Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D15631g3.455ON1170117060690.0
Ecym_44043.455ON1196120923570.0
AGR251C3.455ON1193115522700.0
KLTH0E05104g3.455ON1185118122370.0
Kwal_55.204643.455ON1189115921890.0
SAKL0F06886g3.455ON1183116121530.0
Smik_16.3713.455ON1208116720370.0
Skud_16.4123.455ON1208117219730.0
YPR122W (AXL1)3.455ON1208116719720.0
Suva_16.4513.455ON1218118119530.0
NDAI0A046503.455ON1199117118860.0
TDEL0F034003.455ON1170115418530.0
Kpol_1050.883.455ON1213119418520.0
KAFR0A053703.455ON1201116618400.0
NCAS0A116303.455ON1201116518230.0
KNAG0A077403.455ON1197118018000.0
ZYRO0C06336g3.455ON1189116216650.0
TBLA0C054503.455ON1202117116370.0
TPHA0D040603.455ON1201116515430.0
CAGL0D04686g3.455ON1181117511841e-142
NCAS0J014704.246ON9952533501e-32
NDAI0J022404.246ON9992313341e-30
KNAG0B060804.246ON9962323286e-30
TDEL0E012504.246ON9952293241e-29
KLLA0E05105g4.246ON10049663241e-29
SAKL0H03124g4.246ON10062313142e-28
TPHA0B022604.246ON10412293133e-28
KAFR0A059704.246ON10112533115e-28
Suva_10.5064.246ON10232463081e-27
AER053C4.246ON10132563072e-27
KLTH0D14278g4.246ON10012293043e-27
Kpol_1055.834.246ON10202273027e-27
CAGL0H06457g4.246ON10082313019e-27
Smik_12.4764.246ON10252263011e-26
YLR389C (STE23)4.246ON10272282954e-26
Kwal_23.42374.246ON10012292945e-26
Skud_12.4744.246ON10222462937e-26
TBLA0I029404.246ON9652312928e-26
ZYRO0B12320g4.246ON9942292938e-26
Ecym_32734.246ON10232332793e-24
TBLA0A080504.246ON9953702784e-24
SAKL0H14168g8.376ON4612311075e-04
TPHA0C024508.376ON4692241068e-04
Ecym_41918.376ON4622311020.002
TBLA0H010108.376ON499223950.013
Kpol_1024.23singletonOFF454224950.014
Kpol_YGOB_1024.238.376ON464224950.014
NDAI0G023208.376ON463219950.015
KLLA0D18095g8.376ON469223920.033
TBLA0A069405.541ON991145920.037
CAGL0H02739g8.376ON465220850.24
Skud_12.2308.376ON462226840.26
KNAG0A027608.376ON467227840.29
KLTH0F08954g8.376ON458242840.32
ZYRO0C03806g8.376ON465225830.37
AGL138C8.376ON470225830.39
TDEL0F050008.376ON456227830.43
YLR163C (MAS1)8.376ON462220820.56
Smik_12.2258.376ON462225800.78
Suva_10.2608.376ON462220800.92
NCAS0C029708.376ON461219791.2
Kwal_23.33458.376ON458178781.3
Skud_3.1446.339ON157114733.0
YMR204C (INP1)6.303ON42094745.0
Skud_5.3158.242ON1101138737.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D15631g
         (1170 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} sim...  2342   0.0  
Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON...   912   0.0  
AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON...   879   0.0  
KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] ...   866   0.0  
Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] ...   847   0.0  
SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} simil...   833   0.0  
Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR12...   789   0.0  
Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR12...   764   0.0  
YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Hapl...   764   0.0  
Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR12...   756   0.0  
NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa]...   731   0.0  
TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3....   718   0.0  
Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON} (199...   717   0.0  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...   713   0.0  
NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_...   706   0.0  
KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa]...   697   0.0  
ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} simil...   645   0.0  
TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa]...   635   0.0  
TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3....   598   0.0  
CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} simil...   460   e-142
NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {...   139   1e-32
NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {...   133   1e-30
KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa] ...   130   6e-30
TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.2...   129   1e-29
KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} simil...   129   1e-29
SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} simil...   125   2e-28
TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4....   125   3e-28
KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON} Anc_...   124   5e-28
Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa] ...   123   1e-27
AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON} ...   122   2e-27
KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa...   121   3e-27
Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON} (216...   120   7e-27
CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highl...   120   9e-27
Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa] ...   120   1e-26
YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}...   118   4e-26
Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389...   117   5e-26
Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa] ...   117   7e-26
TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {O...   117   8e-26
ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {...   117   8e-26
Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar ...   112   3e-24
TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON} Anc_4...   111   4e-24
SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} high...    46   5e-04
TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.3...    45   8e-04
Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar t...    44   0.002
TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.3...    41   0.013
Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF} (68467...    41   0.014
Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON} AN...    41   0.014
NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.3...    41   0.015
KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]...    40   0.033
TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa] ...    40   0.037
CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly...    37   0.24 
Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {...    37   0.26 
KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.3...    37   0.29 
KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly...    37   0.32 
ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {...    37   0.37 
AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON} S...    37   0.39 
TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {O...    37   0.43 
YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON} ...    36   0.56 
Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {...    35   0.78 
Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {...    35   0.92 
NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376     35   1.2  
Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C...    35   1.3  
Skud_3.144 Chr3 complement(224763..225236) [474 bp, 157 aa] {ON}...    33   3.0  
YMR204C Chr13 complement(670063..671325) [1263 bp, 420 aa] {ON} ...    33   5.0  
Skud_5.315 Chr5 (526724..530029) [3306 bp, 1101 aa] {ON} YER176W...    33   7.5  

>KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} similar
            to uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1170

 Score = 2342 bits (6069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1137/1170 (97%), Positives = 1137/1170 (97%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP
Sbjct: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
            DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK
Sbjct: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
            TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR
Sbjct: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240
            SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL
Sbjct: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240

Query: 241  VQTTFGDFRTKSTIKSQSFSIESFKKLQKVWAARYTEPLFSKQEPETPNSILIQSSKAPI 300
            VQTTFGDFRTKSTIKSQSFSIESFKKLQKVWAARYTEPLFSKQEPETPNSILIQSSKAPI
Sbjct: 241  VQTTFGDFRTKSTIKSQSFSIESFKKLQKVWAARYTEPLFSKQEPETPNSILIQSSKAPI 300

Query: 301  LRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKFSARNILTRQVTQLSKFTI 360
            LRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKFSARNILTRQVTQLSKFTI
Sbjct: 301  LRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKFSARNILTRQVTQLSKFTI 360

Query: 361  DDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSIDPDEIAQYLNEWNTINLLQFMY 420
            DDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSIDPDEIAQYLNEWNTINLLQFMY
Sbjct: 361  DDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSIDPDEIAQYLNEWNTINLLQFMY 420

Query: 421  QDLDNSTMDKCSDLCSELLQCEDPQFILNNSIAFSCNRKGSDIGSYYESPKSKEWWNSQA 480
            QDLDNSTMDKCSDLCSELLQCEDPQFILNNSIAFSCNRKGSDIGSYYESPKSKEWWNSQA
Sbjct: 421  QDLDNSTMDKCSDLCSELLQCEDPQFILNNSIAFSCNRKGSDIGSYYESPKSKEWWNSQA 480

Query: 481  KKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQVPTNVKFDEHYRFQYELSLIKLNHVK 540
            KKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQVPTNVKFDEHYRFQYELSLIKLNHVK
Sbjct: 481  KKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQVPTNVKFDEHYRFQYELSLIKLNHVK 540

Query: 541  MSPKDFRLPSSTAFLFGLEKNLSALKQSLTAVLRKSQGSALSIITQSKLLQTTPRLMSKN 600
            MSPKDFRLPSSTAFLFGLEKNLSALKQSLTAVLRKSQGSALSIITQSKLLQTTPRLMSKN
Sbjct: 541  MSPKDFRLPSSTAFLFGLEKNLSALKQSLTAVLRKSQGSALSIITQSKLLQTTPRLMSKN 600

Query: 601  ENYELWVKEENSLEYSSRSVITIELINMGMEPSAKNTMNLEILTQLLYFYINESLYPSER 660
            ENYELWVKEENSLEYSSRSVITIELINMGMEPSAKNTMNLEILTQLLYFYINESLYPSER
Sbjct: 601  ENYELWVKEENSLEYSSRSVITIELINMGMEPSAKNTMNLEILTQLLYFYINESLYPSER 660

Query: 661  VGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMVDIGKPDFDITNSMFRHSRIL 720
            VGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMVDIGKPDFDITNSMFRHSRIL
Sbjct: 661  VGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMVDIGKPDFDITNSMFRHSRIL 720

Query: 721  VRTKYEEAARANSCTLASLGVXXXXXXXXXXXXXXXDALEDIDIESFKMFCKDLWIPKSN 780
            VRTKYEEAARANSCTLASLGV               DALEDIDIESFKMFCKDLWIPKSN
Sbjct: 721  VRTKYEEAARANSCTLASLGVLILLEKELTTLEERLDALEDIDIESFKMFCKDLWIPKSN 780

Query: 781  YMNLVIQGDLSIAETVNQYMDGIIHHLSGPNVNQTSVFRLREPETIKLAQGSNFFIEMTS 840
            YMNLVIQGDLSIAETVNQYMDGIIHHLSGPNVNQTSVFRLREPETIKLAQGSNFFIEMTS
Sbjct: 781  YMNLVIQGDLSIAETVNQYMDGIIHHLSGPNVNQTSVFRLREPETIKLAQGSNFFIEMTS 840

Query: 841  FKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXX 900
            FKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVV        
Sbjct: 841  FKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVLGGLRLLT 900

Query: 901  XXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLE 960
                IHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLE
Sbjct: 901  DTLGIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLE 960

Query: 961  KLIKNAGPANLMAQIEASVHSGNYPSNLQSQGYTVGQHKKLKDEISFRTYAFSETKVDVC 1020
            KLIKNAGPANLMAQIEASVHSGNYPSNLQSQGYTVGQHKKLKDEISFRTYAFSETKVDVC
Sbjct: 961  KLIKNAGPANLMAQIEASVHSGNYPSNLQSQGYTVGQHKKLKDEISFRTYAFSETKVDVC 1020

Query: 1021 LLSKLTLQEFKRLFMEKISILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFH 1080
            LLSKLTLQEFKRLFMEKISILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFH
Sbjct: 1021 LLSKLTLQEFKRLFMEKISILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFH 1080

Query: 1081 ITRDELQEIVTKTAGKPTSLFKELFHHFRTQGQSLRLCTLVLKEIVKQILAVTPXXXXXX 1140
            ITRDELQEIVTKTAGKPTSLFKELFHHFRTQGQSLRLCTLVLKEIVKQILAVTP      
Sbjct: 1081 ITRDELQEIVTKTAGKPTSLFKELFHHFRTQGQSLRLCTLVLKEIVKQILAVTPSSSSSS 1140

Query: 1141 NTKLTQNIKTQIPTEIQSIASFKMELTVNI 1170
            NTKLTQNIKTQIPTEIQSIASFKMELTVNI
Sbjct: 1141 NTKLTQNIKTQIPTEIQSIASFKMELTVNI 1170

>Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON}
            similar to Ashbya gossypii AGR251C
          Length = 1196

 Score =  912 bits (2357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/1209 (41%), Positives = 747/1209 (61%), Gaps = 77/1209 (6%)

Query: 10   DVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHL 69
            DV +YTPIS+S R+H+ +QLSN + ALLISDP E+ AS   SVATGSHNDP E+PGLAH 
Sbjct: 11   DVTLYTPISSSKRSHRIIQLSNNLLALLISDPSETIASCAISVATGSHNDPPELPGLAHF 70

Query: 70   CEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDEL 129
            CEHM++SS SKK+P+ + +H+ L   NG++NA TTGEQTSFYFE+P++ +     +F++L
Sbjct: 71   CEHMVLSSGSKKYPEPNFFHESLTRNNGSKNAHTTGEQTSFYFEVPHTTSAELH-VFEQL 129

Query: 130  VGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTG 189
            + ++A     P+F    +NKEI AI +EH  NK+ +SK LYH T+ LA +   FS FSTG
Sbjct: 130  IDILAASFKEPVFHDILVNKEIYAIHSEHMGNKSTLSKMLYHATRLLANENHPFSHFSTG 189

Query: 190  NIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFR 249
            N++TLT  P V    +NLK  L K++ ++F AE + + IRGSQSL+ L KL Q  FGD  
Sbjct: 190  NVFTLTNMPRVNK--LNLKTELIKYFKEHFRAEKMVVCIRGSQSLNQLSKLAQLKFGDIP 247

Query: 250  --------TKSTIKSQSF-----------------SIESFKKLQKVWAARYT-EPLFSKQ 283
                    T S +K +S+                 S++  + L+  W  RY+ EP+F+ +
Sbjct: 248  GSAAAGSPTSSPLKLKSWRSSNSITSSVDTSSTLASLDESRILKDTWLPRYSKEPVFTPR 307

Query: 284  EPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKFS 343
             P+  NS++IQS K P++R +FPV++    F+  E+  ++K W D+ GDE  GS      
Sbjct: 308  -PKY-NSMMIQSKKPPVIRFIFPVNYLSTRFTDKEIATYTKAWCDIIGDEGYGSFCHFLR 365

Query: 344  ARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGF-LPFFQSIDPDE 402
              N ++  +   S F ++D+GL+LQ  LTN GW     S++  LF  + +         +
Sbjct: 366  QNNYISDLLAFSSSFAVNDDGLILQLHLTNYGWAN--VSIIVPLFWKYTVNTILDTSLSK 423

Query: 403  IAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSELLQ---CEDPQFILNNS-IAFSCNR 458
            I QYL+E N+I+LL+F+YQD++ S M++C++LC +L+Q      P FIL  S + F CN 
Sbjct: 424  IGQYLSELNSIDLLKFLYQDVERSPMERCAELCDQLMQDLSVVPPPFILKTSGLMFDCND 483

Query: 459  -KGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQVPT 517
             +   IGSY ES  S +WW  QA KF +FVK + +  N K+I LG L    F  +     
Sbjct: 484  PRIQKIGSYSESQNSTDWWRGQAIKFQTFVKEFTTIENVKMIMLGPLSKCPFYSNSM--- 540

Query: 518  NVKFDEHYRFQYELSLIKLNHVKM--SPKDFRLPSSTAFLFGLEKNLSALKQSLTAVLRK 575
             +  D HY + Y  + I++  ++   +  +F +PS   FL  +   LS +K++L A   +
Sbjct: 541  QLTADTHYEYDYLKAYIEITELEAIDNEYEFHIPSPNQFLVPVGHKLSYIKKALLAASAQ 600

Query: 576  SQGSALSIITQSKLLQTTPRLMSKNENYELWVKEEN-SLEYSSRSVITIELINMGMEPSA 634
            S+ S+L I+TQS LLQTTP L  KN  YELW KEE+ +L + S+S++++E+I+  ++P+ 
Sbjct: 601  SENSSLFIVTQSDLLQTTPSLAGKNAFYELWTKEEDINLSFKSKSIVSLEVISTTLKPAP 660

Query: 635  KNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQI 694
            + TM LEIL QLL+  I+  LYP+ER GY Y+++ +++GDVRL +T++GF +G+  IL I
Sbjct: 661  EYTMQLEILGQLLFSIISPVLYPAERAGYTYELSLSSKGDVRLGITLSGFTEGIMGILNI 720

Query: 695  IMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXXXXXXXXX 754
            I+D ++++G+   +I+  MFR +R++VRTKYEEAA  N  TLASLG+             
Sbjct: 721  ILDSLLELGEDSVEISKGMFRRARVMVRTKYEEAASENCATLASLGLLIVLEGCMWTLED 780

Query: 755  XXDALEDIDIESFKMFCKDLWIPKSNYMNLVIQG-DLSIAETVNQYMDG-IIHHLS---- 808
              +ALEDID+ESF  F K L+I   NY+NL++QG DLS+A+ VN  +D  + HH+S    
Sbjct: 781  RLNALEDIDMESFVQFMK-LFINGRNYLNLLVQGSDLSLADKVNDCVDAKLTHHMSSLET 839

Query: 809  GPNVNQTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSS 868
            G N+       L EP T  + +GSN  ++ +   +DP NS+VYFI+TG R N   YT++ 
Sbjct: 840  GKNI-------LVEPTTHFIPRGSNLCVKKSGSHDDPNNSIVYFIQTGTRDNNYAYTLTV 892

Query: 869  LFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYY 928
              E+ MSMTLVPDLR KKQIGYVV            +HI+ MS+ PP  +E +I+EYL Y
Sbjct: 893  FTEFLMSMTLVPDLRGKKQIGYVVLGGLRVLSDTVGLHITTMSSNPPEYLEKKIDEYLSY 952

Query: 929  LETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNYPSNL 988
            LE+ VL  +   +F+ N L K+++L++SNSL K+ K +GPANLM+QIEA+V SG+     
Sbjct: 953  LESMVLMKLNNEQFKMNYLNKFLRLVESNSLSKIEKTSGPANLMSQIEANVRSGS----- 1007

Query: 989  QSQGYTVGQHKKLKDEISFRTYAFSETK--VDVCLLSKLTLQEFKRLFMEKISILSLQRR 1046
            Q+    +  HK+++++IS+R Y F E    ++   +  LTL+E+   F EKIS+ S  R 
Sbjct: 1008 QNGSMAMKSHKRIRNQISYRRYNFEEEDEPINAKTIRNLTLREYMAFFHEKISVYSKSRA 1067

Query: 1047 KLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFKELFH 1106
            K+SV   +PM+K ++   MM +Q++ FLK KGF+I  ++L+ I+ K+ GKPT L K LF 
Sbjct: 1068 KMSVMVTSPMSKDEVQSKMMFLQIESFLKMKGFNIPSEDLKSIIVKSGGKPTVLLKHLFS 1127

Query: 1107 HFRTQGQSLRLCTLVLKEIVKQI----------LAVTPXXXXXXNTKLTQNIKTQIP-TE 1155
            +FR +G+S++L T ++KEIVKQ            + TP         ++Q +   +P  E
Sbjct: 1128 YFRVRGESIKLLTAIVKEIVKQASNKPPGSAAKTSATPTGTSGTLQAMSQTVAPAVPLIE 1187

