTLGQQLDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVES 636

Query: 662 IDNKEYLPKVNEINTEISSLLASLGLIQQEIANQKVEFSSVTXXXXXXXXXXXXXXXXXX 721
            +NKEYLPK++ I+ +IS LL  L +I+QE AN++ E S +T                  
Sbjct: 637 YENKEYLPKIHTIDNQISELLNELAIIKQENANEQTELSKITKELEEERRAHEEKLKLEA 696

Query: 722 XXXXXXXXXXXXXXXTEYEKQAEEARLKHEEELANLKQTHDXXXXXXXXXXXXXXXXXXX 781
                           E E++AE+ + +HEE++  +K+ ++                   
Sbjct: 697 EERERQEKNLLEKQRLELEEKAEQQKREHEEQVRKMKEQYENELNNVKKQKESLET---- 752

Query: 782 XXXXXXXXXXXXXXXXGEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALKSSN 841
                            EK +E   R    ++ ++ E  +K R+QAEA  A +       
Sbjct: 753 -----------------EKLVEEHNR----NENIKKEVLDKQRKQAEAQHAAQT------ 785

Query: 842 KKTKAAVPPANTTNSSLYDYETVEEVITV 870
            K+ A     +  ++SLY+++T EE++ V
Sbjct: 786 -KSIATNAANDMQDNSLYEFKTEEEIMYV 813

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (61%), Gaps = 3/81 (3%)

Query: 75  RQVRQEKFPTLS--QGAVQLDPEQMGYSVVTDKSVKKAKDIIIPSGLKDTEAEQKVRLTA 132
           +  +Q KFPT+S        DP+++G+  + DKS K+AKDI  P  L + E  Q+  L  
Sbjct: 116 KNAKQMKFPTVSATSALANQDPKELGFKTL-DKSTKRAKDIKFPVYLTENEFRQQTILKE 174

Query: 133 LEKKEKQLRYWRKSQKIVDLT 153
           LE KE +L+Y + SQKI+DLT
Sbjct: 175 LELKEGKLQYLKDSQKIIDLT 195

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score =  145 bits (367), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/292 (33%), Positives = 166/292 (56%), Gaps = 22/292 (7%)

Query: 412 LFALFKRSKKPESSTKVAANAAAGTVVPGDDAPVATPEDPELIVRTQEGYVSKSVYDKLQ 471
           +FAL+KRS+KPE                      ATPEDPE IV T++GY+SK++YD+L+
Sbjct: 308 IFALWKRSEKPEKLN-------------------ATPEDPEFIVLTEKGYMSKNIYDRLE 348

Query: 472 YDEDQHQAKLALYSKEQDERYETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLK 531
           Y+E+ HQ KLA   +    +YE  A+ YEEK+ S+  EIAE+ A M+Q++ + E ++K  
Sbjct: 349 YEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAI 408

Query: 532 QVEKSQALLETNVKHINAKGDLYKQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDE 591
           +   SQ L++   KH   K  L K+ E  KN  I++K         V+ E++ L  L+ E
Sbjct: 409 EASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPELEALKRLELE 468

Query: 592 VAKENQEHESKVEELTAELDNKTSALNESLAKKDETNAEIQALEEEKARLEQEIKEAQEL 651
              E Q+++S+V+ LTAELD +   L     ++ E N  + ALEE + ++E++I E+  +
Sbjct: 469 RKVELQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAV 528

Query: 652 HQQNVSKIESIDNKEYLPKVNEINTEISSLLASLGLIQQEIANQKVEFSSVT 703
              N   +++++N    P +  ++ ++S +  ++  ++QE A QK E + ++
Sbjct: 529 VANNKELLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELS 577

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 47/96 (48%), Gaps = 9/96 (9%)

Query: 59  NEYHSPFRTAEETQRARQVRQEKFPTLSQGAVQLDPEQMGYSVVTDKSVKKAKDIIIPSG 118
            EY SPFR  +    A ++R  KFPT    +            V D   +KA+DI  P  
Sbjct: 55  GEYVSPFRDDKAVAEAERIRDLKFPTTGHHSTVR---------VKDNVKRKAQDIAEPRS 105

Query: 119 LKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLTK 154
              T+ +Q+ +L  L  KE QL Y R SQKIVD+ K
Sbjct: 106 FGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDVRK 141

