Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D16214g7.196ON41841822090.0
SAKL0F07502g7.196ON41239718140.0
Kwal_55.203687.196ON41238917560.0
Kpol_1063.97.196ON41740117460.0
Ecym_43807.196ON41841817420.0
TDEL0H025107.196ON41839517380.0
KLTH0E04554g7.196ON47940817320.0
CAGL0J02442g7.196ON41239817100.0
Suva_9.1777.196ON43538617080.0
Smik_9.1687.196ON43138617020.0
Skud_9.1477.196ON43138616870.0
YIL022W (TIM44)7.196ON43138616700.0
ADL118C7.196ON41840216600.0
TPHA0C045307.196ON41638416400.0
KNAG0H026907.196ON41940616340.0
NCAS0A125207.196ON43238516250.0
NDAI0B017807.196ON43438416220.0
ZYRO0D15840g7.196ON40740816180.0
KAFR0A026407.196ON42138615360.0
TBLA0J015007.196ON42142513340.0
Ecym_26828.806ON33086703.7
Ecym_20615.88ON1362135704.6
TPHA0B027707.216ON48092694.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D16214g
         (418 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]...   855   0.0  
SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {...   703   0.0  
Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022...   681   0.0  
Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON} (26537.....   677   0.0  
Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar t...   675   0.0  
TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.1...   674   0.0  
KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} simila...   671   0.0  
CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa] ...   663   0.0  
Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W ...   662   0.0  
Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W ...   660   0.0  
Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W ...   654   0.0  
YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}  TIM44Essen...   647   0.0  
ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON} S...   644   0.0  
TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {O...   636   0.0  
KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.1...   634   0.0  
NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa] ...   630   0.0  
NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {O...   629   0.0  
ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]...   627   0.0  
KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.1...   596   0.0  
TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7....   518   0.0  
Ecym_2682 Chr2 complement(1319324..1320316) [993 bp, 330 aa] {ON...    32   3.7  
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    32   4.6  
TPHA0B02770 Chr2 (631381..632823) [1443 bp, 480 aa] {ON} Anc_7.2...    31   4.9  

>KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 418

 Score =  855 bits (2209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/418 (100%), Positives = 418/418 (100%)

Query: 1   MLRINGQQAMMHKAVARASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIK 60
           MLRINGQQAMMHKAVARASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIK
Sbjct: 1   MLRINGQQAMMHKAVARASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIK 60

Query: 61  ALQDASGKLGESEAYKKAREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTR 120
           ALQDASGKLGESEAYKKAREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTR
Sbjct: 61  ALQDASGKLGESEAYKKAREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTR 120

Query: 121 KVVNKTADKLDESFEPVRKTKVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKR 180
           KVVNKTADKLDESFEPVRKTKVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKR
Sbjct: 121 KVVNKTADKLDESFEPVRKTKVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKR 180

Query: 181 SRAVKSNDAAGTALVATNIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVM 240
           SRAVKSNDAAGTALVATNIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVM
Sbjct: 181 SRAVKSNDAAGTALVATNIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVM 240

Query: 241 LRTVSGKIGGLFAETESARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVL 300
           LRTVSGKIGGLFAETESARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVL
Sbjct: 241 LRTVSGKIGGLFAETESARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVL 300

Query: 301 KQWFSEAPYNVYAAQQKQFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQE 360
           KQWFSEAPYNVYAAQQKQFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQE
Sbjct: 301 KQWFSEAPYNVYAAQQKQFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQE 360

Query: 361 IHLYRKAKTGEIAAGAESSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418
           IHLYRKAKTGEIAAGAESSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT
Sbjct: 361 IHLYRKAKTGEIAAGAESSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418

>SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {ON}
           highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 412

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/397 (84%), Positives = 366/397 (92%)

Query: 22  RTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREA 81
           RT + + +     RSPLQIFRETFKQEWEKSKELQDNIK LQDASGKLGES+AYKKAREA
Sbjct: 16  RTISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYKKAREA 75

Query: 82  YVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTK 141
           Y++AQKGSTIVGKTLKKTGETVE IA KAW+SE+ K+TRK +N TA K+DESFEPVR+TK
Sbjct: 76  YLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFEPVRQTK 135

Query: 142 VYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIES 201
           VYKDVSEVIDDG+SSRYGGFITKEQRRL KE+ +ASGKR +AVKSND AGTALVATNIE+
Sbjct: 136 VYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALVATNIEA 195

Query: 202 KESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVY 261
           KESF KKIEDFKEKTP GRK+HE K++LWDESENPL+V+LRT+  K+GG+FAETESARV 
Sbjct: 196 KESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAETESARVM 255

Query: 262 GQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFRE 321
           GQFKM+DP FNTE FTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQK FR+
Sbjct: 256 GQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKAFRD 315

Query: 322 QELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSIL 381
           QELFADG+ILDIRGVEIVSAKLL PQDIPVLVVGCRAQEIHLYRKAKTGEIAAG ES+IL
Sbjct: 316 QELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGTESNIL 375

Query: 382 MSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418
           +SSYAMVFTRDPE VDDKETEGW+ILEFVRGGSRQFT
Sbjct: 376 LSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412

>Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022W
           (TIM44) - 48.8 kDa protein involved in mitochondrial
           protein import [contig 149] FULL
          Length = 412

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/389 (83%), Positives = 359/389 (92%)

Query: 30  AMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREAYVKAQKGS 89
              NPRSPLQIFRETFKQEW+KS+ELQDNIKALQDASGKLGES+AYKKAREAY+KAQKGS
Sbjct: 24  CQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESDAYKKAREAYLKAQKGS 83

Query: 90  TIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTKVYKDVSEV 149
           TIVGKT+KKTG++VE IA+KAW+SEI+KSTRK VNKTA KLDESFEPVR T+VYKDVSEV
Sbjct: 84  TIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDESFEPVRHTRVYKDVSEV 143

Query: 150 IDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIESKESFGKKI 209
           ++ G+SSRYGGFITKEQRRL  E+ IASGKR +AV+SND AGTALVATNIE+KESFGKK+
Sbjct: 144 MESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTALVATNIEAKESFGKKV 203

Query: 210 EDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVYGQFKMMDP 269
           +DFKEKT VGRKLH++K+KLWDESENPL+V+LRT+  KIGGLFAETESARV GQFKMMD 
Sbjct: 204 DDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFAETESARVMGQFKMMDG 263

Query: 270 TFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQELFADGK 329
            FN+E F  HLREYIIPE+LEAYVKGDE VLKQWFSEAPYNVYAAQQK FREQ LFADG+
Sbjct: 264 NFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYAAQQKVFREQGLFADGR 323

Query: 330 ILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSILMSSYAMVF 389
           ILDIRGV+IVSAKLL PQD+PVLVVGCRAQEIHLYR  KTGE+AAG +S+ILMSSYAMVF
Sbjct: 324 ILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNILMSSYAMVF 383

Query: 390 TRDPETVDDKETEGWKILEFVRGGSRQFT 418
           TRDPE +D+KETEGWKILEFVRGGSRQFT
Sbjct: 384 TRDPEDIDNKETEGWKILEFVRGGSRQFT 412

>Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON}
           (26537..27790) [1254 nt, 418 aa]
          Length = 417

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/401 (79%), Positives = 361/401 (90%)

Query: 18  ASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKK 77
           + ++  F+ S++ +  PR+P+QIFR+TFK+EWEKSK+LQDNIKALQDASG+LGESEAYKK
Sbjct: 17  SGSIHLFSTSSRVLQGPRTPIQIFRDTFKKEWEKSKDLQDNIKALQDASGRLGESEAYKK 76

Query: 78  AREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPV 137
           AREAY+KAQKGSTIVGKTL+KTGETVE IASKAWDSEI KSTRK  + TA K+DESFEPV
Sbjct: 77  AREAYLKAQKGSTIVGKTLQKTGETVEDIASKAWDSEIGKSTRKAASATARKIDESFEPV 136

Query: 138 RKTKVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVAT 197
           RKT+VYKDVS+VIDDGDSSRYGGFI KEQRRL +E  + SGKR RAVKSND AGT++VAT
Sbjct: 137 RKTQVYKDVSDVIDDGDSSRYGGFIGKEQRRLKRESDLVSGKRVRAVKSNDEAGTSIVAT 196

Query: 198 NIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETES 257
           NIE+KES GKK+EDFKE T  GR +H  K+KLWDE+ENPL+V LR VSGKIGG FAETES
Sbjct: 197 NIEAKESLGKKMEDFKENTTAGRTIHGVKVKLWDENENPLIVFLRKVSGKIGGFFAETES 256

Query: 258 ARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQK 317
           +RV  QFK+MDPTF+ + FTKHLREYIIPE+LEAYVKGDEAVLK+WFSEAPYNVYAAQQK
Sbjct: 257 SRVLSQFKLMDPTFSNDSFTKHLREYIIPEVLEAYVKGDEAVLKKWFSEAPYNVYAAQQK 316

Query: 318 QFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAE 377
           +FR+Q+LF DG+ILDIRGVEIVSAKLL PQDIPVLVVGCRAQEIHLYRK KTGEIAAG E
Sbjct: 317 EFRKQQLFPDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKVKTGEIAAGDE 376

Query: 378 SSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418
           S+ILMSSYAMVFTRDPE +DD ETEGWKILEFVRGGSRQFT
Sbjct: 377 SNILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 417

>Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar to
           Ashbya gossypii ADL118C
          Length = 418

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/418 (75%), Positives = 367/418 (87%)

Query: 1   MLRINGQQAMMHKAVARASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIK 60
           ML+    +      +A+A   R F+ +  + +  +SPLQIFRETFK EW+KS+ELQDNIK
Sbjct: 1   MLKYAAIKQSRMSGIAKAVPARQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIK 60

Query: 61  ALQDASGKLGESEAYKKAREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTR 120
           ALQDASG+LGES+AYKKAREAY+KAQ+GST+VGKTLKKTGET+E +  KAWDS+I K+TR
Sbjct: 61  ALQDASGRLGESDAYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTR 120

Query: 121 KVVNKTADKLDESFEPVRKTKVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKR 180
           +VV+KTA KLDESFEPVR T+VYKD+SE+IDDG+SSRYGGFI KE RR  +E  +ASG+R
Sbjct: 121 EVVSKTAQKLDESFEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRR 180

Query: 181 SRAVKSNDAAGTALVATNIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVM 240
           + AV+SND AGTA+VATN E KESFGKKI+DFKEKT +GRKLHE K+KLWDE+ENPL+ M
Sbjct: 181 THAVRSNDEAGTAMVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISM 240

Query: 241 LRTVSGKIGGLFAETESARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVL 300
           LRT+S KIGGLFAETESARV+ QFK++DPTFN+E+FTKHLREYIIPE+LEAYVKGDE VL
Sbjct: 241 LRTISNKIGGLFAETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVL 300

Query: 301 KQWFSEAPYNVYAAQQKQFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQE 360
           KQW SEAPYNVYAAQQKQFREQELF DG++LDIRGVEIVSAKLLPPQD+P LVVGCR QE
Sbjct: 301 KQWLSEAPYNVYAAQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQE 360

Query: 361 IHLYRKAKTGEIAAGAESSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418
           IHLYRKAKTGEIAAG ES+I+MSSYAMV TRDPE V DKETEGWK+LEF+RGGSRQFT
Sbjct: 361 IHLYRKAKTGEIAAGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418

>TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.196
           YIL022W
          Length = 418

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/395 (79%), Positives = 362/395 (91%)

Query: 24  FTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREAYV 83
           F+ S+ ++ NPRSP+QIFR+TFK+EW+KS+ELQDNIK LQDASG+LGESEAYK+AREAYV
Sbjct: 24  FSTSSGSLQNPRSPVQIFRDTFKKEWKKSQELQDNIKTLQDASGRLGESEAYKRAREAYV 83

Query: 84  KAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTKVY 143
           +AQKGSTIVGKTLKKTGETVE IASKAWDSEIA++TR+  +KTA K+DE FEPVR+TK+Y
Sbjct: 84  RAQKGSTIVGKTLKKTGETVENIASKAWDSEIARNTREAASKTAKKIDEGFEPVRQTKIY 143

Query: 144 KDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIESKE 203
           KDVSEV+DDG+SSRYGGFITKEQRRL +E+ + SGKR++AVK N+ AGTALVAT+IE+K+
Sbjct: 144 KDVSEVMDDGNSSRYGGFITKEQRRLKREQDMLSGKRAKAVKGNEDAGTALVATDIEAKQ 203

Query: 204 SFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVYGQ 263
           SFGKK+EDFKEKT +GR LH  K  LWDES NPL+V LR ++ KIGG FAETE+ARV GQ
Sbjct: 204 SFGKKVEDFKEKTVLGRTLHRLKNSLWDESVNPLIVFLRKITRKIGGFFAETEAARVLGQ 263

Query: 264 FKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQE 323
           FKMMDPTF  E FT+HLREY+IPEILEAYVKGDE VLK+WFSEAPYNVYAAQQK FREQ+
Sbjct: 264 FKMMDPTFTNESFTRHLREYVIPEILEAYVKGDEKVLKKWFSEAPYNVYAAQQKAFREQQ 323

Query: 324 LFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSILMS 383
           LFADGKILDIRGVEIVSAK+LPPQDIPVLVVGCRAQEIHLYRKAKTGE+AAG ES+I+MS
Sbjct: 324 LFADGKILDIRGVEIVSAKMLPPQDIPVLVVGCRAQEIHLYRKAKTGEVAAGHESNIMMS 383

Query: 384 SYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418
           SYAMVFTRDPE +DD+ETEGW+ILEFVRGGSRQFT
Sbjct: 384 SYAMVFTRDPEQIDDEETEGWRILEFVRGGSRQFT 418

>KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} similar
           to uniprot|Q01852 Saccharomyces cerevisiae YIL022W TIM44
           48.8 kDa protein involved in mitochondrial protein
           import
          Length = 479

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/408 (78%), Positives = 360/408 (88%), Gaps = 3/408 (0%)

Query: 11  MHKAVARASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLG 70
           +   V R +  +TF        NPRSPLQIFRETFKQEW+KS+ELQDNIKALQDASGK+G
Sbjct: 75  LKSVVIRRNLAQTFKA---CQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIG 131

Query: 71  ESEAYKKAREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKL 130
           ESEAYKKAREAY+ AQKGSTIVGKTLKKTG++VE IA+KAW+SEI KSTR+ VNKTA KL
Sbjct: 132 ESEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKL 191

Query: 131 DESFEPVRKTKVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAA 190
           DESFEPVR T+VYKDVSEV+D  +SSRYGGFI+KEQRRL  E+ IASGKR +AVKSN+ A
Sbjct: 192 DESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEA 251

Query: 191 GTALVATNIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGG 250
           GTALVAT IE+KESFGKK++DFKEKT VGRKL + K KLWDESENPL+V++RT+  K+GG
Sbjct: 252 GTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGG 311

Query: 251 LFAETESARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYN 310
           LFAETESARV GQFKMMD  FN+E F  HLREYIIPE+LEAYVKG+E VLKQWFSEAPYN
Sbjct: 312 LFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYN 371

Query: 311 VYAAQQKQFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTG 370
           VYAAQQK FREQ LFADG+ILDIRGV+IVSAKLLPPQD+PVLVVGCRAQEIHLYR  KTG
Sbjct: 372 VYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLPPQDLPVLVVGCRAQEIHLYRDVKTG 431

Query: 371 EIAAGAESSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418
           E+AAG +S+ILMSSYAMVFTRDPE +DDKETEGWKILEFVRGGSRQFT
Sbjct: 432 EVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479

>CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022w TIM44
          Length = 412

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/398 (80%), Positives = 356/398 (89%), Gaps = 1/398 (0%)

Query: 22  RTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREA 81
           R F   +  +SNPRSPLQIFRETFK+EWEKS+ELQDNIK LQDASG+LGESEAYKKAREA
Sbjct: 15  RCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAYKKAREA 74

Query: 82  YVKAQKGS-TIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKT 140
           Y+KA KGS TIVGKTL+KTGETVE +A+KAWDS+IAK+TR V +KTA KLDESFEPVR+T
Sbjct: 75  YLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESFEPVRQT 134

Query: 141 KVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIE 200
           K+YKDVSEVIDDGDSS YGGFITKEQRRL +E+ +ASGKR RAVKSND AG+ALVAT+IE
Sbjct: 135 KIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSALVATDIE 194

Query: 201 SKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARV 260
           +KES GKKIEDFKEKTPVGR L   K+ LWDESENPL+V LR ++GKIGG FAETESARV
Sbjct: 195 AKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAETESARV 254

Query: 261 YGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFR 320
           Y QFKM+DPTF    FTKHLR+YI+PE+LEAYVKGDE VLK+WFSEAP+NVY AQQK F+
Sbjct: 255 YKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQQKIFK 314