Query: 1156 IQSIASFKM 1164
            +  + S+++
Sbjct: 1188 VTDVNSYRV 1196

>AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPR122W
            (AXL1)
          Length = 1193

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/1155 (41%), Positives = 734/1155 (63%), Gaps = 53/1155 (4%)

Query: 10   DVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHL 69
            DV +YTPIS+SNR+H+ ++L+N +   LISDP E+ AS   S+ATGSHNDP E+PGLAH 
Sbjct: 11   DVKLYTPISSSNRSHRIIRLNNNLLTFLISDPSETVASCAVSIATGSHNDPVEIPGLAHF 70

Query: 70   CEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDEL 129
            CEHM++SS SK+ P+ + +H+ L + NG+QNA T+GEQTSFYFE+P+S + +   +FD++
Sbjct: 71   CEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQS-SDSLVFDQV 129

Query: 130  VGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTG 189
            VG++AD L  PIF    INKEI AI++EH  NK+ ++K +YH  + LA+    F +F TG
Sbjct: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189

Query: 190  NIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFR 249
            NI+TLT  P +    ++LKN L K++ ++F AEN+ + +RG QSL+ L K+ Q  F D  
Sbjct: 190  NIFTLTNMPKLHK--LSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIP 247

Query: 250  TKSTIK---------SQSFS---------IESFKKLQKVWAARYTE-PLFSKQEPETP-- 288
            +  T++         S SF          +ESF+ L+  W+ARY + P+F K    TP  
Sbjct: 248  SIPTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVFDK----TPMH 303

Query: 289  NSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKFSARNIL 348
            NSI++QSSK+P++R VFP+++    F+  EL  ++++W +L GDE  GS+     + + +
Sbjct: 304  NSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSYI 363

Query: 349  TRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSIDPDEIAQYLN 408
            T  +   S F ++D GL+LQ  LTN GW   V+ ++  +++  +P         +AQY++
Sbjct: 364  TELIAYSSNFAVNDTGLILQLHLTNHGW-LNVQKIIPIVWKYLIPAILDAPLSSLAQYIS 422

Query: 409  EWNTINLLQFMYQDLDNSTMDKCSDLCSELLQ---CEDPQFILNNSIA-FSCNRKG-SDI 463
            E N+++LL+F+YQ+L+ S MD+C+DLC  LLQ     D  F+L +++  F CN    +++
Sbjct: 423  ELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVANL 482

Query: 464  GSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQVPTNVKFDE 523
            G+Y E+  SK+WW  +A KF +FV  +MS +  ++I LG+L    F      P  +  D 
Sbjct: 483  GTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYF---NCNPDKITTDT 539

Query: 524  HYRFQYELSLIKLNHVKMSPKDFR--LPSSTAFLFGLEKNLSALKQSLTAVLRKSQGSAL 581
            ++ ++Y    I L  +      +R  +P    F+  +   LS +K +L A   +S+ SAL
Sbjct: 540  YFEYEYVKIFIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSAL 599

Query: 582  SIITQSKLLQTTPRLMSKNENYELWVKEEN-SLEYSSRSVITIELINMGMEPSAKNTMNL 640
            S++ QS L++ +PRL  KN  YELW+KEE+  L + S+S+ ++ELI+  +EP+ + TM+L
Sbjct: 600  SVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHL 659

Query: 641  EILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMV 700
            EIL QLLY  +   LYP+ER GY Y+++ +++GDVRL +TI+GF  G+  +L+II+D +V
Sbjct: 660  EILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIV 719

Query: 701  DIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXXXXXXXXXXXDALE 760
            ++ +    I   +FR +RILVRTKY+EA+  +  TLASLG+               +ALE
Sbjct: 720  NLSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALE 779

Query: 761  DIDIESFKMFCKDLWIPKSNYMNLVIQG-DLSIAETVNQYM-DGIIHHLSGPNVNQTSVF 818
            DI +ESF++F +  +I   NY+N++IQG D++IA+ +N+Y+ + + HH+S  + N   V 
Sbjct: 780  DIYVESFRIFLEK-FINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDN---VC 835

Query: 819  RLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTL 878
            RL EP T  + +GSN F +   F +DP NS+VYFI+TG+R N   YT++ L E+ MS TL
Sbjct: 836  RLSEPATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTL 895

Query: 879  VPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMT 938
            VPDLR KKQIGY+V            +HI+ M+  PP  +E++I EYL YLE  VL  +T
Sbjct: 896  VPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLT 955

Query: 939  EAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNYPSNLQSQGYTVGQH 998
              +F+ + + + + L+ SNSL KL K +GPANLM+QIEA+VHSG   ++L      +  H
Sbjct: 956  APQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRNTSL-----AMKSH 1010

Query: 999  KKLKDEISFRTYAFSETK--VDVCLLSKLTLQEFKRLFMEKISILSLQRRKLSVRFKTPM 1056
            K+L+ +IS+R Y F E    VD   L  L L E+ R F ++ISI S +R KLS+   + M
Sbjct: 1011 KRLRTQISYRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAM 1070

Query: 1057 TKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFKELFHHFRTQGQSLR 1116
            +K ++   M+ +Q++ FLK KGF+I   +L  IV K+ GKPT+L K L  +FR+QG+SL+
Sbjct: 1071 SKEEVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLK 1130

Query: 1117 LCTLVLKEIVKQILA 1131
            L + VL+E+VKQ+ +
Sbjct: 1131 LLSTVLREVVKQLFS 1145

>KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] {ON}
            similar to uniprot|P40851 Saccharomyces cerevisiae
            YPR122W AXL1 Haploid specific endoprotease that performs
            one of two N-terminal cleavages during maturation of a-
            factor mating pheromone required for axial budding
            pattern of haploid cells
          Length = 1185

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/1181 (40%), Positives = 717/1181 (60%), Gaps = 45/1181 (3%)

Query: 6    VQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPG 65
            VQ  DV  YTPIS+SN+  +  +L+NGI  LLISDP ++  S   SVA+GSH DPDEV G
Sbjct: 8    VQHFDVAFYTPISSSNKGVELCRLANGILVLLISDPADTSVSSSVSVASGSHADPDEVLG 67

Query: 66   LAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPI 125
            LAHLCEH I+S+ SKKFP+ SHYH+++ +  G+ NA+TTGE T+FYFE+P SN+ +G+ +
Sbjct: 68   LAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASND-SGELL 126

Query: 126  FDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSR 185
            FD+++  +A    +P+F  + INKEI AI++EH  NK    K LYH T+ LA  R  FSR
Sbjct: 127  FDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSR 186

Query: 186  FSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTF 245
            F TGN  TL   P +    +N+K  L +++  N+ A  +++ +RG QSL+ L KL +  F
Sbjct: 187  FCTGNFATLCDEPNLHK--VNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYF 244

Query: 246  GDFRTKSTIKSQSFSIESFKKLQKVWAAR---YTEPL---FSKQE--------PETPNSI 291
            GD       + +  +    KK      A    +  PL    SKQ+        P+T N +
Sbjct: 245  GDLPAS---RDRDPTRPPLKKRPSSGVASQDLHVRPLDFKNSKQQTQVQDAFVPDTSNLV 301

Query: 292  LIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKFSARNILTRQ 351
             IQSSK P+LRLVFPVSH+    + +++   S+ W D FGDE  GS+       N++   
Sbjct: 302  AIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLINGV 361

Query: 352  VTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSIDPDEIAQYLNEWN 411
            V  ++ F+  ++GL L+F LTN GW +  + ++T LF  F+P        +IA+ L+E N
Sbjct: 362  VASVAHFSAGNDGLTLEFTLTNLGWSSA-QLIITVLFDLFIPRLIHDKTKDIAKCLSELN 420

Query: 412  TINLLQFMYQDLDNSTMDKCSDLCSELL---QCEDPQFILNNSIAFSCNRKGSDIGSYYE 468
              +LL F+YQ  + S+M+ C+ L S LL   +  DP+ +L  S    CN+  S IG Y E
Sbjct: 421  CTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIGDYSE 480

Query: 469  SPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQVPTNVKFDEHYRFQ 528
            S +S+ WW  +A KF +FV  +++  N +++ LG+   +D L S  V +  K D +Y F 
Sbjct: 481  STESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSS--VTSVSKTDAYYEFT 538

Query: 529  YELSLIKLNHVK-----MSPKDFRLPSSTAFLFGLEKNLSALKQSLTAVLRKSQGSALSI 583
            Y++S I +  V+     +    FR+P    FL  + + L  +KQ+L A   +SQ S L++
Sbjct: 539  YQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQTSLLTV 598

Query: 584  ITQSKLLQTTPRLMSKNENYELWVKEENS-LEYSSRSVITIELINMGMEPSAKNTMNLEI 642
            + ++  LQT PRL  KN N+ELWVKEE+S L + S+S+I+IE+ +  +E     TM LE+
Sbjct: 599  VARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEV 658

Query: 643  LTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMVDI 702
            L QLL   ++  LYPSE++GY Y+I+ + +G  RL+ TI+GFP+GV  ++++I+D+   +
Sbjct: 659  LAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSL 718

Query: 703  GKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXXXXXXXXXXXDALEDI 762
               D  +T +MFR +R+ VR KYEEAA ANS TLA+LG+               DALE+I
Sbjct: 719  INSD-TVTPAMFRKARVAVRNKYEEAASANSTTLATLGLLIVLEECMWPVEDRLDALEEI 777

Query: 763  DIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMD-GIIHHLSGPNVNQTSVFRLR 821
            DIESF+ FC   +I K  Y+N+  QGDLS  E ++ ++D G+  HLS    ++ +V   R
Sbjct: 778  DIESFRTFCSG-FISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEPAV---R 833

Query: 822  EPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPD 881
            EP T  L  G+N FI  ++F EDP++S+VYFI+TGDR +    +++ L E+ MSMTLVPD
Sbjct: 834  EPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPD 893

Query: 882  LRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAE 941
            LR KKQIGY V            +HI+ MS+ PP  +E +I++YL Y+E +VL AM+E E
Sbjct: 894  LRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEE 953

Query: 942  FQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNYPSNLQSQGYTVGQHKKL 1001
            FQ+  ++K+  + +  ++      AGPA+L+AQIEA+VHSGN P     QG  + QHK++
Sbjct: 954  FQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLP----EQGAAMRQHKRI 1009

Query: 1002 KDEISFRTYAFSET--KVDVCLLSKLTLQEFKRLFMEKISILSLQRRKLSVRFKTPMTKP 1059
            +++IS   Y F+      D+ LL  LTL +F+R F EKISI S  R KLSV   +P++  
Sbjct: 1010 RNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSAD 1069

Query: 1060 DIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFKELFHHFRTQGQSLRLCT 1119
            +I    + +Q++ +LK KG  I   EL+ IV  + GKP++L + LF  F  +G++LRLC 
Sbjct: 1070 EIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCN 1129

Query: 1120 LVLKEIVKQ-ILAVTPXXXXXXNTKLTQNIKTQIPTEIQSI 1159
            ++LKE+ K  +L++ P      +  + QN++ ++ T +  I
Sbjct: 1130 VILKELSKAVVLSLKPRPTNNNSAGVLQNVRKEVSTAVPLI 1170

>Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] {ON}
            YPR122W (AXL1) - putative homolog of human
            insulin-degrading endoprotease [contig 148] FULL
          Length = 1189

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/1159 (40%), Positives = 698/1159 (60%), Gaps = 51/1159 (4%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            M+  + +  D+  YTPIS S+R  +  QLSNG+   LISDP ++  S   SVATGSHNDP
Sbjct: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
            DE  GLAHLCEH I+S  SKK+P  ++YH++L +  G+ NA+TTGE T+FYFE+P  ++ 
Sbjct: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAYTTGETTTFYFELPAISD- 119

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
            +G+  FD+ + V+A  L +P+F    INKEI AI++EH  NK LV K LYH ++ LA   
Sbjct: 120  SGELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPS 179

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240
              FSRF TGN  TL   P +     N+K  L   +   +   N+S+ +RGSQSL+ L KL
Sbjct: 180  HPFSRFCTGNFTTLCTLPSL--NKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKL 237

Query: 241  VQTTFGD----------------FRTKSTIKSQSFSIESFKKLQKVWAARYTE-PLFSKQ 283
                FGD                F  K T +S  +    FK L+  W  +Y +   FS+ 
Sbjct: 238  AIRFFGDLPASGQNIARPSSSSLFSNKGTAQSMPY----FKILKYEWTPKYKDVRAFSQG 293

Query: 284  EPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKFS 343
               + N + IQSSK P+LRL+FPVSH+    S S++  FS  W D FGDES GS+     
Sbjct: 294  ---SSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLK 350

Query: 344  ARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSIDPDEI 403
               +++  V+ +S F  +++GL L+  LT  GWK  + +++  LF  ++P       ++I
Sbjct: 351  GCGLISGIVSSVSHFATEEDGLTLELTLTQHGWKN-IPTIMCILFDDYIPKLIHDKTEDI 409

Query: 404  AQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSELL---QCEDPQFILNNSIAFSCNRKG 460
            A+ L+E N I LL+F+YQ  + S MD C++L + LL   +  DP+ +L  S    CN++ 
Sbjct: 410  ARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQEH 469

Query: 461  SDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQVPTNVK 520
            S IG Y E+ +S+ WW  +A KF + V  +++  N + + LGD   ++FL S  V +  K
Sbjct: 470  SRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLAS--VRSTTK 527

Query: 521  FDEHYRFQYELSLIKLNHVKM----SPK-DFRLPSSTAFLFGLEKNLSALKQSLTAVLRK 575
             D +Y F Y ++ + +  +++    +P   F  PS   FL  + + LS +KQ+L     +
Sbjct: 528  TDAYYEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTR 587

Query: 576  SQGSALSIITQSKLLQTTPRLMSKNENYELWVKEEN-SLEYSSRSVITIELINMGMEPSA 634
            +Q ++L +I +S  LQT PRL  KN NYE+WVKEE   L +SS+S+++ E+I+  +  S 
Sbjct: 588  AQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASP 647

Query: 635  KNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQI 694
            KNTM LEIL QLL   ++ +LYPSE++GY Y+I+ +++GDVRL +T++GFP+GV  +++I
Sbjct: 648  KNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKI 707

Query: 695  IMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXXXXXXXXX 754
            I++++      D  I++ +FR +RI VR+KYEEAA AN   LASLG+             
Sbjct: 708  IVEEIKSFSSRDI-ISSKVFREARIAVRSKYEEAAAANCTALASLGLLIILEECMWPIED 766

Query: 755  XXDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMD-GIIHHLSGPNVN 813
              +ALE+I  E+F MFC   ++    YMNL IQGD+S  E +N ++   +  HL      
Sbjct: 767  RLEALEEISQETFTMFCSH-FLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDTREY 825

Query: 814  QTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYF 873
            Q  V   REP    L  G+N F++  +F +DP NS+VYFI+TG+R +   YT + L E+F
Sbjct: 826  QGPV---REPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFF 882

Query: 874  MSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNV 933
            +S+TLVPDLRNKKQIGY V            +HI+ MSN PP  +E +IEEYL YLE  +
Sbjct: 883  LSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCL 942

Query: 934  LGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNYPSNLQSQGY 993
            L  MTE EFQ++ ++KY  ++++N + ++ K AGPA+LM QIEA+V SG    NL+ QG 
Sbjct: 943  LDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSG----NLEEQGS 998

Query: 994  TVGQHKKLKDEISFRTYAFS--ETKVDVCLLSKLTLQEFKRLFMEKISILSLQRRKLSVR 1051
             +  HK  K++IS R Y F   E  V+  +L  +TL EF+  F EKISI SL+R KLSV 
Sbjct: 999  AMRLHKNTKNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVM 1058

Query: 1052 FKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFKELFHHFRTQ 1111
              +PMT  +I    + +Q++ FLK KG  I+  +L +I+  + G+ + + + LF +F   
Sbjct: 1059 IASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSAN 1118

Query: 1112 GQSLRLCTLVLKEIVKQIL 1130
            G++++LC +++KEI K ++
Sbjct: 1119 GETMKLCNVIIKEISKALV 1137

>SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1183

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/1161 (39%), Positives = 708/1161 (60%), Gaps = 46/1161 (3%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            M++  V+  DV  YTPIS S+R+H+ +QL NG+  LLIS+P E   S   SVATGSHNDP
Sbjct: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
             E+ GLAH CEHMI+S+ SK +P  + YHD++ +  G+QNAFTTGEQT+F FE+PN +N 
Sbjct: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSN- 119

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
            + + +FD+++ + +     P+F    +NKEI AI++EH  NK+   K  YH T+ LA   
Sbjct: 120  SDELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGD 179

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240
              FS+FSTG+I TL+   I+    ++L+  + K++ +NF AEN+ + I+G QSL+ L KL
Sbjct: 180  HPFSQFSTGDITTLSD--ILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKL 237

Query: 241  VQTTFGD---------FRTKS----TIKSQSFS-------IESFKKLQKVWAARYTE-PL 279
            V + F D          RTK+     +KS++FS       +ESFK L + W  +Y    +
Sbjct: 238  VFSKFNDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGI 297

Query: 280  FSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIH 339
            F+    +  N++L+ S K P LRL+FP+ H+    ++ E+ + S+ W +LFGDES GS+ 
Sbjct: 298  FTG--CDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLC 355

Query: 340  SKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSID 399
                  + +T     +S F ++D  L+L+  LTN+GWK  ++ ++   F  ++P      
Sbjct: 356  HFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKN-LQMIVAVFFNKYVPIVIECG 414

Query: 400  PDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSELL---QCEDPQFILNNSIAFSC 456
              E+A++L+E N I LL+F+YQD+  S+M++CS+L S LL   +   P FIL  +    C
Sbjct: 415  TYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDC 474

Query: 457  NRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQVP 516
            N   S++GS+ ES +S+ WW   A KF SF+K ++++ N +L+ +GDL+    +K+    
Sbjct: 475  NEIDSELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTS 534

Query: 517  TNVKFDEHYRFQYELSLIKLNHVKMSPKD----FRLPSSTAFLFGLEKNLSALKQSLTAV 572
              +  + +Y F+Y       ++ K++ ++    F +P    FL  +  NLS +K +L A 
Sbjct: 535  LKLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLAS 594

