Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D16192g7.195ON1211216246e-85
Ecym_43817.195ON1201092235e-24
Kwal_55.20373singletonOFF1151002122e-22
Kwal_YGOB_ADL119W7.195ON1151002122e-22
KLTH0E04576g7.195ON1151022122e-22
Kpol_1063.107.195ON1221051983e-20
CAGL0D05148g7.195ON108931852e-18
ZYRO0D15818g7.195ON1181071836e-18
NCAS0E018207.195ON1141111783e-17
TDEL0H025207.195ON1191201732e-16
SAKL0F07480g7.195ON1131011704e-16
TBLA0J015107.195ON107931634e-15
TPHA0C045207.195ON1351061638e-15
Scer_YGOB_ADL119W (ADL119W)7.195ON96931521e-13
Skud_6.1257.195ON225931442e-11
KAFR0G029907.195ON1101001295e-10
ADL119W7.195ON185991256e-09
KNAG0L012307.195ON1281071211e-08
NDAI0G019907.195ON101711146e-08
Suva_6.1147.195ON26893790.026
ZYRO0G10846g4.134ON85553780.031
Suva_11.2142.653ON176588643.1
Kwal_47.177862.408ON54154633.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D16192g
         (121 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON} conse...   244   6e-85
Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON} ...    91   5e-24
Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {O...    86   2e-22
Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa...    86   2e-22
KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {O...    86   2e-22
Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON...    81   3e-20
CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {O...    76   2e-18
ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON} conse...    75   6e-18
NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON...    73   3e-17
TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON...    71   2e-16
SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserv...    70   4e-16
TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {O...    67   4e-15
TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.19...    67   8e-15
Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON} ANN...    63   1e-13
Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)         60   2e-11
KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.19...    54   5e-10
ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No...    53   6e-09
KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON} Anc_7.1...    51   1e-08
NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON...    49   6e-08
Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)         35   0.026
ZYRO0G10846g Chr7 (871341..873908) [2568 bp, 855 aa] {ON} simila...    35   0.031
Suva_11.214 Chr11 complement(395683..400980) [5298 bp, 1765 aa] ...    29   3.1  
Kwal_47.17786 s47 (556939..558564) [1626 bp, 541 aa] {ON} YLR033...    29   3.3  

>KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON}
           conserved hypothetical protein
          Length = 121

 Score =  244 bits (624), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 121/121 (100%), Positives = 121/121 (100%)

Query: 1   MPKGIARVDEKVSVKASLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIV 60
           MPKGIARVDEKVSVKASLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIV
Sbjct: 1   MPKGIARVDEKVSVKASLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIV 60

Query: 61  AKVVARDILISPFLQGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAIYRPPRN 120
           AKVVARDILISPFLQGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAIYRPPRN
Sbjct: 61  AKVVARDILISPFLQGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAIYRPPRN 120

Query: 121 I 121
           I
Sbjct: 121 I 121

>Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON}
           similar to Ashbya gossypii ADL119W
          Length = 120

 Score = 90.5 bits (223), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 69/109 (63%), Gaps = 8/109 (7%)

Query: 17  SLPDLRFEQTFKQSLRKEALKQNKLTLSVADGS---VV-----DPPITPYIVAKVVARDI 68
           ++PD+RFEQTF  +L+KEALKQ++  +    GS   VV     +P IT ++VAKV+ RD+
Sbjct: 7   AIPDIRFEQTFMVALKKEALKQHQYKIRKLKGSQDIVVSEDFGEPTITTFVVAKVIVRDV 66

Query: 69  LISPFLQGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAIYRP 117
           ++ P + G+  + F I+ KPWL+ C Q GR +G  I   + G+N   +P
Sbjct: 67  VLLPLVHGMLWTGFLIMMKPWLKACTQNGRRLGAGIYNVIVGRNVYPKP 115

>Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {OFF}
           [contig 149] FULL
          Length = 115

 Score = 86.3 bits (212), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 60/100 (60%)

Query: 15  KASLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFL 74
           K S+PDLRFEQTFK +L++EALK  +        +  + P++  I+ KVV RD+L+ PFL
Sbjct: 12  KVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLLLPFL 71

Query: 75  QGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAI 114
           QG   +   I  +PWL + +  G  +GR I   + GK+ +
Sbjct: 72  QGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLV 111

>Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 115

 Score = 86.3 bits (212), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 60/100 (60%)

Query: 15  KASLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFL 74
           K S+PDLRFEQTFK +L++EALK  +        +  + P++  I+ KVV RD+L+ PFL
Sbjct: 12  KVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESPLSASIICKVVLRDVLLLPFL 71