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  134 bits (336), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 132/436 (30%), Positives = 208/436 (47%), Gaps = 16/436 (3%)

Query: 444 PVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQEYEEK 502
           P ATP   E IV+T++ G +SKS+YD+LQYD+ QH+  LA Y  E  E+Y+ K QEYE +
Sbjct: 228 PKATPNSKEEIVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENE 287

Query: 503 IQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTEEIKN 562
           ++S+  +I   +  +EQ + + + KL +   E  + + +      + K  ++ +T+ IK 
Sbjct: 288 LKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKR 347

Query: 563 QTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSALNESLA 622
           + I +K + E     V  EID+L   K++V  E  E    +  +  +LD K   + +   
Sbjct: 348 EKIDEKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINI 407

Query: 623 KKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTEISSLL 682
            +     +I  L  EK  L +EI+  +  H  NV  IE++DNK+YLPK+N I+++I+ LL
Sbjct: 408 TQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLL 467

Query: 683 ASLGLIQQEIANQKVEFSSVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTEYEKQ 742
             L LI+QE AN+K++ S +T                                  E E++
Sbjct: 468 NQLTLIKQENANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQK 527

Query: 743 AEEARLKHEEELANLKQTHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEKAI 802
           A + +L HE E+ NLK +++                                   G KAI
Sbjct: 528 ANDLQLNHETEMTNLKTSYE-------QQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAI 580

Query: 803 EAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALKSSNKK------TKAAVPPA--NTT 854
           E Q R    D  L+ E   K  +QAEA +AV+ A K  N         K +  PA     
Sbjct: 581 EDQDRQKQSDNVLKNEILSKQHQQAEAYNAVQLAQKKKNASPVAEDLMKESHIPALSKAK 640

Query: 855 NSSLYDYETVEEVITV 870
           + SL++YET EE++ V
Sbjct: 641 DDSLFEYETEEEIMYV 656

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 61/114 (53%), Gaps = 8/114 (7%)

Query: 60  EYHSPFRTAEETQRARQVRQEK---FPTLSQGA--VQLDPEQMGYSVV-TDKSVKKAKDI 113
           EY SPFR+   T     ++ EK   FPT+S  +       ++MG+  +  DK+   AKDI
Sbjct: 67  EYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNF--AKDI 124

Query: 114 IIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLTKPQEAIEASDNLDE 167
             PS L   E  Q++ LT L K EK L+Y + SQ I+DLTK     ++   LD+
Sbjct: 125 FFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTKQPSQSQSPSPLDD 178

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  119 bits (297), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 163/280 (58%), Gaps = 9/280 (3%)

Query: 429 AANAAAGTVVPGDDAPVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLALYSKE 487
           A+N   G  VP   A VA+PE+PE +VRT E   VSK+VYD++ Y++  H   L  ++  
Sbjct: 300 ASNMTLGVAVPETHA-VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAA 358

Query: 488 QDERYETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHI 547
           +DE+Y TK QEYE+K+  +Q ++ +++ + +   ++ ++K+++ + +  + +L+   K+ 
Sbjct: 359 EDEKYNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYN 418

Query: 548 NAKGDLYKQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELT 607
             KG + K+TE +K Q I+ KED       V++EI++L   K+ +  E       +E LT
Sbjct: 419 VDKGKVIKETELMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLT 478

Query: 608 AELDNKTS---ALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESID- 663
             LD K +   A+NE+  +      +I+ L+ +K  LE EIK+ +E  + N   ++ ++ 
Sbjct: 479 TLLDEKIAKIEAINENNMR---IQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNV 535

Query: 664 NKEYLPKVNEINTEISSLLASLGLIQQEIANQKVEFSSVT 703
            K+YLP++NEI+ +I++    L +I+ E  ++  + S +T
Sbjct: 536 EKDYLPRLNEIDEQIAAKFDKLAIIKNETISENNQLSILT 575

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 60/101 (59%), Gaps = 6/101 (5%)

Query: 57  DDNEYHSPFRTAEETQR---ARQVRQEKFPTLSQGAV--QLDPEQMGYSVVTDKSVKKAK 111
           ++ EY SPFR  ++T R   A+ ++++KFPT S  +   ++ P +MGYS +  K+ K+AK
Sbjct: 33  ENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLA-KNDKRAK 91