Query: 573  LRKSQGSALSIITQSKLLQTTPRLMSKNENYELWVKEEN-SLEYSSRSVITIELINMGME 631
              +SQ +ALS+ +Q+      P+L+ KN  YE+WVKEE+  L + S+S++T E+I+  + 
Sbjct: 595  SNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLN 654

Query: 632  PSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMI 691
            P    TM LEIL +LL   ++  LYPSE++GY Y+IAA+++GDVR+  T++GF +GV  I
Sbjct: 655  PEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKI 714

Query: 692  LQIIMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXXXXXX 751
            ++ I+  +V I   +  I   +FR SRI VR KYEEAA  NS TL ++G+          
Sbjct: 715  IEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWR 774

Query: 752  XXXXXDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMD-GIIHHLSGP 810
                 +ALE  D+ESFK F  D +   S YMNL IQGD +  + +N ++D  +  HLS  
Sbjct: 775  LESRLEALESTDMESFKQFLSDFF-GNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSK- 832

Query: 811  NVNQTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLF 870
               + +V  L EP +  L  GSN FI    FK+DP NS+VYFI+TGDRT+   YT+++  
Sbjct: 833  --KRDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFT 890

Query: 871  EYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLE 930
             + +S+TLVPDLR +KQ+GY+V            +HI++ S+ PPH +E++I EYL YLE
Sbjct: 891  AFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLE 950

Query: 931  TNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNYPSNLQS 990
             ++L  +    F++  +++Y+ +I S  +EK  +   P NLM++I+A+V SG    NL  
Sbjct: 951  KDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSG----NLDR 1006

Query: 991  QGYTVGQHKKLKDEISFRTYAFSETK--VDVCLLSKLTLQEFKRLFMEKISILSLQRRKL 1048
             G T+  H++++ +IS + Y F +    +D+ L+  L    + + F +KISI S  R K+
Sbjct: 1007 VGRTMKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKI 1066

Query: 1049 SVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFKELFHHF 1108
            SV   +PM++ +I    + +QL+ FLK KGF I+ ++LQ+IV K+ GKPT L KELF +F
Sbjct: 1067 SVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYF 1126

Query: 1109 RTQGQSLRLCTLVLKEIVKQI 1129
             ++G+SL++CT++LKEI +Q+
Sbjct: 1127 ASRGESLKICTVMLKEITRQL 1147

>Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/1167 (38%), Positives = 680/1167 (58%), Gaps = 49/1167 (4%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            M+   V   +V  + P+S SNRAH+  +L NGI ALLISDP ++ +S   SV TGSHNDP
Sbjct: 1    MSLREVTNYEVSFHIPLSYSNRAHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
             ++PGLAHLCEHMI+S+ SKK+P    +H L+ + NG+QNA+TTGEQT+FYFE+PN+ N 
Sbjct: 61   MDIPGLAHLCEHMILSAGSKKYPDPGLFHALIAKNNGSQNAYTTGEQTTFYFELPNTQN- 119

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
             G+  F+ ++ V A     P+F    I+KEI AI +EHE N +  +K  YH  + LA   
Sbjct: 120  NGEFAFESILDVFASFFKDPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANSD 179

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240
              FSRFSTGNI++L+  P +  K INLK+ L  ++  NF  ENI++ IRGSQS++ L KL
Sbjct: 180  HPFSRFSTGNIHSLSSIPQL--KKINLKSSLNTYFRSNFFGENITLCIRGSQSVNILTKL 237

Query: 241  VQTTFGDFRTKSTIKSQSFSI-------------------------ESFKKLQKVWAARY 275
              + FGD + KS +K + FSI                         E FK L  VW  +Y
Sbjct: 238  AISKFGDVKPKSIVKERHFSIGKGPFRKSTSLRRSLNSPKNDYRNLEDFKILDTVWEKKY 297

Query: 276  TEPLFSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESS 335
               +  +  PE  NSI I S+K P++R +FPVS +   F++ ++KI+S +W +LFGDES 
Sbjct: 298  QNTMCFQHAPEC-NSIFINSNKMPVMRFLFPVSDRNTRFTKDDIKIYSHLWCELFGDESP 356

Query: 336  GSIHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFF 395
            GS+     +R  +T+     S+F I D GL+L+ ELTNSGWK+ ++++ T +F   LP F
Sbjct: 357  GSLSHYLVSRGWITKCFAFTSEFAIGDIGLILELELTNSGWKS-IKNITTTIFSELLPSF 415

Query: 396  QSIDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCS---ELLQCEDPQFILNNSI 452
               + D +  +L E N I+L +F+YQ  +N  M++CS+L S   E L+C  P  +     
Sbjct: 416  YVKNIDHLVTFLKEQNLIDLARFLYQSSENLPMEECSNLSSFLQENLECLTPSNVFKGFK 475

Query: 453  AFSCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKS 512
            +        +I  Y E+  +  WW  QA KF +F+K++M  +N +L+ LGD++S+     
Sbjct: 476  SL-IEIDDPNIEKYEETKANVRWWTGQAIKFQNFLKSHMKHDNTRLLLLGDIKSHKIFHI 534

Query: 513  RQVPTNVKFDEHYRFQYELSLIKL-NHVKMSPK---DFRLPSSTAFLFGLEKNLSALKQS 568
             +  + ++ D  Y F+Y    + L    K  PK   +F  P S  FL     +   L+Q 
Sbjct: 535  IENKSEIRTDFFYEFEYYTGSVHLAEENKYYPKSSYEFNFPKSNLFLPDYISDPLKLRQL 594

Query: 569  LTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELWV-KEENSLEYSSRSVITIELIN 627
                  KS+ + L     S+  +  P+L+S+N NYE+W+ KE+ +   +++SV++ E++ 
Sbjct: 595  FLECSLKSKFATLRPQIYSEPTRREPQLVSENLNYEMWILKEDPNFASNNKSVVSFEVLG 654

Query: 628  MGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQG 687
            +G++PS + T++LE+L Q+L+   +  LYP+ R+GY Y+IA++++G V L  TI+GFP+G
Sbjct: 655  LGIKPSPEATIHLEVLAQVLFIITSSHLYPALRIGYTYEIASSSKGSVTLRFTISGFPEG 714

Query: 688  VAMILQIIMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXX 747
            V  I++  +D +  I      ++    R +RI VR+KYE A+  N   LAS+G+      
Sbjct: 715  VFKIVKTFVDTLKLIATDPTFLSKDTLRKARIFVRSKYESASSDNCVKLASIGLLIVLEE 774

Query: 748  XXXXXXXXXDALEDIDIESFKMFCKDLWI-PKSNYMNLVIQGDLSIAETVNQYMD-GIIH 805
                     +ALE  ++ESFK FC   W  PK   + L++QG L  A+ +N Y++     
Sbjct: 775  FIWTLQDRINALELTEMESFKEFCSLFWKNPKQ--LVLLVQGSLDYADEINHYLNRNFTQ 832

Query: 806  HLSGPNVNQTSVFRLR-EPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDY 864
            HL   N    S   L   P T  L +G+N FI     ++DP NS+VYFI+T  R +  + 
Sbjct: 833  HLKVCNEGSKSTIHLYPSPSTKNLDEGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIENL 892

Query: 865  TMSSLFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEE 924
             ++ L EY  S+TLVPDLRN+KQIGY+V            IH++VMS    H +E +I E
Sbjct: 893  ALTFLTEYLFSLTLVPDLRNRKQIGYIVLGGLRVLTDTVGIHVTVMSGSSAHNLETKINE 952

Query: 925  YLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNY 984
            YL YLE  VL  +TE +F+  +L+ ++ L+K NS+ K  ++AGP +L+ +I A+V +G+ 
Sbjct: 953  YLSYLELQVLDNLTEIDFRKMLLEPFLTLLKQNSITKFEESAGPVDLLNEIVANVQNGD- 1011

Query: 985  PSNLQSQGYTVGQHKKLKDEISFRTYAFSE--TKVDVCLLSKLTLQEFKRLFMEKISILS 1042
              N       + QH+K++++I+ +   F E    V++  L KLTL+++ R F  KISI S
Sbjct: 1012 --NYTLNNRQMKQHRKVRNKITEKRLNFQEEYEMVNIPFLQKLTLKKYLRFFQAKISIYS 1069

Query: 1043 LQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFK 1102
             QR K+S+   +PM +  I    + +QL+ FLK KGF I  ++L++IV  + G P  L K
Sbjct: 1070 TQRSKISIMIASPMAEEKIASRRIFLQLEAFLKIKGFAIKNEDLKKIVEHSEGSPMLLVK 1129

Query: 1103 ELFHHFRTQGQSLRLCTLVLKEIVKQI 1129
             LF HFR + ++ +L T+VL+EI+K I
Sbjct: 1130 NLFTHFRKRNEAFKLGTVVLQEILKII 1156

>Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/1172 (37%), Positives = 684/1172 (58%), Gaps = 55/1172 (4%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            M+   V   +VPIY P+S SNR H+  +L NGI ALLISDP ++ +S   SV TGSHNDP
Sbjct: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
             +  GLAHLCEHMI+++ SK++P    +H L+ + NG+QNA+TTGEQT+FYFE+PNS + 
Sbjct: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQS- 119

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
             G+  F+ ++ V A    +P+F    I+KEI AI +EHE N +  +K  YH  + LA   
Sbjct: 120  NGEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSD 179

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240
              FSRFSTGNI++L+  P +  K INLKN L  ++ +N+  ENI+I IRG QS++ L KL
Sbjct: 180  HPFSRFSTGNIHSLSSIPQL--KKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKL 237

Query: 241  VQTTFGDFRTKSTIKSQSFSI-------------------------ESFKKLQKVWAARY 275
              + FGD + K++++  +FSI                         ESFK L+ VW  +Y
Sbjct: 238  AISKFGDIKPKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWEEKY 297

Query: 276  TEPLFSK--QEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDE 333
                 SK  + P   N+I I S+K+P++R +FPVS +   F++ ++KI+S +W +LFGDE
Sbjct: 298  KN---SKCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDE 354

Query: 334  SSGSIHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLP 393
            S GS+ S   +R  +T+     S+F I + GL+L+ ELTNSGW++ ++ + T +F   LP
Sbjct: 355  SPGSLGSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWES-IKDITTTIFSKLLP 413

Query: 394  FFQSIDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSELLQCEDPQFILNNSI- 452
             F   + D +  +L E N I++ +F+YQ  ++  M++CS+L S +LQ E+ +++  +++ 
Sbjct: 414  SFYVKNIDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNL-STILQ-ENLEYLTPSNVF 471

Query: 453  -AFSCNRKGSD--IGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDF 509
              F    +  D  I  Y  S  + +WW  QA KF +F+K++M+  N +L+ LG+++S + 
Sbjct: 472  KGFKSLIEIDDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEV 531

Query: 510  LKSRQVPTNVKFDEHYRFQYELSLIKLNH----VKMSPKDFRLPSSTAFLFGLEKNLSAL 565
                +  + +  D  Y F+Y    + L         S  +F  P+S  FL     +   L
Sbjct: 532  FDKIEKRSEMYTDFFYEFEYYTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKL 591

Query: 566  KQSLTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELWV-KEENSLEYSSRSVITIE 624
            +Q       KS+ + L    QS+  +  P+L+SKN NYE+WV KE+ +    ++S+++ E
Sbjct: 592  QQLFLECSLKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFE 651

Query: 625  LINMGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGF 684
            ++ +G++PS + T++LE+L Q+L+   +  LYP+ RVGY Y+IA++++G+V L  TI+GF
Sbjct: 652  ILGLGIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGF 711

Query: 685  PQGVAMILQIIMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVXXX 744
             +GV  I +  +D +  I      ++    R +RILVR KYE A+  N   LAS+G+   
Sbjct: 712  SEGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIV 771

Query: 745  XXXXXXXXXXXXDALEDIDIESFKMFCKDLWI-PKSNYMNLVIQGDLSIAETVNQYMDG- 802
                        DALE  +  SFK FC   W  PK   + L+IQG+L  A+ +N Y++  
Sbjct: 772  LEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKR--LVLLIQGNLEYADEINHYLNNN 829

Query: 803  IIHHLSGPNV-NQTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNP 861
               HL   N  N+ ++     P T  L +G+N F+     ++DP NS+VYFI+T  R + 
Sbjct: 830  FTQHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDI 889

Query: 862  VDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDR 921
               T++ L EY  S+TLVPDLRNKKQIGY+V            IHI+VMS  P H +E++
Sbjct: 890  ESMTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENK 949

Query: 922  IEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHS 981
            I EYL YL+  VL   TE++F+  +L+ ++ L+K NS  KL  ++GP NL+ +I A+V +
Sbjct: 950  INEYLSYLQLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQN 1009

Query: 982  GNYPSNLQSQGYTVGQHKKLKDEISFRTYAFSE--TKVDVCLLSKLTLQEFKRLFMEKIS 1039
            G+   N       + QH+K++++I  R ++F +     D+  L  LTL+ +   F  KIS
Sbjct: 1010 GD---NYTLNNRQMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKIS 1066

Query: 1040 ILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTS 1099
            I S QR KLS+   +PM + DI    M +QL+ FLK KGF I  ++L+ IV  + G P  
Sbjct: 1067 IYSRQRSKLSIMITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVL 1126

Query: 1100 LFKELFHHFRTQGQSLRLCTLVLKEIVKQILA 1131
            L K LF  FR + ++ +L  +VL+EI K I+ 
Sbjct: 1127 LIKNLFTSFRRRNEAFKLGAVVLQEISKIIIV 1158

>YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Haploid
            specific endoprotease that performs one of two N-terminal
            cleavages during maturation of a-factor mating pheromone;
            required for axial budding pattern of haploid cells
          Length = 1208

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1167 (37%), Positives = 674/1167 (57%), Gaps = 49/1167 (4%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            M+   V   +V  Y P+S SNR H+  +L NGI AL+ISDP ++ +S   +V TGSHNDP
Sbjct: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
             ++ GLAHLCEHMI+S+ SKK+P    +H L+ + NG+QNAFTTGEQT+FYFE+PN+ N 
Sbjct: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQN- 119

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
             G+  F+ ++ V A     P+F    I+KEI AI +EHE N +  +K  YH  + LA   
Sbjct: 120  NGEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPD 179

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240
              FSRFSTGNI++L+  P +  K I LK+ L  ++ +NF  ENI++ IRG QS++ L KL
Sbjct: 180  HPFSRFSTGNIHSLSSIPQL--KKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKL 237

Query: 241  VQTTFGDFRTKSTIKSQSFSI-------------------------ESFKKLQKVWAARY 275
              + FGD + KS +K +S SI                         ++FK L   W  +Y
Sbjct: 238  ALSKFGDIKPKSAVKERSISIRTRSFRRSKSLKKRQDSSKNDYSDLKTFKILNTTWEKKY 297

Query: 276  TEPLFSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESS 335
               +  +Q PE  NSI I S+K PI+RL+FPVS +   F++ ++KI+S +W +LFGDES 
Sbjct: 298  KNTMCFQQFPEC-NSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESP 356

Query: 336  GSIHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFF 395
            GS+    +++  LT      S+F I D GL+L+ ELTNSGW+  ++ + T +    LP F
Sbjct: 357  GSLSYYLASKGWLTGCFAFTSEFAIGDIGLILELELTNSGWE-NIKRITTIVLNRLLPSF 415

Query: 396  QSIDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSEL---LQCEDPQFILNNSI 452
              ++ D +  +L E N I+L+ F+YQ  ++  M++CS L   L   L+C  P  I     
Sbjct: 416  YVMNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFK 475

Query: 453  AFSCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKS 512
            +        +I  Y  +  + +WW  QA KF +F+K++M+ +N +L+ LG+++S +    
Sbjct: 476  SL-IEIDDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDK 534

Query: 513  RQVPTNVKFDEHYRFQYELSLIKL----NHVKMSPKDFRLPSSTAFLFGLEKNLSALKQS 568
             +  +++  D  Y F+Y  + + L         S  +F  P+   FL     +   L+Q 
Sbjct: 535  MKNKSDICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQL 594

Query: 569  LTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELWV-KEENSLEYSSRSVITIELIN 627
                  KS+ + L     S+  +T P+L+S+N+NYE+W+ KE+ +    ++SV++ E++ 
Sbjct: 595  FLECSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLG 654

Query: 628  MGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQG 687
            +G++PS + T++LE+L Q L+   +  LYP+ R+GY Y+IA++++G+V L  TI+GFP+G
Sbjct: 655  LGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEG 714

Query: 688  VAMILQIIMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXX 747
            V  I++  +D +  I      ++    R +RILVR KY+ A+  N   LAS+G+      
Sbjct: 715  VFTIVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEK 774

Query: 748  XXXXXXXXXDALEDIDIESFKMFCKDLWI-PKSNYMNLVIQGDLSIAETVNQYM-DGIIH 805
                     +ALE  ++ESF+ FC   W  PK  ++ L +QG L  A+ +N+Y+ +    
Sbjct: 775  YIWTLEDRINALELTELESFEKFCFLFWRNPK--HLVLFMQGSLEYADAINRYLNNNFTQ 832

Query: 806  HLSGPNVNQTSVFRLREPETIK-LAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDY 864
            HL   N       RL  P + K L QG+N FI     ++DP NS+VYFI+T  R +  + 
Sbjct: 833  HLKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNL 892

Query: 865  TMSSLFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEE 924
            T++ L EY  S+TLVPDLRNKKQIGY+V            IHI+VMS    H +E RI E
Sbjct: 893  TLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINE 952

Query: 925  YLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNY 984
            YL YL+  VL   TE +F+  +L+ ++ L+K NS ++   +AGP +L+ +I A+V +G+ 
Sbjct: 953  YLSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGD- 1011

Query: 985  PSNLQSQGYTVGQHKKLKDEISFRTYAFSETK--VDVCLLSKLTLQEFKRLFMEKISILS 1042
              N       + QH+K++++I+     F E    +D+  L KLTL+++   F  KISI S
Sbjct: 1012 --NYTLNNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYS 1069

Query: 1043 LQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFK 1102
             QR KLS+   +PM + +I    M +QL+ FLK  GF I  ++L++IV  + G P  L K
Sbjct: 1070 AQRSKLSIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVK 1129