Query: 321 EQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSI 380
           +QELF+DGKILDIRGVE+VSAKLL PQDIPVLVVGCRAQEIHLYRKAKTGEIAAG ES+I
Sbjct: 315 KQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGDESNI 374

Query: 381 LMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418
           LMSSYAMVFTRDPE +DD ETEGWKILEF+RG SR F 
Sbjct: 375 LMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN 412

>Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W
           (REAL)
          Length = 435

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/386 (80%), Positives = 356/386 (92%)

Query: 33  NPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREAYVKAQKGSTIV 92
           NPRSPLQIFR+TFK+EW+KS+ELQ+NIK LQDASGKLGESEAYKKAREAY++AQ+GSTIV
Sbjct: 50  NPRSPLQIFRDTFKKEWDKSQELQENIKTLQDASGKLGESEAYKKAREAYLRAQRGSTIV 109

Query: 93  GKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTKVYKDVSEVIDD 152
           GKTLKKTGETVE IA++AWDSE+ K+TRK  + TA KLDESFEPVR+TK+YK+VSEVIDD
Sbjct: 110 GKTLKKTGETVEHIATRAWDSELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVIDD 169

Query: 153 GDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIESKESFGKKIEDF 212
           G+SSRYGGFITKEQRRL +E+ +ASGKR RAVKSND AGTA+VATNIESKESFGKK+EDF
Sbjct: 170 GESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDF 229

Query: 213 KEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVYGQFKMMDPTFN 272
           KEKT VGR +   K +LWDESENPL+V++R V+ K+GG FAETES+RVY QFKMMDPTF+
Sbjct: 230 KEKTAVGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGFFAETESSRVYSQFKMMDPTFS 289

Query: 273 TEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQELFADGKILD 332
            E+FT+HLREYI+PEILEAYVKGD  VLK+WFSEAP+NVYAAQQK F+EQ++FADG+ILD
Sbjct: 290 NENFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVFADGRILD 349

Query: 333 IRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSILMSSYAMVFTRD 392
           IRGVEIVSAKLL PQDIPVLVVGCRAQEI+LYRK KTGEIAAG E++ILMSSYAMVFTRD
Sbjct: 350 IRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGEIAAGDEANILMSSYAMVFTRD 409

Query: 393 PETVDDKETEGWKILEFVRGGSRQFT 418
           PE +DD ETEGWKILEFVRGGSRQFT
Sbjct: 410 PEQIDDDETEGWKILEFVRGGSRQFT 435

>Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/386 (80%), Positives = 355/386 (91%)

Query: 33  NPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREAYVKAQKGSTIV 92
           NPRSPLQIFR+TFK+EWEKS+ELQ+NIK LQDASGKLGESEAYKKAREAY+KAQ+GSTIV
Sbjct: 46  NPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIV 105

Query: 93  GKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTKVYKDVSEVIDD 152
           GKTLKKTGET+E IA+KAW+SE+ K+TRK  + TA KLDESFEPVR+TK+YK+VSEVIDD
Sbjct: 106 GKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESFEPVRQTKIYKEVSEVIDD 165

Query: 153 GDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIESKESFGKKIEDF 212
           G+SSRYGGFITKEQRRL +E+ +ASGKR RAVKSND AGTA+VATNIESKESFGKK+EDF
Sbjct: 166 GESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDF 225

Query: 213 KEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVYGQFKMMDPTFN 272
           KEKT VGR +   K KLWDESENPL+V++R ++ K+GG FAETES+RVY QFKMMDPTF+
Sbjct: 226 KEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKMMDPTFS 285

Query: 273 TEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQELFADGKILD 332
            E FT+HLREYI+PEILEAYVKGD  VLK+WFSEAP+NVYAAQQK F+EQ+++ADG+ILD
Sbjct: 286 NESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILD 345

Query: 333 IRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSILMSSYAMVFTRD 392
           IRGVE+VSAKLL PQDIPVLVVGCRAQEI+LYRK KTGEIAAG E++ILMSSYAMVFTRD
Sbjct: 346 IRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRD 405

Query: 393 PETVDDKETEGWKILEFVRGGSRQFT 418
           PE +DD ETEGWKILEFVRGGSRQFT
Sbjct: 406 PEQIDDDETEGWKILEFVRGGSRQFT 431

>Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/386 (79%), Positives = 354/386 (91%)

Query: 33  NPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREAYVKAQKGSTIV 92
           NPRSPLQIFR+TFK+EWEKS+ELQ+NIK LQDASGKLGESEAYKKAREAY++AQ+GSTIV
Sbjct: 46  NPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLRAQRGSTIV 105

Query: 93  GKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTKVYKDVSEVIDD 152
           GKTLKKTGET+E IA+KAW+SE+ K+TRK  + TA +LDESFEPVR+TK+YK+VSEVIDD
Sbjct: 106 GKTLKKTGETMEHIATKAWESELGKNTRKAASATAKRLDESFEPVRQTKIYKEVSEVIDD 165

Query: 153 GDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIESKESFGKKIEDF 212
           G+SSRYGGFITKEQRRL +E+ +ASGKR RAVKSND AGTA+VATNIESKESFGKK+EDF
Sbjct: 166 GESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDF 225

Query: 213 KEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVYGQFKMMDPTFN 272
           +EKT +GR +   K +LWDESENPL+V++R V+ K+GG FAETES+RV+ QFK+MDPTF+
Sbjct: 226 REKTAMGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGFFAETESSRVHSQFKLMDPTFS 285

Query: 273 TEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQELFADGKILD 332
            E FT+HLR+YI+PEILEAYVK D  VLK+WFSEAPYNVYAAQQK FREQ+++ADG+ILD
Sbjct: 286 NESFTRHLRDYIVPEILEAYVKADVKVLKKWFSEAPYNVYAAQQKIFREQDVYADGRILD 345