Query: 112 DIIIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDL 152
           DI  P  L D E  Q   L  L+ KE +L   +KS +++ L
Sbjct: 92  DIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVLVL 132

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  118 bits (295), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 159/273 (58%), Gaps = 5/273 (1%)

Query: 424 SSTKVAA---NAAAGTVVPGDDAPVATPEDPELIVRT-QEGYVSKSVYDKLQYDEDQHQA 479
           SST + A     ++  + P    P+++PE+PE +++T Q GY+SK+VYDK+QYD+  HQ 
Sbjct: 333 SSTGIMAIFKGNSSSNIQPVSKNPMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQR 392

Query: 480 KLALYSKEQDERYETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQAL 539
            L      ++E+Y+ K  EYE+ +  IQ++I  +   M++++L+  +K+++ + +  + +
Sbjct: 393 WLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNI 452

Query: 540 LETNVKHINAKGDLYKQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEH 599
           L+    H ++K  ++K+TE +K + ++ K+D       ++ EI+ L   +  V  +  E 
Sbjct: 453 LDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEW 512

Query: 600 ESKVEELTAELDNKTSALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKI 659
            SK+ E+TA+LD K   +     +K +   E+  L   K  LE+EIK+ +E+H+ N   +
Sbjct: 513 NSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKMELEEEIKKNEEIHKNNTELL 572

Query: 660 ESID-NKEYLPKVNEINTEISSLLASLGLIQQE 691
             ++  K YLP++NEI+ EI+  L  L  I++E
Sbjct: 573 TDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKE 605

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 67/120 (55%), Gaps = 15/120 (12%)

Query: 38  SNSILKRVTTKQQQHQEELDDN-EYHSPFRTAEETQ---RARQVRQEKFPTLSQGA--VQ 91
           S+S+LK+V ++        D N EY SPFR     Q    A+  + E+FPT+S  +   +
Sbjct: 22  SHSMLKKVVSR--------DHNVEYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSR 73

Query: 92  LDPEQMGYSVVTDKSVKKAKDIIIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVD 151
           + P ++GY  ++ KS K+AKDI  PS L   E  Q   +T LE KE  L+Y R SQ +++
Sbjct: 74  MSPNELGYKNIS-KSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILLN 132

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score =  109 bits (272), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 81/266 (30%), Positives = 153/266 (57%), Gaps = 14/266 (5%)

Query: 444 PVATPEDPELIVRTQEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQEYEEKI 503
           P  TPE+PE+++ T  GY+SK+VYD+L  +E  H  +L    ++  + Y+  +Q YE++I
Sbjct: 279 PNGTPEEPEVVLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEI 338

Query: 504 QSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGD-----LYKQTE 558
             + AEI++L A +  ++ E E      Q++  +A L  N++ + A+       L++Q E
Sbjct: 339 ADLDAEISKLRADITALQAETE-----GQIDGLEASLSKNIQDMKAENADKQHVLHEQAE 393

Query: 559 EIKNQTISDKEDKEVAHQT--VQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSA 616
             + + ++DKE  E+ HQ   +Q EID L  LK+  A E  E ++++++L  +LD ++  
Sbjct: 394 AQRAEQLADKE--EIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRE 451

Query: 617 LNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINT 676
           L     ++ E +  +  L+E+KA+LE+E+ ++ E  ++N   +E ++  +Y   V EI+ 
Sbjct: 452 LRLVTDQQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDA 511

Query: 677 EISSLLASLGLIQQEIANQKVEFSSV 702
           + S +L  +  I+QEI  Q+ E  ++
Sbjct: 512 KNSEILTEIAKIRQEIEFQRKELVAL 537

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 13/94 (13%)

Query: 59  NEYHSPFRTAEETQRARQVRQEKFPTLSQGAVQLDPEQMGYSVVTDKSVKKAKDIIIPSG 118
           +EY+SPFR A   + A      KFPT               + VT+++ ++  DI  P  
Sbjct: 54  DEYYSPFRDAIAVEEAHGSGTLKFPTTG-------------THVTEEARRRVPDIDEPKR 100

Query: 119 LKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDL 152
           L   +  Q+ +L  LE KE QLR +++SQKIVD+
Sbjct: 101 LSTVDERQRQQLQELELKEGQLRLYKESQKIVDV 134