Query: 1103 ELFHHFRTQGQSLRLCTLVLKEIVKQI 1129
             LF +FR + +  +L T+VL+EI+K I
Sbjct: 1130 NLFTYFRRRNEVFKLGTVVLQEILKII 1156

>Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR122W
            (REAL)
          Length = 1218

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/1181 (37%), Positives = 674/1181 (57%), Gaps = 62/1181 (5%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            M+   V   ++P Y P+S  NR H+  +L NGI AL+ISDP +S +S   SV TGSHNDP
Sbjct: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILALIISDPTDSSSSCSLSVCTGSHNDP 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
            +++PGLAHLCEHMI+++ SKK+P    +H L+ + NG+QNAFTTGEQT+FYFE+PN+ + 
Sbjct: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQS- 119

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
             G+  F+  + V A     P+F    I KEI AI +EHE N +  +K  YH  + LA   
Sbjct: 120  NGELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANAD 179

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240
              FS FSTGNI++L+  P +    IN+KN L  ++ +NF  EN+++ +RGSQS++ L KL
Sbjct: 180  HPFSHFSTGNIHSLSSVPHLEK--INVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKL 237

Query: 241  VQTTFGDFRTKSTIKSQSFSI-----------------------------------ESFK 265
              + FGD   K+ IK  +FSI                                   E+ K
Sbjct: 238  AISKFGDISLKNDIKGSNFSIKAGSFRRSRSLRRSQDASKTGSPTSESSNTSSYNLENSK 297

Query: 266  KLQKVWAARYTEPLFSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKV 325
                VW  +Y   +   + P   NSI I SSKAPI+R +FPVS +   F++ ++K++S +
Sbjct: 298  ISDTVWEEKYGS-VSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHL 356

Query: 326  WSDLFGDESSGSIHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLT 385
            W +LFGDES GS+     ++   T     +S+F I + GLVL+ ELT +GW++ VES+ T
Sbjct: 357  WRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRS-VESIAT 415

Query: 386  DLFQGFLPFFQSIDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCS---ELLQCE 442
             +F   LP F + + D +  +L E N I++ +F+YQ+ ++  M++CS L     E L+C 
Sbjct: 416  TIFSKLLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECL 475

Query: 443  DPQFILNNSIAFSCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLG 502
             P  I     +        +I  Y  +  + +WW  QA KF +F+K++M+  N +++ LG
Sbjct: 476  TPCNIFKGFKSL-IEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLG 534

Query: 503  DLQSNDFLKSRQVPTNVKFDEHYRFQYELSLIKLN----HVKMSPKDFRLPSSTAFLFGL 558
            D++S++     +  + +  +  Y F+Y +  + L+    +   SP +F  P+   FL   
Sbjct: 535  DIKSHNLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDF 594

Query: 559  EKNLSALKQSLTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELWV-KEENSLEYSS 617
              +   L+Q       KS+ + L    QS+ ++  P+L+SKN NYE+WV KE+ +    +
Sbjct: 595  VNDPLKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDN 654

Query: 618  RSVITIELINMGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRL 677
             SV++ E+I +G++PS + T++LE+L Q+L+   + +LYP+ R GY Y+IA++++G+V L
Sbjct: 655  VSVVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTL 714

Query: 678  AVTINGFPQGVAMILQIIMDKMVDIG-KPDFDITNSMFRHSRILVRTKYEEAARANSCTL 736
              TI+GF +GV  I +  +D +  IG  P F   +++ R +RILVR+KYE A+  N   L
Sbjct: 715  RFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDAL-RKARILVRSKYESASSDNGVKL 773

Query: 737  ASLGVXXXXXXXXXXXXXXXDALEDIDIESFKMFCKDLWI-PKSNYMNLVIQGDLSIAET 795
            AS+G+               DALE  D+ES K FC   W  PK   + L+IQG+L  A+ 
Sbjct: 774  ASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQ--LALLIQGNLDYADE 831

Query: 796  VNQYMDG-IIHHLSGPNVNQTSVFRLR-EPETIKLAQGSNFFIEMTSFKEDPTNSVVYFI 853
            +N Y++     HL   +       RL   P T  +  G+N FI     ++DP NS+ YFI
Sbjct: 832  INHYLNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFI 891

Query: 854  ETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNL 913
            +T  R N  + T++ L EY  S TLVPDLRNKKQIGY+V            IHI+VMS  
Sbjct: 892  QTAQRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGS 951

Query: 914  PPHTIEDRIEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMA 973
              H++E +I EYL YLE  VL   TE+ F+  +L+ ++ L+K N+  KL   +GP+NL+ 
Sbjct: 952  SAHSLETKINEYLSYLEFQVLNNFTESTFRTMLLEPFLALLKKNNFNKLKTLSGPSNLLN 1011

Query: 974  QIEASVHSGNYPSNLQSQGYTVGQHKKLKDEISFRTYAFSETK--VDVCLLSKLTLQEFK 1031
            +I A+V +G+   +       +  H+++++ IS +   F E    VD+  L KLTL+++ 
Sbjct: 1012 EIVANVQNGD---DYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYL 1068

Query: 1032 RLFMEKISILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVT 1091
              F  +ISI S QR KLS+   +PM + +I    M +QL+ FLK KGF I   +L++IV 
Sbjct: 1069 EFFGSRISIYSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVE 1128

Query: 1092 KTAGKPTSLFKELFHHFRTQGQSLRLCTLVLKEIVKQILAV 1132
             + G P  L K LF  FR + ++ +L T+VLKEI K I+A+
Sbjct: 1129 DSKGSPVLLLKNLFTFFRKRSEAFKLGTVVLKEISK-IIAI 1168

>NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1199

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1171 (37%), Positives = 670/1171 (57%), Gaps = 71/1171 (6%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            M+   V+  D P Y P   S+R H+  +L NGI  LLISDP ++ ++   SVATGSHNDP
Sbjct: 1    MSWQDVENYDTPFYIPRCYSDRVHKLCRLPNGILTLLISDPKDTISACSLSVATGSHNDP 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
             ++PGLAHLCEHM++++ SK +P    YH +L + NG QNAFTTGEQT+FYFE+P + N 
Sbjct: 61   ADLPGLAHLCEHMVLAAGSKDYPNAGLYHSMLTKNNGTQNAFTTGEQTTFYFEVPTTQN- 119

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
            +G+ IFD+LV V +     P+F     NKEI AI +EHE N + ++K LYH T+ +A + 
Sbjct: 120  SGELIFDKLVDVFSSFFKEPLFNPLLTNKEIYAIQSEHEGNISSLNKILYHATRLMANKD 179

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240
              FS+FSTGNI TL+  P +  K INLK  L  ++A NF    +++ +RG QS++ L KL
Sbjct: 180  HPFSQFSTGNINTLSSIPQL--KKINLKKALLDYFARNFYGSKMTLCVRGPQSVNTLTKL 237

Query: 241  VQTTFGDFRTKSTIKSQSFS--------------------IESFKKLQKVWAARYTE-PL 279
            V + FGD R  + +K   F                     +E +  L+  W  +Y E P 
Sbjct: 238  VVSKFGDIRANNGLKRSKFGSISSRLSISSFQSKERQPTDLEQYNILKSTWKPKYREAPC 297

Query: 280  FSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIH 339
            F+  + ++ N I I+S+K   LR +FPV  + + FS   + +F   W +LFGDE+ GS+ 
Sbjct: 298  FT-HDSDSANMIFIRSNKQSTLRFLFPVEDKFSKFSSKTVSLFKNFWCELFGDETKGSLC 356

Query: 340  SKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSID 399
                 ++ +T      S+F+    GL+LQF LTN+GW   V+ ++  +    +  F    
Sbjct: 357  YLLVGKSWITDCFAYTSEFSSGSYGLILQFALTNTGWD-NVDKIINIVLDNTIAAFIDKP 415

Query: 400  PDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSD---LCSELLQCEDPQFILNN----SI 452
             D+++ +L E NTI+L++F+YQ  + S M++CS+   L  E L+  D  ++       S 
Sbjct: 416  TDQLSCFLKEQNTIDLIRFLYQPTEKSPMEECSNISCLLQEDLEDLDISYLFKGAPTISD 475

Query: 453  AFSCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKS 512
             +S +    D+  Y      +E W  QA++F  F+K +M+ +N  L  LG+ +    L+S
Sbjct: 476  CYSNDNNTVDMIEY-----EQECWLKQAREFQEFLKVFMNRSNVFLFLLGNEKIAHSLRS 530

Query: 513  RQVPTNVKFDEHYRFQYELSLIKLNHVKMS-PK------DFRLPSSTAFLFGLEKNLSAL 565
                  +    ++     +SL  LN + +  PK       F++P   AF+    ++++ L
Sbjct: 531  ------IIRIRYFLLMQCMSLNILNVIYLRFPKLLSTQYTFQVPPPNAFIPPSCQDVTIL 584

Query: 566  KQSLTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELWVKEENSLEYS--SRSVITI 623
            +Q       KS+ S   +   +  L   P L+S+N +YE+W  + N ++ S   +S+++ 
Sbjct: 585  QQLFLESSLKSRFSTFRLQLLNTNLGNVPHLISRNSSYEMWALD-NPIDASIDKKSIMSF 643

Query: 624  ELINMGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTING 683
            E+ N  M PS +N++NLEIL+Q+L   I+  LYPS R+GY Y+I+++ +GD++L VTI G
Sbjct: 644  EIFNRSMIPSPENSINLEILSQILSTLISPQLYPSIRLGYSYEISSSPKGDIQLKVTIGG 703

Query: 684  FPQGVAMILQIIMDKMVDIGK-PDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVX 742
            F +G+  IL  I+  ++ I K P F  +  + R SR+LVR  YE AA  N  TLAS+G+ 
Sbjct: 704  FSEGIISILDTIVKTLLFIMKTPQFP-SKELLRRSRVLVRNLYEAAASDNCVTLASMGLL 762

Query: 743  XXXXXXXXXXXXXXDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMD- 801
                          +ALE+ID+ SFK FC   ++ +  YMNL+IQG+L   E +N Y++ 
Sbjct: 763  IILERNMWTLQDRLEALEEIDMVSFKEFCVQ-FLEEPMYMNLLIQGNLDYGEEINNYLNT 821

Query: 802  GIIHHLSGPNVN---QTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDR 858
             + HHL   NV    Q+S        TI L  GSNF+ +     +DP NS+VYFI+TG R
Sbjct: 822  NLTHHLECSNVKNEKQSSTL-----STILLEPGSNFYAKYNGHMDDPNNSIVYFIQTGLR 876

Query: 859  TNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTI 918
            TN    T++   EY MS+TLVPDLRNK+QIGY V            IHI+VMS + P  +
Sbjct: 877  TNRRTVTLTYFTEYIMSLTLVPDLRNKRQIGYAVFGGLRELTSTIGIHITVMSGISPSDL 936

Query: 919  EDRIEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEAS 978
            E +I+EY+ YLE  +L ++TE +F     Q Y+ L+ ++   +L K+ GPA+L+ ++ A+
Sbjct: 937  EIKIDEYIAYLEETLLNSLTENQFTLQYKQGYLDLLSNHKFMELEKSGGPADLLNEVVAN 996

Query: 979  VHSGNYPSNLQSQGYTVGQHKKLKDEISFRTYAFSETK--VDVCLLSKLTLQEFKRLFME 1036
            V SGN     +   + +  HK   +EIS + Y F      VD+ ++  LT +EF + F E
Sbjct: 997  VQSGNAD---ELNSHFMKSHKHFFNEISNKRYQFKGDSELVDIEVIKNLTKKEFLKFFRE 1053

Query: 1037 KISILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGK 1096
            K+SI S  R K+SV  ++PM + +I      +QL  FLK +GF I  + L++IV +  G+
Sbjct: 1054 KVSIKSKVRSKISVMIESPMAEMEIVNRKTFLQLQAFLKLEGFTINSEILRDIVERANGR 1113

Query: 1097 PTSLFKELFHHFRTQGQSLRLCTLVLKEIVK 1127
            P++L K+LF +FR + ++LRLCT++LKE+VK
Sbjct: 1114 PSALIKDLFKYFRERNEALRLCTVILKEVVK 1144

>TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3.455
            YPR122W
          Length = 1170

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1154 (36%), Positives = 675/1154 (58%), Gaps = 50/1154 (4%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            M+ + V+ I+VP +TP+S SNR H+  QL NGI  LLISDP ES ++   +VA GS+ND 
Sbjct: 1    MSWSQVKHINVPFFTPLSYSNRTHKLCQLPNGILLLLISDPTESVSACSLTVAAGSYNDS 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
            D+VPG+AHLCEHM+++  SKK+P    YHD++ + NG+ NAFTTGEQT+FYFE+P+  N+
Sbjct: 61   DDVPGVAHLCEHMLLAGGSKKYPSPGCYHDMITKNNGSYNAFTTGEQTTFYFELPDF-NQ 119

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
              +  F++ + + A     P+F    INKEI AI NEH++N + V+K LYH T+ L  + 
Sbjct: 120  APEAGFEKAIDIFASFFSEPLFDHTLINKEIYAIQNEHDSNVSNVTKILYHATRLLGDKS 179

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240
              FSRF+TGN+ +L     + G    L+N+L  H+ +N+    ++I +RG  S++ L KL
Sbjct: 180  HPFSRFATGNMSSLKNTLRLKGP--TLRNLLSNHFRENYAPSRMTICLRGPSSVNGLAKL 237

Query: 241  VQTTFGDFRT-KSTIKSQSFSI--ESFKKLQKVW----AARYTEPLFSKQEPETPNSILI 293
              + FG+ R  K+  K Q+     + F  LQ  W    AA    P   ++     N+I +
Sbjct: 238  AISKFGELRPHKANEKVQAALTPNDGFNILQTRWGHTKAANNCFPSCLER-----NTICV 292

Query: 294  QSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKFSARNILTRQVT 353
             S K PI+R +FPV  +   F++ +  IF + W +LFGDES+GS       +  +T    
Sbjct: 293  DSGKLPIMRFLFPVWQKFTRFTKKDFLIFERFWFELFGDESAGSFCHFLVEKGWITNCYA 352

Query: 354  QLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSIDPDEIAQYLNEWNTI 413
             +S+F+ D+ GL+L+  LTNSGW   +E +   L    +P F      ++A++L+E  +I
Sbjct: 353  YISRFSTDNTGLILELSLTNSGWH-NIELIAQTLIFYLVPKFSREHTVQLARFLSEQFSI 411

Query: 414  NLLQFMYQDLDNSTMDKCSDLCSELLQCEDPQFILNNSIAFSCNRKGSDI--------GS 465
            +L++F+Y + +NS M +CS+LC E+LQ ED      N +  SC   GS +        G 
Sbjct: 412  DLIRFLYSNAENSPMTECSNLC-EVLQ-EDI-----NGLDNSCIFMGSPMVLNEQSTQGL 464

Query: 466  YYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQVPTNVKFDEHY 525
            + E+ +S++WW  QA KF SF+K +M+ +N +LI LG L+      +         D  Y
Sbjct: 465  FSENEESQKWWIGQAIKFQSFLKEFMNHSNMRLILLGCLEDCSLSTTATQGKIAGTDPFY 524

Query: 526  RFQY---ELSLIKLNHVKMSPKDFRLPSSTAFLFGLEKNLSALKQSLTAVLRKSQGSALS 582
             F Y   +LSL K +   ++   F +P    F     +N  +L + L     KSQ ++L 
Sbjct: 525  DFAYFTCKLSLRKPHANILNDYKFSIPPKNEFKPSWAENFPSLMRKLYYSSTKSQQASLG 584

Query: 583  IITQSKLLQTTPRLMSKNENYELWVKEEN-SLEYSSRSVITIELINMGMEPSAKNTMNLE 641
               +S     TP+L+S+NENY++WV  +  +  + S+++++ E+    ++PS +NTMNLE
Sbjct: 585  FAIKSDEGTRTPQLVSQNENYDMWVLSDCPASSHQSKAIVSFEISCWEIQPSPENTMNLE 644

Query: 642  ILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMVD 701
            IL Q++   +   LYPS ++G+ ++I  ++RGDVRL + I+G+ + +  +++ +   +  
Sbjct: 645  ILAQVINLTLASDLYPSLKLGFTFEIYPSSRGDVRLGLVISGYSKRLGKVIESLSSIIRR 704

Query: 702  IGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXXXXXXXXXXXDALED 761
            +       +  +FR +RI VR+ Y++A   +S  +AS+G+               DA+E 
Sbjct: 705  LKSEKSFPSRELFRKARISVRSNYDKAEDNSSINVASIGLLVVMEKYMWSLQDRIDAIEC 764

Query: 762  IDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMD-GIIHHLSGPNVNQTSVFRL 820
            ID+++FK F    +     ++ L IQGDLS A+ +N  +D  + +HL G   +    F+ 
Sbjct: 765  IDLQTFKAFAAS-FADYRKFLRLFIQGDLSHADDINACLDRNLTNHLHGTQTD----FQ- 818

Query: 821  REPE---TIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMT 877
            REPE   T  L   +NF++E    K+DPTNS VY+I+TG R +   YT+++L  Y MS T
Sbjct: 819  REPEYCSTKLLDPATNFYVEYPGRKDDPTNSTVYYIQTGPRDDCTAYTLTALSAYMMSFT 878

Query: 878  LVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAM 937
            L P+LRNK+QIGYVV            +HIS+MS L P  +E++I EYL YLE  VL  M
Sbjct: 879  LKPELRNKRQIGYVVMGGLRLLRNAVGLHISIMSTLEPLALEEKINEYLLYLEREVLTPM 938

Query: 938  TEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNYPSNLQSQGYTVGQ 997
            TE  F++  L+ ++ L    +L+KL K++GPA+LM QI A+V SG+  S++ +  + + +
Sbjct: 939  TEDTFRNKYLKDFLNLQSKGNLDKLRKDSGPADLMDQIVANVQSGD--SDILNSSF-MKK 995

Query: 998  HKKLKDEISFRTYAFS--ETKVDVCLLSKLTLQEFKRLFMEKISILSLQRRKLSVRFKTP 1055
            HK+L+++I+   Y F+  ++ ++  LL +LT+  +   F E+ISI S  R KLSV  K+P
Sbjct: 996  HKRLRNQIADGRYTFADRDSAINTTLLQELTIDHYLCFFRERISIHSKTRAKLSVMVKSP 1055