Query: 333 IRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSILMSSYAMVFTRD 392
           IRGVEIVSAKLL PQDIPVLVVGCRAQEI+LYRK KTGEIAAG E++ILMSSYAMVFTRD
Sbjct: 346 IRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGEIAAGNEANILMSSYAMVFTRD 405

Query: 393 PETVDDKETEGWKILEFVRGGSRQFT 418
           PE +DD ETEGWKILEFVRGGSRQFT
Sbjct: 406 PEQIDDDETEGWKILEFVRGGSRQFT 431

>YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}
           TIM44Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); tethers the
           import motor and regulatory factors (PAM complex) to the
           translocation channel (Tim23p-Tim17p core complex)
          Length = 431

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/386 (80%), Positives = 353/386 (91%)

Query: 33  NPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREAYVKAQKGSTIV 92
           NPRSPLQIFR+TFK+EWEKS+ELQ+NIK LQDASGKLGESEAYKKAREAY+KAQ+GSTIV
Sbjct: 46  NPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIV 105

Query: 93  GKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTKVYKDVSEVIDD 152
           GKTLKKTGET+E IA+KAW+SE+ K+TRK    TA KLDESFEPVR+TK+YK+VSEVIDD
Sbjct: 106 GKTLKKTGETMEHIATKAWESELGKNTRKAAAATAKKLDESFEPVRQTKIYKEVSEVIDD 165

Query: 153 GDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIESKESFGKKIEDF 212
           G+SSRYGGFITKEQRRL +E  +ASGKR RAVKSN+ AGTA+VATNIESKESFGKK+EDF
Sbjct: 166 GESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESFGKKVEDF 225

Query: 213 KEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVYGQFKMMDPTFN 272
           KEKT VGR +   K KLWDESENPL+V++R ++ K+GG FAETES+RVY QFK+MDPTF+
Sbjct: 226 KEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFS 285

Query: 273 TEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQELFADGKILD 332
            E FT+HLREYI+PEILEAYVKGD  VLK+WFSEAP+NVYAAQQK F+EQ+++ADG+ILD
Sbjct: 286 NESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILD 345

Query: 333 IRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSILMSSYAMVFTRD 392
           IRGVEIVSAKLL PQDIPVLVVGCRAQEI+LYRK KTGEIAAG E++ILMSSYAMVFTRD
Sbjct: 346 IRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRD 405

Query: 393 PETVDDKETEGWKILEFVRGGSRQFT 418
           PE +DD ETEGWKILEFVRGGSRQFT
Sbjct: 406 PEQIDDDETEGWKILEFVRGGSRQFT 431

>ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL022W
           (TIM44)
          Length = 418

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/402 (76%), Positives = 361/402 (89%)

Query: 17  RASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYK 76
           R    R F+ +  A + P+SPLQ+FRETFK+EW+KS+ELQDNIKALQDA G+LGES+AYK
Sbjct: 17  RVLAARGFSATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYK 76

Query: 77  KAREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEP 136
           KAREAY+KAQKGSTIVGKTLK+TGET+E I  +AW+SEI K+TRK V+KTA KLDESFEP
Sbjct: 77  KAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEP 136

Query: 137 VRKTKVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVA 196
           VR+TKVYKD+SE+IDDG+SSRYGGF+ KE+RR  +E  +A+GKR+  V+SN+ AG+ALVA
Sbjct: 137 VRQTKVYKDMSEIIDDGESSRYGGFMEKERRREKRERDLATGKRATPVRSNEEAGSALVA 196

Query: 197 TNIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETE 256
           T+ E+ ES GKKI+DFKEKT VGRKLHE K++LWDE+ENPL+ +LRT+S K+GGLFAETE
Sbjct: 197 TDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETE 256

Query: 257 SARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQ 316
           SARV+ QFK++DPTFNTE+FTKHLREYIIPE+LEAYVKGDE VLKQWFSEAPYNVY+AQQ
Sbjct: 257 SARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQ 316

Query: 317 KQFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGA 376
           KQ R+QELFADG+ILDIRGVEI+SAKLLPPQD+P +VVGCRAQEIHL+RKA TGEIAAG 
Sbjct: 317 KQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGH 376

Query: 377 ESSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418
           ES+I++SSYAMV TRDPE VDDKETEGWKILEFVRGGSR FT
Sbjct: 377 ESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418

>TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {ON}
           Anc_7.196 YIL022W
          Length = 416

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/384 (77%), Positives = 348/384 (90%)

Query: 35  RSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREAYVKAQKGSTIVGK 94
           ++P+QIFRETFK+EWEKS+ELQDNIK LQDASG+LG+SEAYKKA+EAYVKAQ+ STIV K
Sbjct: 33  KTPIQIFRETFKKEWEKSQELQDNIKTLQDASGRLGQSEAYKKAKEAYVKAQQSSTIVSK 92

Query: 95  TLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTKVYKDVSEVIDDGD 154
           TLKKTGETVE +A K WDSEI KSTRKVV++ A K+DESFEPVR+T+VYK+VSEVIDDG+
Sbjct: 93  TLKKTGETVEDLAKKTWDSEIGKSTRKVVSQGAKKIDESFEPVRQTQVYKEVSEVIDDGE 152

Query: 155 SSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIESKESFGKKIEDFKE 214
           SSRYGGFI+KEQRR  +E  +ASGKR RA KSN+ AGTA+VATN+ESKESFGKKI+DFKE
Sbjct: 153 SSRYGGFISKEQRRKKREADLASGKRVRATKSNEEAGTAIVATNVESKESFGKKIDDFKE 212

Query: 215 KTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVYGQFKMMDPTFNTE 274
           KT VG+ +  +K+++WDE+ENPL+V+LRT+S KI G FAETES+RVY QFK+MDPTF+  
Sbjct: 213 KTVVGKTMKSFKVRVWDENENPLIVVLRTISNKISGFFAETESSRVYSQFKLMDPTFSNA 272