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 144/264 (54%), Gaps = 5/264 (1%)

Query: 444 PVATPEDPELIVRT-QEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQEYEEK 502
           P AT + PEL+++  + G+VS +V++K+ YD+  H+A++A Y +EQ+ ++  K QEYE+K
Sbjct: 298 PQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQK 357

Query: 503 IQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTEEIKN 562
           +  +      + A+M   +L+   K ++ + +K + L ++N    ++K  +  + + +K 
Sbjct: 358 LAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVKL 417

Query: 563 QTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSALNESLA 622
           Q + D +        +Q E+++L L K    K+     + +  +T  LD +   L++   
Sbjct: 418 QKLQDLKFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNH 477

Query: 623 KKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSK-IESIDNKEYLP--KVNEINTEIS 679
           K+D+   +I+ L + K  LE EI +A +  + N  + +  ++  ++L   ++ ++   I 
Sbjct: 478 KQDKITRQIRDLTQRKTELEAEI-DANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQ 536

Query: 680 SLLASLGLIQQEIANQKVEFSSVT 703
             L SL +++QEI+ ++++   +T
Sbjct: 537 GKLDSLAVVKQEISGERLKLIGIT 560

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 63/103 (61%), Gaps = 8/103 (7%)

Query: 60  EYHSPFRTAEETQRARQV----RQEKFPTLSQGAV--QLDPEQMGYSVVTDKSVKKAKDI 113
           EY SPFR  + T+ +++     R +KFPT+S  ++    +  ++G+S VTD   ++A+DI
Sbjct: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQ-RRARDI 105

Query: 114 IIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLT-KP 155
           + P  L + E  Q++ L  LEK+E+ L + ++ Q ++D T KP
Sbjct: 106 VFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRTCKP 148

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 135/264 (51%), Gaps = 14/264 (5%)

Query: 444 PVATPEDPELIVRTQEGY-VSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQEYEEK 502
           PVA+PE+ E +V+   G  +SK VYDK+++D   +   +  Y  +Q  +      EY EK
Sbjct: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306

Query: 503 IQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTEEIKN 562
           I+SIQ E  +   ++E + LE     ++ Q +  + L+++     + K  + ++T ++K 
Sbjct: 307 IKSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366

Query: 563 QTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSALNESLA 622
           Q +++ +        ++ E + + + KD            + E+  ELD K   L++   
Sbjct: 367 QKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNI 426

Query: 623 KKDETNAEIQALEEEKARLEQEIK--EAQELHQQNVSK-IESIDNKEYLPKVNEINTEIS 679
           + +    EI  L+ +K  L  EI   E ++LH  + SK +E          +NE++ +I+
Sbjct: 427 RNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLE----------LNEMDEQIN 476

Query: 680 SLLASLGLIQQEIANQKVEFSSVT 703
           S L++L LI+QEI N+K++ S +T
Sbjct: 477 SKLSNLNLIKQEIINEKLKISKLT 500

 Score = 38.5 bits (88), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 58/116 (50%), Gaps = 7/116 (6%)

Query: 41  ILKRVTTKQQQHQEELDDNEYHSPFR----TAEETQRARQVRQEKFPTLSQGAVQLDPEQ 96
            L +V T + +  +  D+N+Y+SPFR    + E+ ++ + ++  KFP +S  +      +
Sbjct: 33  FLSKVNTNKSKEND--DENKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYNTDTK 90

Query: 97  MGYSVVTDKSVKKAKDIIIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDL 152
             Y  + D     A+DI  PS L D E  Q   L  L+ K+  L   + S +++D+
Sbjct: 91  DVYKDL-DPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVIDV 145

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 75/147 (51%), Gaps = 20/147 (13%)

Query: 432 AAAGTVVPGDDA-----PVATPEDPE--LIVRTQEG---YVSKSVYDKLQYDEDQHQAKL 481
           +   T VPG+        +ATP++ E  +++R ++G   Y SK V+D +QY+   H  KL
Sbjct: 167 SYVFTKVPGNKKKELKNSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKL 226

Query: 482 ALYSKEQDERYETKAQEYEEKIQSIQAEIAELDAQMEQVR-----LEHEEKLKLKQVEKS 536
              + + DER+ +K  EY+ ++ ++  +I   D + E++R     + H +       + +
Sbjct: 227 KKLNAKGDERHASKINEYDTQVSNLNTKI---DIENEKIRKLNSKISHFK--DFSDFKST 281