Query: 1056 MTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFKELFHHFRTQGQSL 1115
            MT  +I    +  Q+D FLK  G  I   +L+E+V ++ GKP  L KEL+  F ++ ++ 
Sbjct: 1056 MTDEEIVNRQIYSQVDAFLKLHGLTIETAKLRELVQRSKGKPMLLAKELYQSFHSRHETW 1115

Query: 1116 RLCTLVLKEIVKQI 1129
            +LCT++L+E++K +
Sbjct: 1116 KLCTVMLRELLKML 1129

>Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON}
            (199457..203098) [3642 nt, 1214 aa]
          Length = 1213

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/1194 (35%), Positives = 675/1194 (56%), Gaps = 82/1194 (6%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            M+ + V+  D+P YTPIS   R ++  +L NG+  LLISDPGES      SVATGSHNDP
Sbjct: 1    MSWSEVKNYDIPFYTPISYRGRTNKLCRLPNGMLVLLISDPGESSFGCSLSVATGSHNDP 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
             E+PGLAHLCEHMI+++ SKK+P    YH+L+ +  G QNA+TTGEQT+FYFE+PN N +
Sbjct: 61   KEIPGLAHLCEHMILAAGSKKYPNPGLYHELIAKNKGLQNAYTTGEQTTFYFELPNVN-Q 119

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
            T  P+F++++ V A     P+F     +KEI AI++EH  N +  +K  YH  + LA   
Sbjct: 120  TSTPVFEDIIDVFASFFKDPLFNQTLTSKEIYAIESEHTGNTSNPTKIFYHAERLLANSN 179

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240
              FS FSTGNI TL+  P +  + INLK++L  ++  NF AEN+++ I+G QS++ L K+
Sbjct: 180  HPFSHFSTGNINTLSSGPQL--RKINLKSLLDSYFKVNFKAENMTLCIKGPQSVNILTKI 237

Query: 241  VQTTFGDFRTKSTIK-------------------------------------SQSFSIES 263
                F D +  ++IK                                       + S+ S
Sbjct: 238  AIRYFSDIKGLNSIKKPKRFGTIRKSISTSEKSIPLSPSSPTSCKSISSVLSETNSSLLS 297

Query: 264  FKKLQKVWAARYTEPLFSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFS 323
             K L+ VW+ +Y   +    +P+  N+I+++S+K P+LRLVFPV   +  FS+ EL  F 
Sbjct: 298  TKILENVWSPKYNNMVCFDPKPKY-NTIIVKSNKKPVLRLVFPVVTNKGKFSKEELITFC 356

Query: 324  KVWSDLFGDESSGSIHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESL 383
             +W +  GDES  SI +       +T  +   S F +++ GL+L+F LT+ G    V  +
Sbjct: 357  NLWCETLGDESENSICNILMNEEYITDILAFTSDFALNNIGLILEFSLTDKGL-NNVSHI 415

Query: 384  LTDLFQGFLPFFQSIDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSELLQCE- 442
            +  + +  +P       +E+A++L+E ++I+LL F++++ + S M++CSDL S L+Q + 
Sbjct: 416  INSIMESAIPKLSKEYTEELARFLSECDSIDLLNFLHKESELSPMEECSDL-SGLMQTDL 474

Query: 443  ---DPQFILNNSIAFSCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLI 499
                P+ +   S     N+  + IG++ ES +S++WW ++A  +  F++ YM+ +  ++ 
Sbjct: 475  DILKPECLFKQSPMIVGNKYPT-IGNFGESSESRQWWLNKATMYQEFLEMYMNKDLLRIA 533

Query: 500  FLGDLQSNDFLKSRQVPTNVKFDEHYRFQYELSLIKLNHV-KMSPKD-------FRLPSS 551
             L D     +         +  D  Y F Y    IKL+ + +  P+D        + P+ 
Sbjct: 534  LLCDFSEKQYFGKNVSEQKLVTDTFYEFDY----IKLSVLPEKVPEDQVDIFSNLKFPAK 589

Query: 552  TAFLFGLEKNLSALKQSLTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELWVKEEN 611
              ++  L ++L  L++ L  V  +S+   LS+ T SK  +  P+L  K + YE+WV E+ 
Sbjct: 590  NEYIPELGRSLLYLREMLKKVSYESRSPILSLTTPSKATRPIPKLAEKGDMYEMWVMEDK 649

Query: 612  -SLEYSSRSVITIELINMGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAAN 670
                   ++++T +L+++ + P+ KNTM+LEIL Q+LY  ++  LYPS ++GY Y+IA++
Sbjct: 650  FRPSTEKKTIVTFDLLSLDVPPTPKNTMHLEILGQILYVLLSPKLYPSLKLGYTYEIASS 709

Query: 671  NRGDVRLAVTINGFPQGVAMILQIIMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAAR 730
            ++GDVRL+ T++G+  G+  +++ ++     I   D   +  + R +RIL R KYE AA 
Sbjct: 710  SKGDVRLSFTLSGYSDGLTEVVKTVIKTCFTIAIDDEIPSKRLLRRARILTRRKYESAAA 769

Query: 731  ANSCTLASLGVXXXXXXXXXXXXXXXDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDL 790
             N   LAS+G+               +ALE+ DI SFK FC   ++    Y+NL++QG+L
Sbjct: 770  ENCAKLASVGLIIMLEKYIWPLEDRLNALEESDIHSFKEFCI-AFLRSKKYLNLIVQGNL 828

Query: 791  SIAETVNQYM-DGIIHHL---SGPN---VNQTSVFRLREPETIKLAQGSNFFIEMTSFKE 843
              A  +N+Y+ D   +HL   SG N   V+ +   +L EP       G+N   E     +
Sbjct: 829  KCANEINKYLNDSFTNHLGEKSGKNTKSVDCSKTTKLLEP-------GTNCIFEHFGHPD 881

Query: 844  DPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXX 903
            DP N +VYFI+TG R +     ++S  EY +S+TLVPDLRNKKQIGYVV           
Sbjct: 882  DPNNCIVYFIQTGKRDDKKALALTSFTEYLLSLTLVPDLRNKKQIGYVVFGGMRVLSDTV 941

Query: 904  XIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLI 963
             IHI+VMS   P  +E++I+EYLY+LE+ VL  ++E +F    ++ Y+  +  +S   ++
Sbjct: 942  GIHITVMSGSNPLDLEEKIDEYLYFLESEVLKKLSEEQFGKKFVKDYLSTMGGDSTGDMM 1001

Query: 964  KNAGPANLMAQIEASVHSGNYPSNLQSQGYTVGQHKKLKDEISFRTYAFS--ETKVDVCL 1021
              AGP N++  I A+V +G++      Q  T   H+++K+EI+ + Y FS  + + D+  
Sbjct: 1002 STAGPPNVLDGIAANVQAGDFSVLNSLQMIT---HRRIKNEITSKRYNFSNDDIETDLNF 1058

Query: 1022 LSKLTLQEFKRLFMEKISILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHI 1081
            +  LTL+++ + F E ISI S+ R KLSV   +PM   +I      +QL+GFLK  GF I
Sbjct: 1059 IKHLTLKKYLKFFEENISISSVNRSKLSVAITSPMATQEIMNRKFFLQLEGFLKLNGFTI 1118

Query: 1082 TRDELQEIVTKTAGKPTSLFKELFHHFRTQGQSLRLCTLVLKEIVKQI-LAVTP 1134
              D L+ +V+++ G+P  LFK LF++F  +G+  + C +V  E++K I ++V P
Sbjct: 1119 NNDTLKSMVSESQGRPGKLFKLLFNYFSNRGEGWKFCKIVTSEVLKIIAISVKP 1172

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/1166 (36%), Positives = 681/1166 (58%), Gaps = 57/1166 (4%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            M+   V+  DV + TP+S SNR H+   L NGI  LLISDP ++ ++   +VATGSHNDP
Sbjct: 1    MSWTEVRHHDVQLCTPLSYSNRTHKLCTLPNGIPTLLISDPADTSSACSLTVATGSHNDP 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
              +PGLAHL EHMI+++ SK++P    YH+L+ + NG+QNAFTTGEQT+FYFE+P+++ K
Sbjct: 61   PNIPGLAHLAEHMILAAGSKQYPDPGLYHELISKNNGSQNAFTTGEQTTFYFELPDTH-K 119

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
             G+  FD+++ V A    +P+F S+ INKEI AI+NEH NN +  +K LYH T+ LA + 
Sbjct: 120  QGELEFDKVLDVFASFFKNPLFNSSIINKEIYAIENEHTNNMSRQTKILYHSTRLLANKF 179

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240
              FS+F+TGNI++L     +  + I++K++L  ++A++F A  +++ +RG  S++ L KL
Sbjct: 180  HPFSQFTTGNIFSLDNNSQL--RSISIKSLLVNYFAEHFKANKMTLCLRGPHSVNVLTKL 237

Query: 241  VQTTFGDFRTKSTIKSQSFS-----------------IESFKKLQKVWAARYTE-PLFSK 282
                F D ++++ ++   F                  IES   L+ +W+ RY   P F  
Sbjct: 238  AIAKFSDIKSQNDLQRNKFGSISSKRDSRQPRQGYSKIESSNILENIWSKRYANLPCFV- 296

Query: 283  QEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKF 342
             E +  NSI I+S K P++R +FP+S Q  +F++ E+ +FS  W  LFGDES GS+    
Sbjct: 297  NESKKVNSIFIKSKKKPLVRFLFPLSSQSTIFTQREIILFSNFWCTLFGDESEGSLMHFL 356

Query: 343  SARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSIDPDE 402
              +   T   + +S F +   GLV++  LTNSG    +  ++  LF+  +    +     
Sbjct: 357  VEKGWSTSGHSYVSTFAVGSIGLVIELALTNSGVGQ-ITDIINVLFEKIVKILTTKHTTL 415

Query: 403  IAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCS---ELLQCEDPQFILNNSIAFSCNRK 459
            +A +LNE N I  ++F+Y+ ++   M++CSDL     E +Q  D +++   S + +    
Sbjct: 416  MADFLNEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLDIKYLFKGSPSITQLYS 475

Query: 460  GSDIGSYYES-PKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQVPTN 518
            G +   Y ES    K  W + A KF +F+ T+M++ N +L+FLG       L +++    
Sbjct: 476  GKN--QYSESMTDGKIQWTAYAIKFQNFLLTFMNYENLRLLFLGSNAKETRLITKE-KKR 532

Query: 519  VKFDEHYRFQYELSLIKLNHVKMSPKD------FRLPSSTAFLFGLEKNLSALKQSLTAV 572
            ++F+  + ++++      +  K S         F LPSS  F+    ++ + L+Q+    
Sbjct: 533  IEFETDFFYEFDFYRTFTDFRKCSSDIETENYIFTLPSSNLFIPKSCRSYTYLQQAFQES 592

Query: 573  LRKSQGSALSIITQSKLLQTTPRLMSKNENYELW---VKEENSLEYSSRSVITIELINMG 629
              KS+ ++L    Q + +   P L+S + NYE+W       +S    S++++T ELI+  
Sbjct: 593  SLKSKLASLRPQVQIEKIHFAPTLVSDSPNYEMWTLPCAINSSPSLRSKTIVTFELISTN 652

Query: 630  MEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVA 689
            M PSA++T++LEIL QLL++ ++  LYPS ++GY Y IA++++GDVRL  TI+GF +G+ 
Sbjct: 653  MIPSAESTIHLEILAQLLFYLVSSKLYPSLKLGYSYDIASSSKGDVRLKFTISGFSEGLL 712

Query: 690  MILQIIMDKMVDIGKPDFDI--TNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXX 747
            ++L+ I+  ++ I K   +I  TN + R +R+LVR KY+EA   N   L S+G+      
Sbjct: 713  LVLEEIIQSVLHIAKDKENIYVTNELLRKARVLVRRKYDEACCENCAKLGSVGLLILLES 772

Query: 748  XXXXXXXXXDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYM-DGIIHH 806
                     DALED D+ SFK F  +      NY  L IQG+L  A  ++ Y+ D + HH
Sbjct: 773  FLWTLEDRIDALEDTDMTSFKNFVNEFLFESFNYFTLFIQGNLDRAHEIHHYLNDNLTHH 832

Query: 807  LSGPNVNQTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTM 866
            L   ++    V  L +P T  L +GSNFF+     +EDP N++VYFI++G R++ + YT+
Sbjct: 833  L---DILPEKVI-LNKPRTKILQEGSNFFVAYDGHEEDPNNAIVYFIQSGLRSDSIAYTL 888

Query: 867  SSLFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYL 926
            ++  EY MSMTL+PDLR+KKQIGY+V            +HI+V+S  PP  +ED+I+EY+
Sbjct: 889  TAFTEYLMSMTLLPDLRHKKQIGYIVVGGMRVLVDSIGLHITVVSGTPPQDLEDKIDEYM 948

Query: 927  YYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNYPS 986
             +LE  +LG +TE EF++  +Q Y+ ++   +   L   AG  NL+  I ++V +G Y  
Sbjct: 949  NFLERIILGRLTEEEFRNQYVQNYLDMLNGKNNGTLNGTAGAHNLLNDIVSNVANGEYEI 1008

Query: 987  NLQSQGYTVGQHKKLKDEISFRTYAFSETKVDVCLLSK-----LTLQEFKRLFMEKISIL 1041
               S+   + +HK+L ++IS   ++F +   D+ L+++     LTL+ + + F +KISI 
Sbjct: 1009 LNSSE---MREHKRLWNQISDDDHSFLD---DIELINREVIETLTLKGYMQFFKKKISIH 1062

Query: 1042 SLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLF 1101
            S +R KLSV   +PM + +I    + +QL+ FLK KGF I  ++L+EIV K  GKP+ + 
Sbjct: 1063 SNKRSKLSVMVTSPMPENEIINRKLFLQLEAFLKIKGFAIKSNQLKEIVDKADGKPSVVL 1122

Query: 1102 KELFHHFRTQGQSLRLCTLVLKEIVK 1127
            K L   FR + ++ +L   VLKE++K
Sbjct: 1123 KLLLSEFRERNEAWKLLRAVLKEVLK 1148

>NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1165 (36%), Positives = 672/1165 (57%), Gaps = 58/1165 (4%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            M+   ++  DVP+Y P++ SNR H+   L NG+  LLISDP ++  S   SVA+GSHNDP
Sbjct: 1    MSWQEIKDFDVPLYLPLAYSNRVHKLCLLPNGLLTLLISDPADTVTSCSLSVASGSHNDP 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
             ++ GLAHLCEHMI+++ SK +P    YH+ L + NG  NAFTTGEQT+FYFE+PN ++ 
Sbjct: 61   KDIQGLAHLCEHMILAAGSKSYPDPGLYHETLSKNNGVHNAFTTGEQTTFYFEVPNVHHG 120

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
             G+ +FDE++ + A     P+F     NKEI AI +EH+ N + V+K LYH T+ L+   
Sbjct: 121  -GELVFDEILDIFASFFKEPLFNPLLTNKEIYAIQSEHDGNMSSVTKILYHATRMLSDPG 179

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240
              FS+FSTGN+ TL   P + G  +NL+  L +++  N+ A  +++ +RG QS++ L K 
Sbjct: 180  HPFSQFSTGNMNTLASIPKLQG--VNLQRTLFQYFKKNYYASKMTLCLRGPQSVNILTKY 237

Query: 241  VQTTFGDFRTKSTIKSQSFS-----------------------IESFKKLQKVWAARYTE 277
              + FGD +  + +    F                        +ESF  L++ W  +Y +
Sbjct: 238  ALSKFGDIKENTALTRSRFGSMSSISTKRSSKSSTENHSTKNDLESFNILEESWRQKYCD 297

Query: 278  -PLFSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSG 336
             P F +   E  N I I+SSK P LR++FPV+  +  F++ E+KIF  +W +LFGDE+ G
Sbjct: 298  IPCFPEISKE--NMIFIKSSKQPTLRILFPVTDNKTRFTKGEIKIFGDLWCELFGDETKG 355

Query: 337  SIHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWK---TGVESLLTDLFQGFLP 393
            S+      ++ +T      S F + + GL+++  LT++GW+   T +E +L  L + F  
Sbjct: 356  SLCYYLVGKSWITSCYAYTSSFALGNIGLIIELTLTSTGWENSDTIIEIVLGKLVETFSE 415

Query: 394  FFQSIDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSELLQ----CEDPQFILN 449
             +      E+A ++ + N+I+L++F+YQ    + M++CS+L SELLQ      +  +I  
Sbjct: 416  QYVH----ELANFMEDQNSIDLIRFLYQVPKKNPMEECSNL-SELLQNDLKAPNMAYIFK 470

Query: 450  NSIAFSCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDF 509
             S   +   +G+  G    S  ++EWW  QA KF SF+K +M+ +N ++I LG L+    
Sbjct: 471  GSPPITDMHEGNVGG--INSEHNQEWWIDQAIKFQSFMKKFMNSSNARVILLGSLERIPE 528

Query: 510  LKSRQVPTNVKFDEHYRFQYELSLIKLNHVK-MSPKDFRLPSSTAFLFGLEKNLSALKQS 568
            L  +++   +  +  Y F+Y++S I L   + ++  +F +P    F+    K    L+Q 
Sbjct: 529  LFKKEIQNTLTTEPFYEFEYKISTINLKASQSVNTYEFCIPHKNKFIPSACKGDGVLEQL 588

Query: 569  LTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELW-VKEENSLEYSSRSVITIELIN 627
                  KSQ S L +   S   +  P+L+ +N+ YE+W +KE+ +     +S+++ E+++
Sbjct: 589  FLESSLKSQYSNLHLQINSMSFENKPQLVGRNQRYEMWTLKEDLNSIMDLKSIVSFEVLS 648

Query: 628  MGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQG 687
              M+ S +NT++LEIL Q+++  I+  LYP+ ++GY Y+I+A+++GDV+L  TI GF +G
Sbjct: 649  TDMKGSPENTIHLEILNQIIFTLISPQLYPAIKLGYFYEISASSKGDVQLRFTIGGFSEG 708