Query: 275 DFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQELFADGKILDIR 334
            FTKHLR+YIIPE+LEAYVKGDE VLK+WFSEAP+NVYAAQQK+ R+Q+LF DG+ILDIR
Sbjct: 273 AFTKHLRDYIIPEVLEAYVKGDEVVLKKWFSEAPFNVYAAQQKELRKQQLFTDGRILDIR 332

Query: 335 GVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSILMSSYAMVFTRDPE 394
           GV+IVSAKLL PQDIPVLVVGCRAQE+HLYRK KTGE+ AG ES+I+MSSYAMVFTRDP+
Sbjct: 333 GVDIVSAKLLAPQDIPVLVVGCRAQELHLYRKVKTGELGAGDESNIMMSSYAMVFTRDPD 392

Query: 395 TVDDKETEGWKILEFVRGGSRQFT 418
            +DD ETEGWKILEFVRGGSRQFT
Sbjct: 393 NIDDDETEGWKILEFVRGGSRQFT 416

>KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.196
           YIL022W
          Length = 419

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/406 (76%), Positives = 357/406 (87%), Gaps = 1/406 (0%)

Query: 13  KAVARASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGES 72
           + VARA  + T  V      +PRSPL IFR+TFK+EWEKS+ELQ+NI+ LQDASGK+GE+
Sbjct: 15  RVVARAP-LHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGET 73

Query: 73  EAYKKAREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDE 132
           EAY+KAREA+++AQKGSTIVGKTLKKTGETVE IASKAWDSEIAK++RK   KTA KLDE
Sbjct: 74  EAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDE 133

Query: 133 SFEPVRKTKVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGT 192
            FEPVR+T++YKDVSEVIDDGDS+ YGGF T+E+R+  +E+A+ASG+R RAVKSND AGT
Sbjct: 134 GFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTREERQRRREKALASGERVRAVKSNDEAGT 193

Query: 193 ALVATNIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLF 252
           ALVAT +ESKES GKK+EDFKEKT VGR LH  K +LWDESENPL+V +R VSGK+G  F
Sbjct: 194 ALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFF 253

Query: 253 AETESARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVY 312
           AETES RVY QFK+MDP FN+  FTKHLREY++PEILEAYV+GDE VLK+WFSEAPYNVY
Sbjct: 254 AETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVY 313

Query: 313 AAQQKQFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEI 372
           AAQQK F+E+ LFADG+ILDIRGVEIVSAKLL PQD+PVLVVGCRAQEI+LY+K KTGEI
Sbjct: 314 AAQQKMFKEKALFADGRILDIRGVEIVSAKLLQPQDLPVLVVGCRAQEINLYKKVKTGEI 373

Query: 373 AAGAESSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418
           AAG+ES+ILMSSYAMVFTRDPE V D+ETEGWKILEFVRGGSRQFT
Sbjct: 374 AAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419

>NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa]
           {ON} Anc_7.196 YIL022W
          Length = 432

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/385 (77%), Positives = 345/385 (89%), Gaps = 1/385 (0%)

Query: 35  RSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREAYVKAQKGS-TIVG 93
           R+P+QIFR+TFK+EW+KS+ELQ+NIKAL DASGKL ESE +K A++AY+KA KGS TI+ 
Sbjct: 48  RTPIQIFRDTFKKEWDKSQELQENIKALHDASGKLSESETFKMAKDAYLKAHKGSSTILS 107

Query: 94  KTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTKVYKDVSEVIDDG 153
           KT++KTGETVE +ASKAWDSEIAKSTR+   KTAD LD+SFEPVRKT+VYKD+SEVIDDG
Sbjct: 108 KTMQKTGETVENMASKAWDSEIAKSTREAAKKTADTLDKSFEPVRKTQVYKDISEVIDDG 167

Query: 154 DSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIESKESFGKKIEDFK 213
           DSSRYGGFITKE+RRL +E  +ASGKR RA+KSN+ AGTALVAT+IE+K+SFGKK+EDFK
Sbjct: 168 DSSRYGGFITKEERRLKRESDLASGKRQRAIKSNEEAGTALVATDIEAKQSFGKKVEDFK 227

Query: 214 EKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVYGQFKMMDPTFNT 273
           EKT VG+ +   K+KLWDESENPL+V LR ++ KIGG F ETESARVY QFKMMD TF  
Sbjct: 228 EKTVVGKTMSSVKVKLWDESENPLIVFLRKITNKIGGFFDETESARVYTQFKMMDATFTN 287

Query: 274 EDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQELFADGKILDI 333
           E FT+HLREYI+PE+LEAY+KGDE VLK+WFSEAP+NVY+AQQK FREQ LF+DG+ILDI
Sbjct: 288 EGFTRHLREYIVPELLEAYIKGDEKVLKKWFSEAPFNVYSAQQKVFREQGLFSDGRILDI 347

Query: 334 RGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSILMSSYAMVFTRDP 393
           RGVEIVSAKLL PQDIPVLVVGCRAQEI+LYRK KTGEIAAG +S+ILMSSYAMVFTRDP
Sbjct: 348 RGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKVKTGEIAAGDQSNILMSSYAMVFTRDP 407

Query: 394 ETVDDKETEGWKILEFVRGGSRQFT 418
           E +DD ETEGWKILEFVRGGSRQFT
Sbjct: 408 EQIDDDETEGWKILEFVRGGSRQFT 432

>NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {ON}
           Anc_7.196 YIL022W
          Length = 434

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/384 (77%), Positives = 342/384 (89%)