Query: 537 QALLETNVKHINAKGDLYKQTEEIKNQ 563
           +  L    ++ N K  LY + E IKNQ
Sbjct: 282 KNYLFKMTEYNNTKTRLYGEIEAIKNQ 308

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 50/96 (52%), Gaps = 6/96 (6%)

Query: 60  EYHSPFR---TAEETQRARQVRQEKFPTLSQGA--VQLDPEQMGYSVVTDKSVKKAKDII 114
           +Y SPFR   T      A + +  ++PT+S  +    + P+ +GY  +   S K+AKDI 
Sbjct: 55  QYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNI-HPSTKRAKDIP 113

Query: 115 IPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIV 150
            P  L + E  Q      L +KE QL Y +KSQK++
Sbjct: 114 FPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLI 149

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 69/139 (49%), Gaps = 23/139 (16%)

Query: 412 LFALFKR-------SKKPESSTKVAANAA---AGTVVPGDDA--PVATPEDPELIVRTQE 459
            F +FKR       S  P +   V +N       T+   ++   P ATP++PEL+V+T+ 
Sbjct: 333 FFTVFKRNSNRDQYSNSPSNQRNVNSNLTNIKTSTLREMNNVINPKATPKNPELLVKTRY 392

Query: 460 G----YVSKSVYDKLQYDEDQHQAKLALY-------SKEQDERYETKAQEYEEKIQSIQA 508
                 +SKSVYD + Y+   H  ++  Y        KE++E +     E + KI+SI+ 
Sbjct: 393 NNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFNNSINELDLKIKSIEK 452

Query: 509 EIAELDAQMEQVRLEHEEK 527
           +I +  A+++ +  ++ EK
Sbjct: 453 DIIDYKAKIDSLMNDNVEK 471

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 71/152 (46%), Gaps = 16/152 (10%)

Query: 444 PVATPEDPELIV------RTQEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQ 497
           PVATPE PE +V       T + Y SK ++D +Q D   H A L     + +++  TK +
Sbjct: 121 PVATPETPEEVVIYKHLNGTNKAY-SKEIFDNIQRDICNHNAWLLSREGKANDQCATKME 179

Query: 498 EYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQT 557
           EY +++  +  +I    A M  +R + +  + L +   ++  L    +    K  +YK+T
Sbjct: 180 EYNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKET 239

Query: 558 EEIKNQTISDKEDK--------EVAHQTVQSE 581
           E + N  I   +DK        + +H TV  E
Sbjct: 240 ERL-NFAIRKHQDKNRQGILPDDASHDTVTVE 270

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 2/66 (3%)

Query: 92  LDPEQMGYSVVTDKSVKKAKDIIIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVD 151
           L PE++GY     K  K A++I  P+ L + E  Q+  L  L++KE+ L + +KSQ++V 
Sbjct: 25  LKPEELGYKQKFPK--KYAREIHFPAELTENEMRQRAILQDLDEKEQHLDHLKKSQRVVY 82

Query: 152 LTKPQE 157
           + KP E
Sbjct: 83  IDKPVE 88

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 59/109 (54%), Gaps = 6/109 (5%)

Query: 435 GTVVPGDDAPVATPEDPELIVR---TQEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDER 491
           G   P    P+ATP++PE++V+    Q   VSK  YD+L   + +H A L  Y+ E    
Sbjct: 171 GMNPPSPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMAN 230

Query: 492 YETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALL 540
           Y  + Q Y+++I  +  +I     +M  V LE  + L++ ++ K++AL+
Sbjct: 231 YNQRHQWYQKQIDVLDEKIRYYQ-EMSNV-LE-ADYLRVSEINKNKALV 276

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 36.2 bits (82), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 47/99 (47%), Gaps = 7/99 (7%)

Query: 444 PVATPEDPELIVRTQE--GYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQEYEE 501
           P+AT  +PE++++  +    ++K  YDKL      H   +   + E    Y TK + Y+E
Sbjct: 384 PIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQE 443

Query: 502 KIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALL 540
           K+  +  +I   +  +  ++     K  LK  E + A+L
Sbjct: 444 KLNKLNEQINHHNLIISMIK-----KDTLKNKELNDAIL 477