Query: 75  QGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAI 114
           QG   +   I  +PWL + +  G  +GR I   + GK+ +
Sbjct: 72  QGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLV 111

>KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {ON}
           conserved hypothetical protein
          Length = 115

 Score = 86.3 bits (212), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (58%)

Query: 15  KASLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFL 74
           K ++PDLRFEQTF+++LR+EA K  K T      +  D  I+  ++ KVV RD+L+ PFL
Sbjct: 12  KVAVPDLRFEQTFQRALRREASKNQKATSQGHSTTDADATISASVICKVVLRDVLLMPFL 71

Query: 75  QGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAIYR 116
           QG+  +   I  KPWL   R  G+ +G  I   + GK  + +
Sbjct: 72  QGILWTSALIALKPWLHMVRIRGQLVGHRIYEMVLGKGLVRK 113

>Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON}
           complement(28076..28444) [369 nt, 123 aa]
          Length = 122

 Score = 80.9 bits (198), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 59/105 (56%), Gaps = 11/105 (10%)

Query: 18  LPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVD----------PPITPYIVAKVVARD 67
           +PD+RFE+TF +++ KEA KQ + +L    G   D          P +T YIV KV+ RD
Sbjct: 12  VPDVRFEETFNRAINKEAEKQREYSLK-KKGLTTDEISKIKENEAPEVTTYIVWKVIVRD 70

Query: 68  ILISPFLQGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKN 112
           +LI PF+QG+  S   I+ KPWL+     GR  G  I   + GKN
Sbjct: 71  MLIMPFIQGIMFSGLLIILKPWLRSVVGNGRRFGTFIYNTVLGKN 115

>CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {ON}
           some similarities with KLLA0D16192g Kluyveromyces lactis
           and DEHA0C08349g Debaryomyces hansenii
          Length = 108

 Score = 75.9 bits (185), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 55/93 (59%), Gaps = 2/93 (2%)

Query: 18  LPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFLQGV 77
           +PD RFEQTF++++ +E  KQN L+    D     P  + Y++ KVV RD+L+ PF+Q V
Sbjct: 7   IPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGP--SAYVICKVVVRDVLLMPFIQSV 64

Query: 78  FLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFG 110
             + F +  KPWL+     GR  G  + R L+G
Sbjct: 65  LWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYG 97

>ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON}
           conserved hypothetical protein
          Length = 118

 Score = 75.1 bits (183), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 58/107 (54%), Gaps = 10/107 (9%)

Query: 18  LPDLRFEQTFKQSLRKEALKQNKLT---LSVADGSVVDP-------PITPYIVAKVVARD 67
           +PD RFE TFK++L +EA KQ  L    + V D  V++         I  Y+V KVVARD
Sbjct: 7   IPDTRFESTFKRALNREAEKQRTLQWKKMGVEDPLVINQLQKNQPVKINSYVVCKVVARD 66

Query: 68  ILISPFLQGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAI 114
           ++  P +QG+  +   I  KPWL+   Q GR  G  I R + G + I
Sbjct: 67  VIFMPLVQGLLWTSLLITMKPWLRSVIQNGRKFGTFIYRTVLGTDLI 113

>NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON}
           Anc_7.195
          Length = 114

 Score = 73.2 bits (178), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 67/111 (60%), Gaps = 9/111 (8%)

Query: 17  SLPDLRFEQTFKQSLRKEA---LKQNKLTL---SVADGSVVDPPITPYIVAKVVARDILI 70
           ++PDLR EQTFK+++ KE    + +NK T    ++ + + V+  +   I +KV+ RDIL+
Sbjct: 7   NIPDLRVEQTFKRAVAKETKEYIIKNKATFPRSTITELTRVEKAV---ICSKVILRDILV 63

Query: 71  SPFLQGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAIYRPPRNI 121
            PFLQ V  + F IV KPWL+     GR +G S +  + G+N +   P++I
Sbjct: 64  MPFLQSVAWTGFLIVLKPWLRTTVTFGRKMGSSAMDLITGRNLVKSKPKSI 114

>TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 119

 Score = 71.2 bits (173), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 64/120 (53%), Gaps = 11/120 (9%)

Query: 12  VSVKASLPDLRFEQTFKQSLRKEALKQNKLT---LSVADGSVVD-------PPITPYIVA 61
           +S    +PD RFEQTF+++L +EA K        + V D  V++       P I+  +V 
Sbjct: 1   MSANYPVPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVC 60

Query: 62  KVVARDILISPFLQGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAIYRPPRNI 121
           KVV RD++  P +QG+  +   I  KPWL+     GR +G SI R + G + + +P R I
Sbjct: 61  KVVLRDVIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLV-KPKRRI 119

>SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserved
           hypothetical protein
          Length = 113

 Score = 70.1 bits (170), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 64/101 (63%), Gaps = 5/101 (4%)

Query: 18  LPDLRFEQTFKQSLRKEA--LKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFLQ 75
           +PD RFEQTFK +L+KEA  +K  +L ++  D    + P+TP +VAKVV RD+L+ P +Q
Sbjct: 14  VPDTRFEQTFKNALKKEAKRMKAARLGITTLDD---NAPVTPMVVAKVVVRDVLLMPLVQ 70

Query: 76  GVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAIYR 116
           GV  + F I  KPWL+     GR  G S+ R + GK+ + +
Sbjct: 71  GVLWTSFLIAIKPWLRNAVWQGRRFGMSVYRLVLGKDLVRK 111

>TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 107

 Score = 67.4 bits (163), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 55/93 (59%), Gaps = 4/93 (4%)

Query: 18  LPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFLQGV 77
           +PD RFE TF++ L KE  K N  + S+     V   +    + KV+ RD++  PF+QG+
Sbjct: 12  IPDTRFESTFRRKLDKELNKNNVNSNSIIKDERVRKLLC---LGKVICRDVIFMPFVQGM 68

Query: 78  FLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFG 110
           F+   +I+ KPWL    + G+NIGR+ +  LFG
Sbjct: 69  FMCGAFILIKPWLLKLLRNGKNIGRNFV-ELFG 100

>TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 135

 Score = 67.4 bits (163), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 59/106 (55%), Gaps = 9/106 (8%)

Query: 18  LPDLRFEQTFKQSLRKEALKQN--KLTLSVADGSVV------DPP-ITPYIVAKVVARDI 68
           +PD+R EQ+F  +L+KEA KQ   KL     D S +      +P  +T YIV KV+ RD+
Sbjct: 25  VPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWKVILRDM 84

Query: 69  LISPFLQGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAI 114
           ++ PF+QG   +   +  KPWL+     GR  G  I + + GK+ +
Sbjct: 85  ILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLV 130

>Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 96

 Score = 63.2 bits (152), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 49/93 (52%), Gaps = 12/93 (12%)

Query: 17  SLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFLQG 76
           ++PDLRFE+ FK++L +E    + L+                ++ KVV RD+L+ P LQ 
Sbjct: 14  NIPDLRFEKVFKKALHRELAPSSSLSRKAG------------VITKVVVRDVLLMPLLQS 61

Query: 77  VFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLF 109
             LSL  +  K WL Y R  GR +G  I + LF
Sbjct: 62  FVLSLALMGVKEWLSYIRLKGRTLGDRIRQRLF 94

>Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)
          Length = 225

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 52/93 (55%), Gaps = 12/93 (12%)

Query: 17  SLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFLQG 76
           ++PDLRFE+ FK++L +E          +A  S V  P    ++ KVV RD+L+ P LQ 
Sbjct: 143 NIPDLRFEKVFKKALHRE----------LAPSSSV--PSKWAVITKVVVRDVLLMPLLQS 190

Query: 77  VFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLF 109
             LSL  +  K WL++ R  GR +G  + + LF
Sbjct: 191 FVLSLVLMGVKDWLRFIRLEGRTLGGRLRQRLF 223

>KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 110

 Score = 54.3 bits (129), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 58/100 (58%), Gaps = 9/100 (9%)

Query: 17  SLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFLQG 76
           ++PD RF   F+++++KE  KQ K T S  D   ++  +   I+ KV+ARD+++ PF+Q 
Sbjct: 13  AIPDTRFGYVFRKAVQKELRKQVKETDS--DNKHINKNL---IICKVIARDVILMPFIQS 67

Query: 77  VFLSLFYIVAKPWL----QYCRQAGRNIGRSIIRNLFGKN 112
           +  + F I  KP L    ++C++ G  I  SI+    GK+
Sbjct: 68  ILWTGFLISFKPCLRGFIRFCQRLGPMIKGSILEGNIGKS 107

>ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No
           homolog in Saccharomyces cerevisiae
          Length = 185

 Score = 52.8 bits (125), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 56/99 (56%), Gaps = 8/99 (8%)

Query: 17  SLPDLRFEQTFKQSLRKEALKQNKLTL-----SVADGSVVDPPITPYIVAKVVARDILIS 71
           ++PD+RFEQTF+ +L KE+ +Q +L       + ADG   +  I+  +VAKVV RD+L+ 
Sbjct: 81  TIPDVRFEQTFRAALAKESARQRQLRAQKEGEAAADG---EAGISALVVAKVVVRDVLLM 137