Query: 688  VAMI-LQIIMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXX 746
            + M+   II   +     PDF  +  + R +R+LVR+ YE AA  N   LASLG+     
Sbjct: 709  ILMLIEIIIKTIIFITTTPDFP-SKELLRRARVLVRSNYENAAADNCVKLASLGLLIVLE 767

Query: 747  XXXXXXXXXXDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMD-GIIH 805
                      DALED+ + SFK FC+  ++  S Y+ L IQG+LS A+ +NQ+++     
Sbjct: 768  ENMWSLEDRIDALEDVTMASFKEFCQS-FLNGSKYLTLFIQGNLSYADKINQFLNLNFTK 826

Query: 806  HLSGPNVNQTSVFRLR-EPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDY 864
            HL   ++N+ +   L     T  L  G+N F E     +DP NS+VYFI+TG R++    
Sbjct: 827  HL---DINKDTSLPLNAHTSTHILKPGTNIFAEYPGPLDDPNNSIVYFIQTGLRSDTDLC 883

Query: 865  TMSSLFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEE 924
            T++S  EY MS+TLVP+LRNKKQIGY+V            ++I+VMS   P  +E +I+E
Sbjct: 884  TLTSFTEYIMSLTLVPELRNKKQIGYLVMGGLRVLTDTIGVYITVMSGSEPIDLESKIDE 943

Query: 925  YLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNY 984
            Y+ ++E  VL  +TEA F+    Q Y+ L+  N+  K  K +GPANL+ +I  +V  G  
Sbjct: 944  YIAFIENGVLNRLTEATFEREYKQAYLTLLGDNNQNKGGKLSGPANLLNEIVPNVQVG-- 1001

Query: 985  PSNLQSQGYTVGQHKKLKDEISFRTYAFS--ETKVDVCLLSKLTLQEFKRLFMEKISILS 1042
             S+ Q    ++  H++ +++IS + Y F+  E  +D+ L+ KLTL  +   F +KISI S
Sbjct: 1002 -SSDQLNSTSMKLHRRFRNQISDKQYNFTDEELHIDIPLIEKLTLSSYLNFFKDKISIFS 1060

Query: 1043 LQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFK 1102
              R KLS+   + M   DI      +QL+ FLK KGF I +++LQEIV    G  + L K
Sbjct: 1061 PTRSKLSIMITSSMAAKDIINRKTYLQLEAFLKIKGFTIKKEKLQEIVDSADGNSSLLIK 1120

Query: 1103 ELFHHFRTQGQSLRLCTLVLKEIVK 1127
             LF++FR++ +  +LCT+VLKE+VK
Sbjct: 1121 NLFNYFRSRNEGWKLCTVVLKEVVK 1145

>KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1197

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1180 (36%), Positives = 664/1180 (56%), Gaps = 79/1180 (6%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCA-SVATGSHND 59
            MT A VQ  D+    P++ S+R H+  +L NG+ ALLISDP E  AS+C+ +VATGSHND
Sbjct: 1    MTWAAVQNYDIQFRIPLAFSHRTHKLCKLPNGVLALLISDP-EDNASVCSVTVATGSHND 59

Query: 60   PDEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNN 119
            P  VPGLAHLCEHM+ ++ SKK+P    YH  L +  G  NA+TTGEQT+F+  +PN N 
Sbjct: 60   PKGVPGLAHLCEHMLFAAGSKKYPDVDKYHQTLSKTGGTHNAYTTGEQTTFHISVPNMN- 118

Query: 120  KTGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQ 179
            + G+  FD ++ + +  L  P+F S  +NKEI AI +EH++N + +SK LY   + +A  
Sbjct: 119  REGELEFDCILDMFSSFLKEPLFNSTAMNKEIYAIQSEHDSNVSSLSKILYQAIRLMANG 178

Query: 180  RSKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKK 239
               FS+FSTGNI+TL   P+V G  +NL+ +L  ++  NF   NI++ I+GSQS++ L K
Sbjct: 179  NHPFSQFSTGNIHTLKNMPLVTG--MNLRTLLVNYFETNFQPRNITVCIKGSQSVNILTK 236

Query: 240  LVQTTFGDFRT----KSTIKSQSFS--------------IESFKKLQKVWAARYTEPLFS 281
            L  T FG  ++    K  +  +S S              IESF+ L+K W A+Y +    
Sbjct: 237  LALTNFGYIQSSRAAKGNVIRRSISKRDSIRSNGKKLKKIESFRILEKAWKAKYKD---I 293

Query: 282  KQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSK 341
            K   +  N ++I+S+K   +R +FPV+   A F+  ELKIFS +W +LFGDES GS+HS 
Sbjct: 294  KCFDDRNNFMIIKSNKQSTMRFLFPVNESGANFTPKELKIFSGIWRELFGDESKGSLHSY 353

Query: 342  FSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSIDPD 401
            F  ++ +T   T +S FT    GL+LQF LT SGW+  +  +++ +F+G L   +  + +
Sbjct: 354  FIEKSWITETTTYISDFTYGVYGLILQFSLTASGWE-NLREIISKVFKGTLELVRWENLN 412

Query: 402  EIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSELLQC------------EDPQFILN 449
             +++ L E  TI  + ++YQ+ +  + D CS+L +ELLQ             E P  I  
Sbjct: 413  SLSRILFEHTTIEYINYLYQEQEVLSSDFCSEL-TELLQHSLRTPELEYLFKESPNLIEL 471

Query: 450  NSIAFSCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLG-DLQSND 508
            N      N    ++ +   +P    WW  QA KF +F+  +M   N KL  LG +L+ N 
Sbjct: 472  N------NDHSENLMTV--TP----WWFDQAMKFQNFINEFMKVTNVKLFLLGSELKHNA 519

Query: 509  FLKSRQVPTNVKFDEHYRFQYELSLIKLNHVKMSP----KDFRL--PSSTAFLFGLEKNL 562
            F +      +   D +Y F Y  S +    +   P     D+ L  PS   F+    +NL
Sbjct: 520  FFELGSQNKDWSTDAYYGFDYIKSHLNFKQIIDEPCTTVNDYSLALPSKNLFIPQFFQNL 579

Query: 563  SALKQSLTAVLRKSQGSALSI-ITQSKLLQTTPRLMSKNENYELWV----KEENSLEYSS 617
            + L+Q       +S+ + L   +  S L    PRL++++ +YE+W+    KE  S+    
Sbjct: 580  ANLQQIFMEYSLRSRFAVLQPQVPTSMLPNQKPRLVNRSSHYEMWILPIDKEPESVASPD 639

Query: 618  R----SVITIELINMGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRG 673
            R    S +T  + ++ M PS+ NTM+LEIL ++L F +   LYPS ++ Y Y+IA + +G
Sbjct: 640  RIPKQSTVTFSIESLTMTPSSMNTMHLEILGEVLNFLLTSDLYPSLQLSYAYEIATSLKG 699

Query: 674  DVRLAVTINGFPQGVAMILQIIMDKMVDIGKPDFD--ITNSMFRHSRILVRTKYEEAARA 731
            DV+L  TI GF  GV  I   I+  +  IG P     +TNS+ R +RI VR+KYE A+  
Sbjct: 700  DVQLCCTICGFSDGVVKITDYILSTLRLIGDPATANIVTNSLLRKARIQVRSKYEAASSE 759

Query: 732  NSCTLASLGVXXXXXXXXXXXXXXXDALEDIDIESFKMFCKDLWIPKS-NYMNLVIQGDL 790
                LAS+G+               +ALED D+ SF+ FC +  +  S NY+NL +QGD+
Sbjct: 760  ICVKLASMGLLIVLERGMWTLEDRLEALEDSDMSSFQQFCHEFVMNDSGNYLNLFVQGDM 819

Query: 791  SIAETVNQYMDG-IIHHLSGPNVNQTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSV 849
              A+ VN  +   + HHL+    + T     R   T+ L  G N+++E     +DP NS+
Sbjct: 820  RYADEVNCLIHSKLTHHLNSSRCS-TPTTDYRRSTTV-LKPGVNYYVEYPGQGDDPNNSI 877

Query: 850  VYFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISV 909
            V+F++ G R +   +T++    Y M +TLVPDLR KKQIGYVV            +HI+V
Sbjct: 878  VHFVQVGLRNDRAAFTLAHFTAYLMHLTLVPDLRYKKQIGYVVLGGLRIMTDTVGLHITV 937

Query: 910  MSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPA 969
            MS      +ED+I+EY+ YLE  VL A+TE++F++  L+ Y++LI  +++ ++  + GP 
Sbjct: 938  MSAGQCLDLEDKIDEYMMYLEDTVLNALTESQFEEIYLKPYIRLIGEHTVGEMDTSGGPT 997

Query: 970  NLMAQIEASVHSGNYPSNLQSQGYTVGQHKKLKDEISFRTYAFSETK--VDVCLLSKLTL 1027
            NL+++I  +V +G + S L  +G  + +HK+L + I  + Y F +    +D  ++  LTL
Sbjct: 998  NLLSEIYPNVQNG-HSSVL--EGIDMKRHKQLWNLIQAKEYDFLQGNDILDRTVVQGLTL 1054

Query: 1028 QEFKRLFMEKISILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQ 1087
              +   F EK+S  S  R K+S+   +PM + +I    M +Q++ FLK KGF I   EL+
Sbjct: 1055 HRYMTFFKEKLSARSTTRSKISIMIDSPMKREEIMNRQMFLQMETFLKMKGFAIKDTELR 1114

Query: 1088 EIVTKTAGKPTSLFKELFHHFRTQGQSLRLCTLVLKEIVK 1127
            +IV K+ G PT L + L  HF+T+G++ +LC ++ KE+ K
Sbjct: 1115 DIVNKSQGSPTQLLRHLLAHFKTRGENWKLCRVIAKEVGK 1154

>ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1189

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1162 (34%), Positives = 661/1162 (56%), Gaps = 54/1162 (4%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            M +  ++  D+P  TP S   R H+  +L NG+  LLISDP E+ ++   SVA+GSHNDP
Sbjct: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENSSACSLSVASGSHNDP 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
             E+PGLAHLCEHM++++ S+K+P   +YH+++++  G+QNAFTTGEQTSFYFE+PN  + 
Sbjct: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
              +  FDE + V A     P+F S  INKE  AI++EH+ N +   K  Y  T+ LA   
Sbjct: 121  LQEG-FDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGN 179

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240
              FSRFSTGNI TL   P    K +NLKN+L +++ +NF A  +++ +RG QS+H L KL
Sbjct: 180  HPFSRFSTGNISTLNSIP--HLKNLNLKNLLHEYFKENFCASKMTLCLRGPQSIHSLAKL 237

Query: 241  VQTTFGDFRTK-------------STIKSQSFSIESFKKLQKV----WAARYTEPL-FSK 282
              T F   +                + +S +  +E   K   +    W  +Y   L F+ 
Sbjct: 238  ALTKFSLIKNNPQRYRPSPPVSPSKSKRSSNEWVEVNPKEMNISKNTWLPKYRGQLCFTS 297

Query: 283  QEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKF 342
             E E    I I+SSK P +R +FP   +   F+  ++KI + +W +LFGDES GS     
Sbjct: 298  DEQE--KFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWL 355

Query: 343  SARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSIDPDE 402
             ++  +T     +S+  I +  L+L+ +LT +G++  +  +   LF+  +P     +  E
Sbjct: 356  QSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQN-LSHIAKVLFEQAIPALSQKNTLE 414

Query: 403  IAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSEL---LQCEDPQFILNNSIAFSCNRK 459
            +AQ++++ N I+L++F+YQ+ + S M++C +L S +   L+  DP +I   S     + +
Sbjct: 415  LAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGS-PMMIDEQ 473

Query: 460  GSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDF--LKSRQVPT 517
              +IG+Y E+ +S  WW  QA KF SF+K +M  +N +++  G+ + +    L S++   
Sbjct: 474  HHNIGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNSRESQLEELSSQE--- 530

Query: 518  NVKFDEHYRFQY-ELSLIKLNHVKMSPKD--FRLPSSTAFLFGLEKNLSALKQSLTAVLR 574
              + D  Y F+Y +   I    +     D  F++P     +  + K+ S LK+ L    +
Sbjct: 531  -FQVDLFYEFEYFKRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDSSQ 589

Query: 575  KSQGSALSIITQSKLLQTTPRLMSKNENYELWV---KEENSLEYSSRSVITIELINMGME 631
            KSQ + LS    + LL+  P L+S+N  +E+WV    E+ SL    +S+++ E+  + +E
Sbjct: 590  KSQSAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHL--KSIVSFEIFGLDLE 647

Query: 632  PSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMI 691
               +NTMNLEIL Q+++  ++  +YPS ++G+  +I + N+GD+RL  TI+GF + +   
Sbjct: 648  ACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEITS-NKGDIRLGFTISGFSKQLTSF 706

Query: 692  LQIIMDKMVDIGK-PDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXXXXX 750
            ++ I++ +  I + PDF ++    R +RILVR KYE AA  N   + S+G+         
Sbjct: 707  VKSIIETIKRISQDPDF-LSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMW 765

Query: 751  XXXXXXDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMD-GIIHHLSG 809
                  +ALEDID+++FK FC+  ++    Y++L +QGDLS A+ +N+Y+     HHL G
Sbjct: 766  TLEDRLEALEDIDMDNFKQFCQS-FLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGG 824

Query: 810  PNVNQTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSL 869
              + +T         T  L  G+N  ++    K+DP NS++YFI+TG R + + +T+++ 
Sbjct: 825  -GIYETQGKTFTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNF 883

Query: 870  FEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYL 929
              + MS+ L  +LRNK+Q+GY+V            +HI++MS   P  +E +I+EYL+YL
Sbjct: 884  TVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYL 943

Query: 930  ETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNYPSNLQ 989
            E+  L  + E  F    ++ Y+QL+         +++GPA+L++++ A+V  G+    L 
Sbjct: 944  ESQ-LQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGD-SEILS 1001

Query: 990  SQGYTVGQHKKLKDEISFRTYAF--SETKVDVCLLSKLTLQEFKRLFMEKISILSLQRRK 1047
            SQ  T+ +HKKL+ +I    Y F      +D  L+S+++L+++   F   ISI S  R K
Sbjct: 1002 SQ--TMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRSK 1059

Query: 1048 LSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFKELFHH 1107
            +S+   + + + DI    + +QL+ FLK KGF I  DEL++IV ++ GKP  L  EL+  
Sbjct: 1060 ISIMISSSIAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSC 1119

Query: 1108 FRTQGQSLRLCTLVLKEIVKQI 1129
            FRT+  +LRLC+++L E+ K +
Sbjct: 1120 FRTRNDALRLCSVILAELFKML 1141

>TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1202

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/1171 (34%), Positives = 659/1171 (56%), Gaps = 59/1171 (5%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            M+    +T D+  Y P S SNR  +  +L NGI ALLISD   +  +   SVATGSH+DP
Sbjct: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
             ++PG+AHLCEHMI+++ SKK+PK   +H++L   NG+QNAFTTGEQT+FYFE+P S   
Sbjct: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTST-A 119

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
              +  F E++ + +     P+F     NKEI AI++EH+ N +  SK LYH  + L+ + 
Sbjct: 120  IEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKS 179

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240
              F  FSTGNI+TL++  +V  K  NLK +L +++ +N+ + N++I I+G QSL+ L KL
Sbjct: 180  HPFHNFSTGNIHTLSK--VVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKL 237

Query: 241  VQTTFGDFRTK--------STIKSQ----------------------SFSIESFKKLQKV 270
                FGD + K        ++IK Q                      +  +E+FK L   
Sbjct: 238  ALANFGDIKDKDELTKFHINSIKPQKSLRISKSRSSISSCNSFKTNENLDLENFKLLDNA 297

Query: 271  WAARYTEPLFSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLF 330
            W  +Y + +       + N+I + SSK PILRL+FP+S +   F++ ++KI+S +W  +F
Sbjct: 298  WLDKYGDNVCFPTSL-SHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIF 356

Query: 331  GDESSGSIHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQG 390
            GDE+ GS     +  N +T      S F I +  L+L+ +LTN+G K  +++++  L Q 
Sbjct: 357  GDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKK-LQNIIDILLQQ 415

Query: 391  FLPFFQSIDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSELLQCE----DPQF 446
             +        + +A +L E N I++L+F+  D++ + MD+CS+L S LLQ      +P++
Sbjct: 416  VVKLLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSEL-SGLLQENFKLFNPKY 474

Query: 447  ILNNSIAFSCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQS 506
            +   S       +     +      S  +W  QA KF +F+K +M+W N K++ +GD+  
Sbjct: 475  LFYGSEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDE 534

Query: 507  NDFLKSRQVPTNVKFDEHYRFQYELSLIKLNHVKMSPKD--FRLPSSTAFL--FGLEKNL 562
               + +     + K D +Y F+Y+   I     ++ P+D  F  P    +L  FG    L
Sbjct: 535  FKNVLNIVKEMSKKTDLYYEFEYQKLKIS-KKSRICPRDYPFTYPIKNEYLPKFGYNLGL 593

Query: 563  SALKQSLTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELWVKEENSLEYSSRS--V 620
                        ++    +  +++    +   +L+S+N+ ++LWV  +NS +  S S  +
Sbjct: 594  LRNILLNNLESSRTVSFYMPQVSEE---EDQNKLVSQNDMHKLWVNPKNSKDQLSESPCI 650

Query: 621  ITIELINMGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVT 680
            ++ +L+N  ++ S ++TM+LE++ QLL+  +   LYP+  VGY ++I+ + RGDV L+ T
Sbjct: 651  VSFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFT 710

Query: 681  INGFPQGVAMILQIIMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLG 740
            ++GF +G+  I++  ++   ++   D  IT   FR +RILVR KYE+AA  +   LAS+G
Sbjct: 711  LSGFSEGIFKIIKECINIFGELTSSDL-ITKKEFRRARILVRDKYEDAASDSCVKLASVG 769

Query: 741  VXXXXXXXXXXXXXXXDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYM 800
            +               DALE ID+E F  F +  +  ++ +++L I+G+L  A+ +N Y 
Sbjct: 770  LLILLERKMWTLEERIDALELIDLEMFLEFAQKFF--QNLFLSLYIEGNLEYADLINSYF 827