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
            Anc_5.88 YGR238C
          Length = 1167

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 17/92 (18%)

Query: 554  YKQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNK 613
            +KQ   +KNQ + D    EVA                 +  +N  H+S V++L+  LD+ 
Sbjct: 965  WKQMTIMKNQKLDDGMKSEVA-----------------IEDDNGHHKSVVDKLSNRLDDL 1007

Query: 614  TSALNESLAKKDETNAEIQALEEEKARLEQEI 645
             +   E    KD+ + E Q+LE + + L QE+
Sbjct: 1008 IAKSQEMSESKDKLSKEYQSLELKHSTLSQEL 1039

>Kwal_26.8380 s26 complement(760306..760923) [618 bp, 205 aa] {ON}
           YKL065C (YET1) - Yeast endoplasmic reticulum 25 kDa
           transmembrane protein [contig 59] FULL
          Length = 205

 Score = 33.1 bits (74), Expect = 1.9,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 587 LLKDEVAKENQEHES-KVEELTAELDNKTSALNESLAKKDETNAEIQALEEEKARLEQEI 645
           L+K E    ++E +S K  E++AE D++ S L + L   +E  A I+AL ++KA LE   
Sbjct: 131 LVKYETLIRDKESKSIKQSEVSAEADDEVSKLQKVL---NEKKASIKALRKQKANLEAHF 187

Query: 646 KEAQELHQQNVSKIE 660
            ++ +  +   SK++
Sbjct: 188 DKSVKAQKIADSKLK 202

>Ecym_3320 Chr3 complement(613681..615405) [1725 bp, 574 aa] {ON}
           similar to Ashbya gossypii ADL219C
          Length = 574

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 481 LALYSKEQDERYETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQA 538
           LAL SK       T  +EY   +Q     I E + ++EQ+++EHEE LK  +VEK  A
Sbjct: 461 LALRSK-----LPTNFEEYCTNVQKNIGTIEEFNNKLEQLQVEHEEHLKEIEVEKQHA 513

>Suva_16.511 Chr16 complement(876329..878284) [1956 bp, 651 aa] {ON}
           YPR179C (REAL)
          Length = 651

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 81/147 (55%), Gaps = 13/147 (8%)

Query: 529 KLKQVEKSQALLETNVKHINAKGDLYKQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLL 588
           KL Q+E  +  +E   KH+  +G+ + + EE+  +TI+ +++ E   +  +S+  E   +
Sbjct: 491 KLSQIETLEKDIEFLKKHLATQGERFAKLEELFIKTINLQDEIEREERINKSKDTEREYM 550

Query: 589 KDEV------AKENQEHESKVEELTAELDNKTSALNESLAKKDETNAEIQALEEEKARLE 642
           + E+       +EN E  SK+ +   EL+N+   LN  L    +T A  + L E+ A L+
Sbjct: 551 EQEIKRAADAIRENDEETSKIGDKRRELENE---LNSKLG---DTEAIKEELREKVALLK 604

Query: 643 QEIKEAQELHQQNVSKI-ESIDNKEYL 668
           +EIK   +L+++ V ++ +++DN E L
Sbjct: 605 REIKLENDLNRELVGQLSKTMDNLENL 631

>NCAS0G00880 Chr7 complement(150292..151812) [1521 bp, 506 aa] {ON}
           Anc_5.603 YOR023C
          Length = 506

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 17/132 (12%)

Query: 416 FKRSKKPESSTKVAANAAAGTVVPGDDAPVATPEDP-ELIVRTQEGYVSKSVYDKLQYDE 474
           FK++     S  + +N+     + G    VATP+ P E  +   +  + +S  DKL    
Sbjct: 46  FKKANGSLKSKYMDSNSTTNQNITGY-YQVATPKSPQEFTLSPVDDNIRESFTDKLGIAV 104

Query: 475 DQHQAKLALYSKEQDERYETKAQEYEEK-----------IQSIQAEIAELDAQMEQVRLE 523
           +  +  + L    Q  RYET   E  +K           ++ IQ +I + DAQM  + L 
Sbjct: 105 ESPEDNVQL----QRLRYETAKNEILDKLNLHILINHKEVEDIQRDIKKTDAQMRVIELL 160