Query: 72  PFLQGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFG 110
           P +QG   +   I  KP L  C   GR   ++  R L G
Sbjct: 138 PLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVG 176

>KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 128

 Score = 51.2 bits (121), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 13/107 (12%)

Query: 11  KVSVKASLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILI 70
           K S+   +P++RF   F  +L+ EA + N          V +P  T ++V KVV +D+L+
Sbjct: 29  KGSLPIKIPEMRFNYVFNNALKAEAARHN----------VAEP--TTWMVCKVVCKDVLL 76

Query: 71  SPFLQGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAIYRP 117
            PFLQ    +   I  K  L+      + +  ++  N+ G N +Y+P
Sbjct: 77  MPFLQSFLWTALLISMKTPLKNALNYTKRMCSALFTNVSGAN-MYKP 122

>NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON}
          Anc_7.195
          Length = 101

 Score = 48.5 bits (114), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 18 LPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFLQGV 77
          +PD RF+Q F+ +L +E  K    T     G++V   +   ++ KV+ RD+++ PF+Q V
Sbjct: 6  IPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESL---VIFKVILRDVILLPFIQSV 62

Query: 78 FLSLFYIVAKP 88
            + F IV KP
Sbjct: 63 LWTEFLIVCKP 73

>Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)
          Length = 268

 Score = 35.0 bits (79), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 12/93 (12%)

Query: 17  SLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVVARDILISPFLQG 76
           ++PDLRF + F+++L ++       +  +A            +VAKVV RD+L+ P +Q 
Sbjct: 186 NIPDLRFGKVFERALYRDLTPSASRSRKLA------------VVAKVVVRDVLLMPLVQS 233

Query: 77  VFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLF 109
           + LS+  I  K WL+Y R  G  +G  + + LF
Sbjct: 234 IVLSVVLIGVKDWLRYIRLKGFTLGARLRQRLF 266

>ZYRO0G10846g Chr7 (871341..873908) [2568 bp, 855 aa] {ON} similar
           to uniprot|Q06163 Saccharomyces cerevisiae YLR318W EST2
           Reverse transcriptase subunit of the telomerase
           holoenzyme essential for telomerase core catalytic
           activity involved in other aspects of telomerase
           assembly and function
          Length = 855

 Score = 34.7 bits (78), Expect = 0.031,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 28/53 (52%)

Query: 11  KVSVKASLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKV 63
           K S   ++P+ RF  TFK   +   L + +L+    DG+V +PP   Y + ++
Sbjct: 713 KTSCLFNIPNFRFHSTFKTYQKLRHLYELRLSYGTVDGNVNEPPTILYQIHQI 765

>Suva_11.214 Chr11 complement(395683..400980) [5298 bp, 1765 aa]
           {ON} YKL014C (REAL)
          Length = 1765

 Score = 29.3 bits (64), Expect = 3.1,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 44/88 (50%), Gaps = 7/88 (7%)

Query: 27  FKQSLRKEALKQNKLTLSVA-DGSVVDPPITPYI--VAKVVARDILISPFLQGVFLSLFY 83
           F+++++K     + +   V  DGS  +  I   +  V++ ++  +L S  + G+ L    
Sbjct: 885 FQETIQKTVFDGDNIEERVIYDGSYCEKDINALLTSVSEYLSTPVLTSLLMYGITLEF-- 942

Query: 84  IVAKPWLQYCRQAGRNIGRSIIRNLFGK 111
             ++  L+     G+NIG S++RN+  K
Sbjct: 943 --SRNILKKVHNEGKNIGMSLLRNVLDK 968

>Kwal_47.17786 s47 (556939..558564) [1626 bp, 541 aa] {ON} YLR033W
           (RSC58) - Chromatin Remodeling Complex subunit [contig
           204] FULL
          Length = 541

 Score = 28.9 bits (63), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 11  KVSVKASLPDLRFEQTFKQSLRKEALKQNKLTLSVADGSVVDPPITPYIVAKVV 64
           K+SV  S+P   + ++F  SL  + L  +  + S+ D   VDPP + +IV K++
Sbjct: 165 KISVGYSVP---YAESFYISLGDQDLFSSTSSKSLLDSRPVDPPNSSFIVNKII 215

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.140    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,226,341
Number of extensions: 377382
Number of successful extensions: 1009
Number of sequences better than 10.0: 24
Number of HSP's gapped: 992
Number of HSP's successfully gapped: 24
Length of query: 121
Length of database: 53,481,399
Length adjustment: 90
Effective length of query: 31
Effective length of database: 43,161,459
Effective search space: 1338005229
Effective search space used: 1338005229
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)