Query: 801  -DGIIHHLSGPNVNQTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRT 859
             D ++HHL+   ++      L+   + KL  G+N + E+    +DP NS+VYFI+TGD +
Sbjct: 828  SDKLVHHLT-KRLDYPKEDTLQSLPSTKLISGTNIYYELEGSVDDPNNSIVYFIQTGDLS 886

Query: 860  NPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIE 919
            N    +++SL  + +S +LVP+LRNKKQIGYVV            +HI++MS+  P  IE
Sbjct: 887  NKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIE 946

Query: 920  DRIEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASV 979
              IE+Y+ YLE ++LG + +  FQ+N L KY+ LI     +   + +GP N+M +I A+V
Sbjct: 947  IEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANV 1006

Query: 980  HSGNYPSNLQSQGYTVGQHKKLKDEISFRTYAFSETK-VDVCLLSKLTLQEFKRLFMEKI 1038
            H G+  + L S+   +  HKK K+E+        E K VD+  L  L L ++ + F   I
Sbjct: 1007 HGGD-SAILNSE--KIKNHKKNKNELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSI 1063

Query: 1039 SILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPT 1098
            S  S +R KLS+  K+PM + ++    + +QL  FLK KGF I  +ELQ+IV +T G+PT
Sbjct: 1064 STNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPT 1123

Query: 1099 SLFKELFHHFRTQGQSLRLCTLVLKEIVKQI 1129
             LFKELF  F+ + +S +  ++VLKEI+K I
Sbjct: 1124 LLFKELFACFKARDESWKFISIVLKEILKVI 1154

>TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/1165 (32%), Positives = 622/1165 (53%), Gaps = 66/1165 (5%)

Query: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
            M+   V+  D+PIY P S+    ++  +L NGI  ++ISDP    AS   SVATGSHNDP
Sbjct: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60

Query: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
              +PGLAHLCEHMI+S+ SKK+P  + YH L+ E NG+ NA+TTGEQT+FYFEIP     
Sbjct: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIP-CLFT 119

Query: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180
            + +  F+ L+ + +     P+F+   +NKEI AI++EH+ N   ++K LYH T+ LA  +
Sbjct: 120  SSESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSK 179

Query: 181  SKFSRFSTGNIYTLTQFPIVAGKIINL--KNVLQKHYADNFVAENISIVIRGSQSLHYLK 238
              FSRFSTGNI TL +      K++    K +L+ ++  N+ A N+++ I+G QS++ L 
Sbjct: 180  HPFSRFSTGNITTLGK----GAKLLKTTSKKLLESYFKTNYNASNMTLCIKGPQSVNVLT 235

Query: 239  KLVQTTFG----DFRTKST-IKS--------QSFS-------------------IESFKK 266
            K   T F       R  +T IKS        Q FS                   +E F  
Sbjct: 236  KYALTYFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHI 295

Query: 267  LQKVWAARYTEPLFSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVW 326
            L   +  +Y +    K+ P   N+I I+S+K PILRL+FP+   +  F++ +L  F  VW
Sbjct: 296  LSNAYNPKYKDIKCFKRNP-NHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVW 354

Query: 327  SDLFGDESSGSIHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTD 386
             +LFGDE+  S+       N++T      S F ++  GLV++  LT +G K   E ++  
Sbjct: 355  CELFGDENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQ-ELIINS 413

Query: 387  LFQGFLPFFQSIDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSEL---LQCED 443
            +    +      +  E+A++L+E NTI++++F+ +  ++++MD+ S++ S L   L    
Sbjct: 414  ICNSAIEKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNR 473

Query: 444  PQFILNNSIAFSCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGD 503
            P F+L     F  +   + I ++ E+  SK WW S+A  F  F+K Y++  N +++FLGD
Sbjct: 474  PSFLL-KEFPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGD 532

Query: 504  LQSNDFLKSRQVPTNVKFDEHYRFQYELSL---IKLNHVKMSPKDFR---LPSSTAFLFG 557
            +++  F    +       D  Y F+Y ++     K N ++     FR   +P    F+  
Sbjct: 533  IETPKFTTLTEDLKVYSTDPFYDFEY-ITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPE 591

Query: 558  LEKNLSALKQSLTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELWVKEENSLEYSS 617
            + K+L+ L  +L A+L++++     II  +  +++ P L+ KN N E WV   + L++SS
Sbjct: 592  IGKSLAILSANLEAILKRNESIGYPIIYNNS-IESKPGLVLKNSNQETWVL-NSPLQHSS 649

Query: 618  --RSVITIELINMGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDV 675
               S+ + E+ N  ++PS  +TM+LE+L QLL   +   LYP+ R+GY Y+I A+  GDV
Sbjct: 650  TESSIFSFEITNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDV 709

Query: 676  RLAVTINGFPQGVAMILQIIMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCT 735
            +L +TI+GF  G+  +LQ I+     I   +  +T+S    +R++ R KYE+AA  NS  
Sbjct: 710  KLMITISGFQSGIMSLLQNIIKICNSISIKNPTVTHSALHRARVMTRRKYEDAASGNSVK 769

Query: 736  LASLGVXXXXXXXXXXXXXXXDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAET 795
            LAS+G+               DALE+ DI SF  FC   +   + Y+   I G   +A  
Sbjct: 770  LASVGLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFF-KSAKYIKSFISGTNELAMK 828

Query: 796  VNQYMDGIIHHLSGPNVNQTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIET 855
            ++  +    H +    ++     +     T  L  G N + +    + D  N + YFI+T
Sbjct: 829  LSHLIYD--HWILSDTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQT 886

Query: 856  GDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPP 915
            G+R N    T++SL +Y M   LV +LRN+KQ+GYVV            +HI++MS   P
Sbjct: 887  GERNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADP 946

Query: 916  HTIEDRIEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQI 975
              +E  I+EY++ LE + +G++ E+ F+   L  ++  ++ ++      N    NL+  +
Sbjct: 947  EDLERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDT-NNPFNNVTNVNLVDDV 1005

Query: 976  EASVHSGNYPSNLQSQGYTVGQHKKLKDEISFRTYAFS---ETKVDVCLLSKLTLQEFKR 1032
             A+V +G+   N ++Q   +  H  LK  I       +      +D+ ++ KLTL+E+  
Sbjct: 1006 VANVQAGD-SVNFETQQMKL--HNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLE 1062

Query: 1033 LFMEKISILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTK 1092
             F   ISI S  R K+S+   + M K +I    + +QL  FLK KG  I RDEL+EIV  
Sbjct: 1063 FFRATISINSKNRSKISIHIISLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEI 1122

Query: 1093 TAGKPTSLFKELFHHFRTQGQSLRL 1117
            + GKP+ L KE+  +F+ + ++ +L
Sbjct: 1123 SEGKPSKLLKEIVKYFKKKDEAKKL 1147

>CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122w AXL1
            protease
          Length = 1181

 Score =  460 bits (1184), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 333/1175 (28%), Positives = 571/1175 (48%), Gaps = 79/1175 (6%)

Query: 6    VQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPG 65
            V+   VP Y P+ + NRA++ +QL NGI  ++ISD  E++ S   +VA GSHNDP  VPG
Sbjct: 5    VKKFWVPFYVPLLHMNRAYKLIQLPNGINVVIISDAEENYNSCSLTVAAGSHNDPATVPG 64

Query: 66   LAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPI 125
            LAHLCEHMI+++ S   P    +H L+ +YNG+ NA+TTGEQTSFYF++P   N  G   
Sbjct: 65   LAHLCEHMILAAGSSNHPTPGLFHSLIAKYNGDMNAYTTGEQTSFYFQVPQVANSEGTLA 124

Query: 126  FDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSR 185
            F+EL+ V +     P+F S+ +NKEI AI +EHENNK    K LY  T+ LA +   FSR
Sbjct: 125  FEELLSVFSSAFKFPLFTSSVLNKEIYAIQSEHENNKTNPGKVLYQATRLLANKNHPFSR 184

Query: 186  FSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTF 245
            F TG++ TL  FP  + + IN++  L  ++ DNF  ENI++ +RG QSL++L KL    F
Sbjct: 185  FCTGDMNTLKTFP--STENINIRKELISYFNDNFYGENITLCVRGPQSLNHLVKLCMQNF 242

Query: 246  GDFRTKSTIKSQ---------SFSIESFKKLQ---KVWAARYTE-PLFSKQEPETPNSIL 292
             D +    + +              E+ K+L     VWA RYT  P F        N IL
Sbjct: 243  NDIKPLPVLPTAIGNNRDSDTELFEETLKRLNILYDVWAPRYTSLPCFHIGYKN--NVIL 300

Query: 293  IQSSKAPILRLVFPV----SHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKFSARNIL 348
            + S      R+V P+    + ++A+F+    ++F+ +  +L G+E  GS        + +
Sbjct: 301  VNSDMEQSFRIVIPLITNDTREDAIFT----EVFTNICVELLGNEEVGSFCHFLKEISWV 356

Query: 349  TRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSIDPDEIAQYLN 408
                   S+F +   G+VL+F+  ++G+ + +E+++  LFQ  +P + ++  D++A+++ 
Sbjct: 357  RECYVYRSEFAVGAAGIVLEFKCFDTGF-SQIENIVNVLFQTLIPMYLNMPSDDLARFIK 415

Query: 409  EWNTINLLQFMYQDLDNSTMDKCSDLCSELLQCEDPQFILNNSIAFSCNRKGSDIGSYYE 468
            E   I  + FMY     S M++ SDL  +L +      + N  I +   +  S + +Y E
Sbjct: 416  EQTIIETIDFMYTWKHLSPMEESSDLSMQLQKD-----LHNRGIKYLLMKSPSFLHNYEE 470

Query: 469  SPKSKE--WWNSQAKKFLSFVKTYMSWNNCKLIF-----LGDLQSNDFLKSRQVPTNVKF 521
              K+++  +W    +KF  F++ +M   N K+I            N F  ++Q+    + 
Sbjct: 471  MSKTEKLHYWPLIVEKFKVFLRRHMILPNAKVIIPTSEPFTKTVRNLFKNAQQMEVTSET 530

Query: 522  DEHYRFQYELSLIKLNHVK-MSPKDFRLPSSTAFLFGLEKNLSALKQSLTAVLRKSQGSA 580
            D +Y F Y +  +     + + P  F  P    F+    +NL  L + L  +  ++  S 
Sbjct: 531  DPYYEFNYSVYSVSFPESRVIFPYQFSFPGPNEFIPPKYRNLDTLLEMLFGISERANFSP 590

Query: 581  LSIITQSK--LLQTTPRLMSKNENYELWVKE------ENSLEYSSRSVITIELINMGMEP 632
            L  I + K    ++ P+L+ + E+ E+W            +    +S +TI+++N  + P
Sbjct: 591  LRPIVRLKNSRARSAPKLVHQTEDVEIWTANIVDGIFSKVVNADIKSYVTIKIVNQCIRP 650

Query: 633  SAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMIL 692
            +  ++++L ++ +++  ++   LY   ++G+ + + A   G +   + + G   G+  IL
Sbjct: 651  TPISSLHLGMMVEIMNMFLLPRLYSCTKLGFSFHLQAALDGSMSFDIVVTGIMAGIIKIL 710

Query: 693  QIIMDKM-VDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXXXXXX 751
            + + D + + + KP + +TN+  R +R+ +R++YE A + +S  + + G+          
Sbjct: 711  EKVTDLIEIIVTKPGYILTNAFIRKARVAIRSRYEAATKGSSVKIGTTGLLVDLEPHVWS 770

Query: 752  XXXXXDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMDGIIHHLSGPN 811
                 DALE+ DIE F  F    +    +          S  + + +Y+   I     P 
Sbjct: 771  FEERVDALEESDIEVFFQFINTFFRTHKHTKVFAQSSSTSNIDKIARYVVQRIVTPGIPE 830

Query: 812  VNQTSVFRLREP-ETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETG--DRTNPVDYTMSS 868
             N   V  +R+   T  L  G    I++     DP N V  ++E    +  +   Y M  
Sbjct: 831  GNDALVECVRDDGHTRMLKPGEERHIKLIGRDNDPNNCVFSYLEMAPLEGISLKQYRMIE 890

Query: 869  LFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLY- 927
              +Y   +TLVP+LRNK+Q+GY V            +++ V+S+  P  IE  IE Y   
Sbjct: 891  FTDYLFQLTLVPELRNKRQVGYAVDGGLVILNNVVGVNVVVVSSTSPEHIEQEIESYYAH 950

Query: 928  ---YLETNVLGAMTEAEFQDNILQKYMQLIKS-NSLEKLIKNAGPANLMAQ-IEASVHSG 982
               YL  NV          D I + Y ++I   + L  L+ +    N+  +  +   +S 
Sbjct: 951  VRQYLSDNV----------DQIWRDYSKIINDRDPLMYLLDHDVWYNIERENSDIPEYSR 1000

Query: 983  NYPSNLQSQGYTVGQHKKLKDEISFRTYAFSETKVDVCLLSKLTLQEFKRLFMEKISILS 1042
            ++ +N Q     V ++K L + +   T   S    D       ++QE+ +     I    
Sbjct: 1001 DHVANCQR----VFKYKDLIELLVVDT-PISGRHPDYT--PPFSMQEYLQFLDSSIGTYK 1053

Query: 1043 LQR-----RKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKP 1097
             +R     R +SV   +PM K D+    +  QL+ FLK KG  I   +L +I+ +  GK 
Sbjct: 1054 HKRHHNGTRSVSVWVYSPMDKRDVFQRQVKYQLESFLKLKGLVIPERDLADIIREAGGKQ 1113

Query: 1098 TSLFKELFHHFRTQGQSLRLCTLVLKEIVKQILAV 1132
            T++FK L+  F+ Q ++ +    V  E  K IL +
Sbjct: 1114 TTMFKLLYRRFKRQNEAGKFVNSVATETFKSILHI 1148

>NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {ON}
           Anc_4.246
          Length = 995

 Score =  139 bits (350), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 87/253 (34%), Positives = 136/253 (53%), Gaps = 15/253 (5%)

Query: 1   MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60
           MTAA+ +  ++    P  +  R+++F++L N + ALLI+DP    A+    V  GS NDP
Sbjct: 25  MTAASYKNHNLSFQKPDLDE-RSYRFIELPNKLKALLITDPKTDKAAASLDVNIGSFNDP 83

Query: 61  DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120
           + +PGLAH CEH++    S+KFP  + Y   L ++ G+ NA+T    T+++FEI N+ + 
Sbjct: 84  EPLPGLAHFCEHLLFMG-SRKFPDENDYSSFLSKHGGHSNAYTGSSNTNYFFEI-NAEHL 141

Query: 121 TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSK--ALYHGTKKLAT 178
            G    D   G        P+F     +KEI A+D+  EN KNL +    +Y   K L+ 
Sbjct: 142 FGA--LDRFSGFFT----GPLFNKNATDKEINAVDS--ENKKNLQNDLWRIYQLDKSLSN 193

Query: 179 QRSKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLK 238
            +  + +FSTGNI TL Q P   G  +N+++ L K Y D++ A  + + I G + L  L 
Sbjct: 194 LKHPYHKFSTGNIQTLKQLPESQG--LNIRDELLKFYDDSYSANLMKLCIIGREDLDTLA 251

Query: 239 KLVQTTFGDFRTK 251
           +     F D + K
Sbjct: 252 QWTADLFNDVKNK 264

>NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {ON}
           Anc_4.246
          Length = 999

 Score =  133 bits (334), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 125/231 (54%), Gaps = 14/231 (6%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R+++F++L N + ALLISDP    A+    V  G+  DP+ +PGLAH CEH++    S+
Sbjct: 49  DRSYRFIELPNKLKALLISDPTTDKAAASLDVNIGAFEDPESLPGLAHFCEHLLFMG-SE 107

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           KFP  + Y   L ++ G+ NA+T  + T+++FEI   N +  K   D   G  +     P
Sbjct: 108 KFPDENDYSSFLSKHGGHSNAYTGSQNTNYFFEI---NYEHLKGALDRFSGFFS----CP 160

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSKA--LYHGTKKLATQRSKFSRFSTGNIYTLTQFP 198
           +F     +KEI A+D+  EN KNL S    +Y   K L+     + +FSTGN+ TL   P
Sbjct: 161 LFNIGSTDKEINAVDS--ENKKNLQSDMWRIYQLDKSLSLLDHPYHKFSTGNLETLKIIP 218

Query: 199 IVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFR 249
               K +N+++ L K Y  N+ A  + + I G + L  L   VQ+ F D +
Sbjct: 219 --ESKNVNVRDELLKFYNANYSANLMKLCIIGREDLDTLSDYVQSFFKDVK 267

>KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa]
           {ON} Anc_4.246 YLR389C
          Length = 996

 Score =  130 bits (328), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 124/232 (53%), Gaps = 14/232 (6%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R++++VQL N + ALLISDP    A+    V  G+  DP+E+PGLAH CEH++    S 
Sbjct: 44  DRSYRYVQLPNNLKALLISDPTTDKAAAALDVNIGAFEDPEELPGLAHFCEHLLFMG-SS 102

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           KFP  + Y   L ++ G+ NA+T  + T++YF++ N  +  G    D   G        P
Sbjct: 103 KFPNENEYSSYLSKHGGSSNAYTGAQNTNYYFQV-NYEHLYG--ALDRFSGFFT----GP 155

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSK--ALYHGTKKLATQRSKFSRFSTGNIYTLTQFP 198
           +F     +KEI A+D+  EN KNL +    LY   K L      + +FSTGN+ TL   P
Sbjct: 156 LFNKESTDKEINAVDS--ENKKNLQNDLWRLYQLDKSLTNGGHPYHKFSTGNLETLGTTP 213

Query: 199 IVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFRT 250
              G  +++++ L K Y  ++ A  + + I G + L  + K V+  F D +T
Sbjct: 214 KELG--LDIRDELLKFYNKSYSANLMKLCILGREDLDTMTKWVEELFQDVKT 263

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 83/384 (21%), Positives = 145/384 (37%), Gaps = 56/384 (14%)

Query: 594 PRLMSKNENYELWVKEENSLEYSSRSVITIELINMGMEPSAKNTMNLEILTQLLYFYINE 653
           P L+S+NE  ++W K+++   +  R  I +         SA N+M   +  QL    IN+
Sbjct: 536 PLLISENETGKVWFKKDDRF-WQPRGYIYLTFKLPHTHASALNSMLSTLYVQL----IND 590