Query: 524 HEEKLKLKQVEK 535
           HE+K  + +++K
Sbjct: 161 HEDKELMSKIKK 172

>TDEL0B01520 Chr2 complement(268066..270717) [2652 bp, 883 aa] {ON}
           Anc_8.484 YDR251W
          Length = 883

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 55/106 (51%), Gaps = 11/106 (10%)

Query: 554 YKQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNK 613
           Y++  E K++  +  ED++     ++   DE + LKDEVA   +  + K E LT++L N+
Sbjct: 364 YQKLNEGKSKWFTRIEDQQDVKSKLKLMADEKIRLKDEVANLQKSLQDK-EALTSQLQNE 422

Query: 614 TSALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKI 659
           + A     +KK     ++Q L+ +     QEI    + H+ ++ K+
Sbjct: 423 SQA-----SKK-----QVQVLQNQLGSFRQEIANLTKRHEIDIQKM 458

>ZYRO0B04730g Chr2 (378912..380648) [1737 bp, 578 aa] {ON} weakly
           similar to uniprot|Q12433 Saccharomyces cerevisiae
           YOR023C AHC1 Ada Histone acetyltransferase complex
           component protein of the Ada histone acetyltransferase
           complex
          Length = 578

 Score = 32.7 bits (73), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 18/80 (22%)

Query: 473 DEDQHQAK---LALYSKEQDE----RYETKAQEYEEK-----------IQSIQAEIAELD 514
           DED+       LA  S+E +E    +YET   E  EK           +Q IQ EI  LD
Sbjct: 96  DEDRSSGGTSGLAKSSRESEEVERLKYETAKAEILEKLHLHTLIGNKEVQGIQREICRLD 155

Query: 515 AQMEQVRLEHEEKLKLKQVE 534
           AQM+ ++  H+++  L ++E
Sbjct: 156 AQMKLMKTLHDDENLLDKIE 175

>ZYRO0B03982g Chr2 (328985..337363) [8379 bp, 2792 aa] {ON} similar to
            uniprot|P38110 Saccharomyces cerevisiae YBL088C TEL1
            Protein kinase primarily involved in telomere length
            regulation contributes to cell cycle checkpoint control
            in response to DNA damage functionally redundant with
            Mec1p homolog of human ataxia telangiectasia (ATM) gene
          Length = 2792

 Score = 32.7 bits (73), Expect = 5.4,   Method: Composition-based stats.
 Identities = 43/218 (19%), Positives = 103/218 (47%), Gaps = 26/218 (11%)

Query: 470  LQYDEDQHQAKLALYSKEQDERYETKAQEYEEKIQSIQAEIAELDAQMEQVRL------E 523
            L+  +D  QA L  ++ E   R ET +  +E+ I++ +A++ + D + +   +      +
Sbjct: 2095 LEVPDDYIQAMLVKWTSES--RLETASVIFEKYIRNFEAKVKDHDMRAKMFYILGNFLND 2152

Query: 524  HEEKLKL-KQVEKSQALLETNVKHINAKGDLYKQTEEIKNQTISDKEDKEVAHQTVQSEI 582
              ++L+  +++E+ Q   +  V   NA   +YK +    N + ++++D +  +  V+ ++
Sbjct: 2153 QAQRLQASREIEERQRRCDRQVNESNALEMIYKNS----NLSENERKDAKRHYLKVRMQL 2208

Query: 583  DELLLLKDEVAKENQEHESKVEELTAELDNKTSALNESLAKKDETNAEIQALEEEKARLE 642
            +  + L D +  +  +  SK             AL+  L     TN     + ++   L 
Sbjct: 2209 ENDMELLDSLKSQRMQFVSK-------------ALHYYLNTLVFTNKFDDDVLDKFCGLW 2255

Query: 643  QEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTEISS 680
             E     +++   + +I S+ + ++LP VN+I +++S+
Sbjct: 2256 FEYDGVDDVNSLLLKEIGSVPSWKFLPWVNQIASKLST 2293

>Smik_14.33 Chr14 (50872..52800) [1929 bp, 642 aa] {ON} YNL299W
           (REAL)
          Length = 642

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 591 EVAKENQEHESKVEELTAELDNKTSALNESLAKKDETNAEIQALEE 636
           EV  +N+ H +K E L  ++D+  +  N  L K D+ + EI  +EE
Sbjct: 37  EVFNDNRSHFNKYESLAIDVDDDGTLGNFVLMKNDKVDVEIPVIEE 82