Query: 35  RSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREAYVKAQKGSTIVGK 94
           R+P+QIFR+TFK+EWEKS+ELQDNIKAL DASGKL ESE +K A++AY+KA KGSTIV K
Sbjct: 51  RTPIQIFRDTFKKEWEKSQELQDNIKALHDASGKLSESETFKMAKDAYLKAHKGSTIVSK 110

Query: 95  TLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTKVYKDVSEVIDDGD 154
           TLKKTGETVET+ASKAWDSEI K+TR    KTA+ +D+SFEPVRKT++YKDVSEVIDDGD
Sbjct: 111 TLKKTGETVETMASKAWDSEIGKNTRIAAKKTAETIDKSFEPVRKTQIYKDVSEVIDDGD 170

Query: 155 SSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIESKESFGKKIEDFKE 214
           SSRYGGFITKE+R+L +E  +ASGKR RAVKSND AGTALVATNIE+KESFGKK+EDFKE
Sbjct: 171 SSRYGGFITKEERKLKRERDLASGKRQRAVKSNDEAGTALVATNIEAKESFGKKVEDFKE 230

Query: 215 KTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVYGQFKMMDPTFNTE 274
           KT VG+ +   K+KLWDESENPL+V LR +S KI G F ETESA+VY QFK+MD TF  +
Sbjct: 231 KTVVGKTMKTVKMKLWDESENPLIVTLRKISNKISGFFDETESAKVYTQFKLMDTTFTND 290

Query: 275 DFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQELFADGKILDIR 334
            FT+HLR+YI+PEILEAY+KGDE VLK+WFSEAP+NVYAAQQK FREQ LF+DG+ILDIR
Sbjct: 291 GFTRHLRDYIVPEILEAYIKGDEKVLKKWFSEAPFNVYAAQQKVFREQGLFSDGRILDIR 350

Query: 335 GVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSILMSSYAMVFTRDPE 394
           GVEIVSAKLL PQDIPVLVVGCRAQEI+LY+KAK+GEIAAG ES+I+MSSYAMVFTRDPE
Sbjct: 351 GVEIVSAKLLAPQDIPVLVVGCRAQEINLYKKAKSGEIAAGDESNIVMSSYAMVFTRDPE 410

Query: 395 TVDDKETEGWKILEFVRGGSRQFT 418
            +DD ETEGWKILEFVRGGSR F 
Sbjct: 411 QIDDDETEGWKILEFVRGGSRPFN 434

>ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 407

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/408 (70%), Positives = 360/408 (88%), Gaps = 1/408 (0%)

Query: 11  MHKAVARASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLG 70
           M+K +    +V  F+ S++++   RSPLQIFR+TFK+EWEKS+ELQ+NIK LQDASG+LG
Sbjct: 1   MYKGIVTQRSVALFSTSSRSLQG-RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLG 59

Query: 71  ESEAYKKAREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKL 130
           +SE  K+AREAY++AQKGSTIVGKTL+KTGETVE IASKAW+SEIAKSTR   + TA KL
Sbjct: 60  DSEGVKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIAKSTRSAASATAKKL 119

Query: 131 DESFEPVRKTKVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAA 190
           D+SFEPVR TK+YKDVSEV++D D+SRYGGF+TKEQR++ +E  IASGKR+RA++SN+ A
Sbjct: 120 DKSFEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEA 179

Query: 191 GTALVATNIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGG 250
           GTALVATNIE+KES GKK+EDF+EKT +GR + + K++LW+E+ENPL+V+LR ++ K+GG
Sbjct: 180 GTALVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGG 239

Query: 251 LFAETESARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYN 310
            FAETE+A+V GQFK++DP+F +E FT+ LR+Y+IPE+LEAY KGDE  LK+WFSEAP+N
Sbjct: 240 FFAETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFN 299

Query: 311 VYAAQQKQFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTG 370
           VYAAQQK FR+Q+LFAD +ILDIRGV+IVSAKLLPPQDIPVL+VGCRAQEI LYR  K+G
Sbjct: 300 VYAAQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSG 359

Query: 371 EIAAGAESSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418
           E+AAG ES+ILMSSYAMVFTRDPE V+D+ETEGW+I+EFVRGGSRQFT
Sbjct: 360 EVAAGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407

>KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/386 (73%), Positives = 334/386 (86%), Gaps = 2/386 (0%)

Query: 35  RSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREAYVKAQKGS-TIVG 93
           R+PLQIFRETFK+EWEKS ELQ +IK LQDASGK+ ESEAYKKAR+AY+KA +GS TI+ 
Sbjct: 36  RTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAYLKAHRGSSTILD 95

Query: 94  KTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTKVYKDVSEVI-DD 152
           KTLKKTG+T+E IA+KAW+SEI+K+TR++ ++TA KLDESFEPVR TK+YKDVSEV+ DD
Sbjct: 96  KTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTKIYKDVSEVLNDD 155

Query: 153 GDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIESKESFGKKIEDF 212
           GDS RYGGFI K++RRL +E A+ SGKR RAVKSND AGTALVATN++S ES G+K E+F
Sbjct: 156 GDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQSHESIGQKYENF 215

Query: 213 KEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVYGQFKMMDPTFN 272
           KE+T VG+ LH +K+  WDESENPL+V+LR ++ KI G F ETES+RVY QFK++D TFN
Sbjct: 216 KERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRVYSQFKLIDQTFN 275

Query: 273 TEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQELFADGKILD 332
            E FT+HLREYI+PEILEAY+KGDE VLK WFSEAP+NVY+AQQK FR+Q LF DG ILD
Sbjct: 276 AESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQQNLFPDGNILD 335

Query: 333 IRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSILMSSYAMVFTRD 392
           IR VEIVSAKLL PQDIPVLVV CRAQEI++YRK KTGE+AAG  S ILMS+YAMVFTRD
Sbjct: 336 IRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDILMSTYAMVFTRD 395

Query: 393 PETVDDKETEGWKILEFVRGGSRQFT 418
           PE +D+ ETEGW+ILEFVRG SRQFT
Sbjct: 396 PEEIDNDETEGWRILEFVRGNSRQFT 421

>TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  518 bits (1334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/425 (57%), Positives = 327/425 (76%), Gaps = 11/425 (2%)

Query: 1   MLRING--QQAMMHKAVARASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDN 58
           MLR     Q+  +H +    S+  ++ V  ++  + ++P+QIFRETFKQEWEKS  LQD 
Sbjct: 1   MLRSRSLIQRNALHPSKLLISSFHSYPVVLQSNDSNKTPIQIFRETFKQEWEKSATLQDQ 60

Query: 59  IKALQDASGKLGESEAYKKAREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKS 118
           IK L DAS ++ +S+A+KKA++AY      +TI+ KT+ KTG  +   A KAWDS++A+ 
Sbjct: 61  IKTLTDASDRINQSDAFKKAKDAYKNVSNQTTILSKTISKTGTKLNDAALKAWDSDLAQK 120

Query: 119 TRKVVNKTADKLDESFEPVRKTKVYKDVSEVIDDGDSS-RYGGFITKEQRRLMKEEAIAS 177
           T+      A KLD+SFEPVR TK+YKDVSEVIDD D+S +YGGFI+KE+RR  +   + +
Sbjct: 121 TKLA----AKKLDDSFEPVRNTKIYKDVSEVIDDKDNSYKYGGFISKEERRSKRISDLQT 176

Query: 178 GKRSRAVKSNDAAGTALVATNIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPL 237
           GKR + +KSND AGTAL+AT+++SKES  +K+ DFKEKT VG+ +   K K+WDE++NPL
Sbjct: 177 GKRMKPIKSNDEAGTALIATDLKSKESINEKLNDFKEKTVVGQTMTSIKTKVWDENDNPL 236

Query: 238 VVMLRTVSGKIGGLFAETESARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDE 297
           +V +R V+G     FAETES+RV  QFK++DP FN E F + LREYIIPE+LEAY+KGDE
Sbjct: 237 IVGMRKVTGVFNRFFAETESSRVLTQFKLIDPNFNNESFLRSLREYIIPEVLEAYIKGDE 296

Query: 298 AVLKQWFSEAPYNVYAAQQKQFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCR 357
            +LK WFSEAPYNVY+AQQK+ R+Q++F+DG++LDIRGV+IV+AK+LPPQDIPV+VV CR
Sbjct: 297 KILKNWFSEAPYNVYSAQQKELRKQKIFSDGRVLDIRGVDIVTAKMLPPQDIPVIVVSCR 356

Query: 358 AQEIHLYRK----AKTGEIAAGAESSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGG 413
           AQEI++Y+K     +T +I AG +S+ILMS+YAMVFTRDPE +D+ ETEGWKILEFVRGG
Sbjct: 357 AQEINIYKKFNVEKQTNDIVAGHDSNILMSTYAMVFTRDPEQLDNDETEGWKILEFVRGG 416

Query: 414 SRQFT 418
           SR+FT
Sbjct: 417 SRKFT 421

>Ecym_2682 Chr2 complement(1319324..1320316) [993 bp, 330 aa] {ON}
           similar to Ashbya gossypii AGL215W
          Length = 330

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 11/86 (12%)

Query: 174 AIASGKRSRAVKSNDAAGTAL------VATNIESKESFGKKIED---FKEKTPVGRKLHE 224
            +   KRSR + + DAAG  +      V   +  K S  K I++      +T  GRK   
Sbjct: 121 PVWPAKRSRPLSTKDAAGLNIQEVKRIVEFRVLEKLSMHKMIKEQFGVPLRTNYGRKPQS 180

Query: 225 YKIKLWDESENPLV--VMLRTVSGKI 248
            + ++W E E+P +  +++R  S ++
Sbjct: 181 DQFQVWCEDEDPCIKGIVMRPSSSRL 206

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 51/135 (37%), Gaps = 11/135 (8%)

Query: 22  RTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREA 81
            + + S     NPRSPL    E    E         N  ++  + G    ++      E 
Sbjct: 645 HSISSSGGTQQNPRSPLTAVSENSDDEV--------NFSSITYSQGHEKTNKRLSFFGEE 696

Query: 82  YVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRK-- 139
           Y   + G  IVG +  +     +++++         + RK  N    +L  SF P  K  
Sbjct: 697 YDDGELGIGIVGNSPARDDVRKQSVSTNNMSGRNNGTPRKDSNNFTLELPGSFTPSSKDN 756

Query: 140 -TKVYKDVSEVIDDG 153
            T+  KDV  + DDG
Sbjct: 757 ATRSPKDVRHLYDDG 771

>TPHA0B02770 Chr2 (631381..632823) [1443 bp, 480 aa] {ON} Anc_7.216
           YIL039W
          Length = 480

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 7/92 (7%)

Query: 147 SEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATN--IESKES 204
           S+ IDD   S +    ++  RR+ K         +   +S+D  G   V T   IESK  
Sbjct: 147 SQWIDD---SEFYNRTSRYMRRIFKRNTDILFDINN--ESHDENGQYQVNTEKWIESKNL 201

Query: 205 FGKKIEDFKEKTPVGRKLHEYKIKLWDESENP 236
           F  + E+  E TP+  +     +  WDE  +P
Sbjct: 202 FSYEFENIDESTPIDNEFGYEDLYSWDEDSDP 233

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,003,382
Number of extensions: 1720946
Number of successful extensions: 5678
Number of sequences better than 10.0: 127
Number of HSP's gapped: 5921
Number of HSP's successfully gapped: 129
Length of query: 418
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 306
Effective length of database: 40,638,807
Effective search space: 12435474942
Effective search space used: 12435474942
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)