>TDEL0A04690 Chr1 (831207..832985) [1779 bp, 592 aa] {ON} Anc_5.603
           YOR023C
          Length = 592

 Score = 32.3 bits (72), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 58/113 (51%), Gaps = 23/113 (20%)

Query: 445 VATPEDP-ELIVRTQEGYVSK---SVYD---KLQYDEDQHQ----AKLALYSKEQDE-RY 492
           VATP+ P ELI+  Q+  ++    + +D   +  +D D+ Q     +LA  S+E +  +Y
Sbjct: 51  VATPKSPHELILDDQDVDLASQRDNFHDPNSRHGHDGDKRQDSLMGRLAGESEETERLKY 110

Query: 493 ETKAQEYEEKI-----------QSIQAEIAELDAQMEQVRLEHEEKLKLKQVE 534
           ET   E  EK+           Q IQ EI  +DAQM  +R  H+++   K+VE
Sbjct: 111 ETAKTEILEKLHLQTLISHKEAQGIQREIKRVDAQMTLLRKLHDDQELQKKVE 163

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 42/98 (42%), Gaps = 6/98 (6%)

Query: 517 MEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTEEIKNQTISDKEDKEVAHQ 576
           +E ++L+    LK K VE     L TN KH    G L K  + IK  T+    D  +A  
Sbjct: 119 VEHLKLQVRMNLKTKSVE-----LRTNPKHTTDPGALQKGADFIKAFTLGFDLDDSIALL 173

Query: 577 TVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKT 614
            +     E   +KD V   N +H S+     A  D KT
Sbjct: 174 RLDDLYIETFEIKD-VKTLNGDHLSRAIGRIAGKDGKT 210

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 49/90 (54%), Gaps = 14/90 (15%)

Query: 488 QDERYETKAQEYE------EKIQSIQAEIAELDAQMEQVRLEHEEKLK--LKQVEKSQAL 539
           Q E YE+K ++ E      + + S+Q +I EL  Q    R + E K+    KQ+E+ + L
Sbjct: 408 QREYYESKLRQLEINEEELKSVHSLQQQIQELKLQAVVTRSKSEHKVNEMRKQLEEERLL 467

Query: 540 ---LETNVKHI-NAKGDLYKQTEE--IKNQ 563
              L+ N+ H+ N  GDL KQ E+  I+NQ
Sbjct: 468 SRALQKNLDHLSNTIGDLQKQQEQSVIENQ 497

>KAFR0E04340 Chr5 complement(874796..876646) [1851 bp, 616 aa] {ON}
           Anc_4.364 YJR134C
          Length = 616

 Score = 31.6 bits (70), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 81/170 (47%), Gaps = 25/170 (14%)

Query: 483 LYSKEQDER-YETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLE 541
           L  +E+D +  ETK +  E  I+ + A I  L+A  +Q + +HEEK+K         L+E
Sbjct: 194 LTKREEDWKNIETKLESKERTIEELNATIQALEASSKQEKNDHEEKVK--------RLIE 245

Query: 542 TNVKHINAKGDLYKQTEEIKNQ------TISDKEDKEVAHQTVQSEIDELLLLKDEVAKE 595
           +N +HI +   L    E+++ Q      T  DKE   +  ++         LL++++   
Sbjct: 246 SNNEHIIS---LESSLEQLRIQLSGSESTADDKEGGAINTESYS-------LLQEQLTSS 295

Query: 596 NQEHESKVEELTAELDNKTSALNESLAKKDETNAEIQALEEEKARLEQEI 645
            +  ES   +L  ++ N  ++L E        N EIQ L+ E +RL  EI
Sbjct: 296 KKNWESIEFQLNLKMTNLETSLGEKEKLITGLNTEIQNLKVENSRLVTEI 345

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.303    0.123    0.319 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,553,038
Number of extensions: 2736693
Number of successful extensions: 28835
Number of sequences better than 10.0: 2478
Number of HSP's gapped: 25595
Number of HSP's successfully gapped: 4244
Length of query: 871
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 753
Effective length of database: 39,950,811
Effective search space: 30082960683
Effective search space used: 30082960683
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.8 bits)
S2: 70 (31.6 bits)