Query: 654 SL----YPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMD--KMVDIGKPDF 707
           SL    Y +            N+G   L +T+ GF   + ++L  +++  K   + +P F
Sbjct: 591 SLKDLQYNANCANLRASFVKTNQG---LDLTLYGFNDKLIILLTRLLEGIKSFKLEQPQF 647

Query: 708 DI---------TNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXXXXXXXXXXXDA 758
            I          N M+      + T Y       S ++                    D 
Sbjct: 648 KIFKDKSVQHLKNLMYEVPYSQISTVYNYLINERSWSVEE----------------KLDV 691

Query: 759 LEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMDGIIHHLSGPNVN--QTS 816
           +E I  E    F   ++  +  Y   +I G+L   E +   +  ++  L   +V   QT 
Sbjct: 692 MEKITYEELINFIPTIF--EELYFEALIHGNLKYEEAME--IASLVKILQPSDVTRLQTK 747

Query: 817 VFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSM 876
             R+R   +  + +G  +  E         NS + ++   D  +      S LF   +  
Sbjct: 748 NSRMR---SYLIPRGETYRYETKLKDAKNVNSCIQYVTQLDVYDEKLSAKSGLFAQMIHE 804

Query: 877 TLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGA 936
                LR K+Q+GYVV            + I + S      +E RI+ + Y     +L A
Sbjct: 805 PCFDTLRTKEQLGYVVFSSSLNNHGTANMRILIQSEHTTPYLEFRIDTF-YQKFGELLNA 863

Query: 937 MTEAEFQDN-------ILQKYMQL 953
           M+E +F  +       +LQKY  +
Sbjct: 864 MSEEDFSKHKNALCKSLLQKYKNM 887

>TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.246
           YLR389C
          Length = 995

 Score =  129 bits (324), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 122/229 (53%), Gaps = 14/229 (6%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R+++F+QL N + AL+I DP    ++    V  G+ +DP+E+PGLAH CEH++    S+
Sbjct: 47  DRSYRFIQLPNDLKALIIQDPTTDKSAAALDVNIGAFSDPEELPGLAHFCEHLLFMG-SR 105

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           KFP  + Y   L ++ G+ NA+T  + T++YF++   N++  K   D   G        P
Sbjct: 106 KFPDENEYSSFLSKHGGSSNAYTGAQNTNYYFQV---NHEHLKGALDRFSGFFT----GP 158

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSK--ALYHGTKKLATQRSKFSRFSTGNIYTLTQFP 198
           +F     +KEI A+D+  EN KNL +    LY   K L+     + +FSTGN+ TL + P
Sbjct: 159 LFSKDSTDKEINAVDS--ENKKNLQNDIWRLYQLDKSLSNPSHPYHKFSTGNLKTLNEIP 216

Query: 199 IVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGD 247
              G  ++++N L   Y+  + A  + + + G + L  L       F D
Sbjct: 217 KSKG--VDVRNELLNFYSKYYSANLMKLCVLGREDLDTLSDWAYELFSD 263

 Score = 36.2 bits (82), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 80/379 (21%), Positives = 143/379 (37%), Gaps = 36/379 (9%)

Query: 594 PRLMSKNENYELWVKEENSLEYSSRSVITIELINMGMEPSAKNTMNLEILTQLLYFYINE 653
           P L+  ++  +LW K+++   +  R  I           S  N+M   +  QL+  Y+ +
Sbjct: 534 PLLLKDDKISKLWYKKDDRF-WQPRGYIYTTFKLPHTHASIVNSMLSTLYVQLINDYLKD 592

Query: 654 SLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMVDIGKPD---FDIT 710
             Y +            N G   L +TI GF   + ++L   ++ +    KPD   F+I 
Sbjct: 593 LQYDASCADLHLSFIKTNEG---LDITITGFNDKLIILLTRFLEGLKAF-KPDRKRFEIF 648

Query: 711 NSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXXXXXXXXXXXDALEDIDIESFKMF 770
               +  + L    YE      S    SL                 + +E +  E  + F
Sbjct: 649 KE--KSKQHLNNQLYEIPYSQVSSLYNSL-----VNERSWTAEEKLEVVEQLTFEQLEAF 701

Query: 771 CKDLWIPKSNYMNLVIQGDLSIAETVNQYMDGIIHHLSGPNVNQTSVFRLREPETIKLAQ 830
              ++  +  +   ++ G++   E     +D +I  L   +V+ + +   R    + L  
Sbjct: 702 IPTIF--EEMFFETLVHGNIKYEEA--DQIDSLIQMLRSNSVSNSQIKNARIRSYV-LPL 756

Query: 831 GSNFFIEMTSFKEDPTNSVV-YFIETGDRTNPVDYTMSSLFEYFMSMTLVP---DLRNKK 886
           G     E         NS + Y I+ G      D  +S++   F  M   P    LR K+
Sbjct: 757 GKTHRYEAKLADTQNVNSCIQYVIQLG----VYDEALSAIGRLFAQMLHEPCFDTLRTKE 812

Query: 887 QIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQDN- 945
           Q+GYVV            I I + S      +E RIE +L       L  M++ +F+++ 
Sbjct: 813 QLGYVVFSSSLNNHGTANIRILIQSEHTTPYLEWRIESFLEQF-GKTLKEMSDRDFENHK 871

Query: 946 ------ILQKYMQLIKSNS 958
                 +LQKY  + + +S
Sbjct: 872 DALCKTLLQKYKNMKEESS 890

>KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1004

 Score =  129 bits (324), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 214/966 (22%), Positives = 387/966 (40%), Gaps = 160/966 (16%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R ++++QL N + ALLISD     A+    V  GS  DP+ +PGLAH CEH++    ++
Sbjct: 59  DRKYRYIQLPNNLKALLISDAEADKAAAALDVNIGSFQDPEHLPGLAHFCEHLLFMG-NE 117

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           K+P  + Y   L ++ G+ NA+T  + T++YF +   N++   P  D   G  +     P
Sbjct: 118 KYPDENDYSSFLSKHGGSSNAYTGSQNTNYYFHL---NHENLYPALDRFSGFFS----CP 170

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSK--ALYHGTKKLATQRSKFSRFSTGNIYTLTQFP 198
           +F  A  +KEI A+D+  EN KNL +    +Y   K L      + +FSTGNI TL   P
Sbjct: 171 LFNKASTDKEINAVDS--ENKKNLQNDIWRMYQLDKSLTNWEHPYHKFSTGNIKTLGDIP 228

Query: 199 IVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFRTKSTIKSQS 258
            + G  I+++N L   + +N+ A  + + + G + L  L   V   F D           
Sbjct: 229 KLKG--IDIRNELLDFHKNNYSANLMKLCVLGREDLDTLADWVYELFKD----------- 275

Query: 259 FSIESFKKLQKVWAAR-YTEPLFSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRS 317
             + +  K    + AR YTE    K     P   L +      +   FP    +  +   
Sbjct: 276 --VPNLNKQVPYYPARLYTESQLKKMVYCKPVKDLKK------IEFTFPTPDMDPYWESK 327

Query: 318 ELKIFSKVWSDLFGDESSGSIHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWK 377
                +   S L G E +GS+ +    +             + D+    ++ +LT+ G  
Sbjct: 328 P----NHYLSHLIGHEGNGSLLAFLKEKGWAVELSAGSHTISKDNAVFGIEIDLTDDG-M 382

Query: 378 TGVESLLTDLFQGFLPFFQSIDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSE 437
             V  ++   FQ +L   +   P+E     NE  + ++  F ++       D  S   S 
Sbjct: 383 NHVNEIIISTFQ-YLEMLKVTLPEEWIH--NELKSTSVSSFKFKQ-----KDPPSSTVSN 434

Query: 438 LLQCEDPQFILNNSIAFSCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCK 497
           + +C + ++I              DI S   +   +E+  S  KK++      ++W N +
Sbjct: 435 MARCLEKEYI-----------PVVDILS---TSLIREYNPSMIKKYVQ----SLNWENSR 476

Query: 498 LIFLGDLQSNDFLKSRQVPTNVKFDEHYRFQYELS------LIKLNHVKMSPKDFRLPSS 551
           ++  G          + +P + K ++ Y  +Y+++      L KL +V ++PK F LP  
Sbjct: 477 IMLTG----------QNLPVDCK-EQWYGTEYKVTDYPESLLKKLPNVGLNPK-FHLPRP 524

Query: 552 TAFL---FGLEK--NLSALKQSLTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELW 606
             F+   F + K  N+  L +                          P L+  +   +LW
Sbjct: 525 NEFICTKFEVNKLDNVKPLDE--------------------------PFLLKDDHYSKLW 558

Query: 607 VKEENSLEYSSRSVITIELINMGMEPSAKNTMNLEILTQLLYFYINESL----YPSERVG 662
            K+++        +     ++M +  +  + +N  +LT L    I ++L    Y +    
Sbjct: 559 YKKDDRFWVPKGHI----YVSMKLPHTFSSVVN-SMLTSLYVDMIKDALVDLQYDASCAD 613

Query: 663 YMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMVDIGKPDFDITNSMF-----RHS 717
               +   N+G   + +  +G+ + + ++L   ++     G   F    S F     R  
Sbjct: 614 LRITLGKTNQG---IDIQASGYNEKLTILLTRFLE-----GIKSFQPKESRFNVIKNRLL 665

Query: 718 RILVRTKYEEAARANSCTLASLGVXXXXXXXXXXXXXXXDALEDIDIESFKMFCKDLWIP 777
           + L   +Y+      S    SL                 D  +D+  E  K F   ++  
Sbjct: 666 QKLSNQQYDVPYNQISNVFNSL-----VNERSWTTKAKLDVTKDLTFEHLKSFVPTIY-- 718

Query: 778 KSNYMNLVIQGDLSI--AETVNQYMDGIIHHLSGPNVNQTSVFRLREPETIKLAQGSNFF 835
           +  +   ++ G+ S+  A  +NQ +D ++     PN+ +    +LR   +  L + S F 
Sbjct: 719 EQLFHESLVLGNFSVEMAYEINQLVDILVVD-RIPNL-EVKNNKLR---SYILPEESAFR 773

Query: 836 IE-MTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVXX 894
            E M   K +  + + Y I+ G  +  +    +SL    +       LR K+Q+GY+V  
Sbjct: 774 YEYMLEDKANVNSCIQYLIQLGAYSEELA-AKASLVSQLIHEPCFDTLRTKEQLGYIVFS 832

Query: 895 XXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQ-------DNIL 947
                     + + V S      +E RI ++L       L  M E  F+        N+L
Sbjct: 833 AVANTHGTTNLRVLVQSERDSAYVESRIVKFLNSF-GEALKEMPEEAFEKHKSGLIKNLL 891

Query: 948 QKYMQL 953
           QK   L
Sbjct: 892 QKLTNL 897

>SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1006

 Score =  125 bits (314), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/231 (31%), Positives = 120/231 (51%), Gaps = 14/231 (6%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R ++F+QL N + ALLI DP    A+    +  G+  DP+ +PGLAH CEH++    S 
Sbjct: 59  DRNYRFIQLPNNLKALLIQDPATDKAAAALDINVGAFEDPENIPGLAHFCEHLLFMGSS- 117

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           KFP  + Y   L ++ G  NA+T  + T++YF++   N++  +   D   G       SP
Sbjct: 118 KFPDENEYSSFLSKHGGASNAYTGSQNTNYYFQV---NHEDLRGALDRFSGFFT----SP 170

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSK--ALYHGTKKLATQRSKFSRFSTGNIYTLTQFP 198
           +F     +KEI A+D+  EN KNL +    +Y   K   +    + +FSTGN+ TL + P
Sbjct: 171 LFNKNSTDKEINAVDS--ENKKNLQNDLWRMYQLDKSFTSPMHPYHKFSTGNLKTLGETP 228

Query: 199 IVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFR 249
              G  +++++ L K Y   + A  + + + G + L  + + V   F D R
Sbjct: 229 KNQG--LDIRDELLKFYNKFYSANIMKLCVLGREDLDTMSEWVYELFKDVR 277

>TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4.246
           YLR389C
          Length = 1041

 Score =  125 bits (313), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/229 (31%), Positives = 117/229 (51%), Gaps = 10/229 (4%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R+++++QL N + ALLISDP    A+    V  G+  DP+ +PGLAH CEH++    S+
Sbjct: 90  DRSYRYIQLPNSLKALLISDPQTDKAAASIDVNVGAFEDPENLPGLAHFCEHLLFMG-SE 148

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           KFP ++ Y   L ++ G+ NA+T    T+++FE+   N++      D   G        P
Sbjct: 149 KFPDQNEYSSYLSKHGGHSNAYTAALNTNYFFEV---NHEHLHGALDRFSGFFT----GP 201

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIV 200
           +  +    KEI A+D+E++ N        Y   K ++     + +FSTGNI TL + P  
Sbjct: 202 LMNADSTEKEINAVDSENKKNLQNDDWRRYQMDKTISNYNHPYHKFSTGNIKTLMEEPTK 261

Query: 201 AGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFR 249
            G  +N +N L K Y  ++ A  + + I G Q L  L       F D +
Sbjct: 262 LG--LNTRNELLKFYNSSYSANIMKLCILGRQDLDTLSNWATEFFKDVK 308

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 79/188 (42%), Gaps = 8/188 (4%)

Query: 757 DALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMDGIIHHLSGPNVNQTS 816
           D LE +  + F  F   ++     Y + ++ G++   E +    + ++  L+   +    
Sbjct: 732 DVLEALTFDQFVSFVPSIY--NEFYFDALVHGNIRYEEAME--ANDLLKSLASFKILNLH 787

Query: 817 VFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVV-YFIETGDRTNPVDYTMSSLFEYFMS 875
           V   R    I L +G ++  E+    +D  NS + + ++ G  T  +   +S LF   + 
Sbjct: 788 VRNSRLRSYI-LPEGESYRYEIDMEDKDNLNSCIQHVVQLGLYTEELS-ALSGLFAQMIR 845

Query: 876 MTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLG 935
                 LR K+Q+GYVV            + I V S      +E RI+E+ Y      L 
Sbjct: 846 EPCFDTLRTKEQLGYVVFSSNLNNHGTANMRILVQSEHSTSYLEWRIDEF-YKKFGESLN 904

Query: 936 AMTEAEFQ 943
            M+E +F+
Sbjct: 905 NMSEEDFE 912

>KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON}
           Anc_4.246 YLR389C
          Length = 1011

 Score =  124 bits (311), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 80/253 (31%), Positives = 130/253 (51%), Gaps = 15/253 (5%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R+++F++L N + AL+I DP    A+    V  G+  DP+ +PGLAH CEH++    S+
Sbjct: 61  DRSYRFIKLPNNLKALVIQDPTADKAAAALDVNIGAFEDPEHLPGLAHFCEHLLFMG-SE 119

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           KFP  + Y   L ++ G+ NA+T+   T++YFE+   N++      D   G        P
Sbjct: 120 KFPDENEYSSFLSKHGGSSNAYTSSLNTNYYFEV---NHEHLYNALDRFSGFFT----CP 172

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSKA--LYHGTKKLATQRSKFSRFSTGNIYTLTQFP 198
           +F     +KEI A+D+  EN KNL +    +Y   K L+  +  + +FSTGN+ TL + P
Sbjct: 173 LFNKGSTDKEISAVDS--ENKKNLQNDVWRIYQLDKSLSNLQHPYHKFSTGNLITLGENP 230

Query: 199 IVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFR-TKSTIKSQ 257
                 +N+++ L K Y  ++ A  + + I G + L  L       F D R T   +   
Sbjct: 231 KSLN--LNIRDELLKFYYHSYSANLMKLCIIGREDLDTLSNWAYKLFKDVRNTNRALPEY 288

Query: 258 SFSIESFKKLQKV 270
           S  I +   LQK+
Sbjct: 289 SSKILNETHLQKI 301

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 83/381 (21%), Positives = 141/381 (37%), Gaps = 38/381 (9%)

Query: 594 PRLMSKNENYELWVKEENSLEYSSRSVITIELINMGMEPSAKNTMNLEILTQLLYFYINE 653
           P L+   +  +LW K+++   +  R  I + L       S  N+M   I  QL   ++ +
Sbjct: 548 PLLLKDTKLSKLWFKKDDRF-WQPRGYIYVSLKLPHTHASVLNSMLSTIYVQLANDFLKD 606

Query: 654 SLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMVDIGKPDFDITNSM 713
             Y +            N+G   L +T++GF   +  ++   +      G  DF  T   
Sbjct: 607 LQYDASCANLNLSFVKTNQG---LDITLSGFNDKLVTLMTRFLQ-----GVKDFKPTEER 658

Query: 714 FR-----HSRILVRTKYEEAARANSCTLASLGVXXXXXXXXXXXXXXXDALEDIDIESFK 768
           F+      ++ L    YE      S    SL                 + +E I  E   
Sbjct: 659 FKIFKDKTTQHLKNLLYEVPYSQISGVYNSL-----INERSWSVEEKLNVVEHITFEQLL 713

Query: 769 MFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMDGIIHHLSGPNVN----QTSVFRLREPE 824
            F   ++  +  Y   ++ G+L   E +   ++ +I+ +   N N    Q    RLR   
Sbjct: 714 AFIPTVF--EELYYETLVHGNLKFEEAIE--IESLINDILITNENHNNLQVKNNRLR--- 766

Query: 825 TIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRN 884
           +  + +G  +  E         NS +  +   D  N     +S LF   +       LR 
Sbjct: 767 SYFIPKGKTYRFEKELKDSKNVNSCIQHVTQLDVYNEELSALSGLFAQMIHEPCFDTLRT 826

Query: 885 KKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQD 944
           K+Q+GYVV            I I V S      +E RIEE+ Y     +L  M+E +F  
Sbjct: 827 KEQLGYVVFSSSLNNHGTANIRILVQSEHTTPYLEWRIEEF-YSKFGAILKDMSEEDFDK 885

Query: 945 N-------ILQKYMQLIKSNS 958
           +       +LQKY  + + +S
Sbjct: 886 HKDALCKSLLQKYKNMGEESS 906

>Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa]
           {ON} YLR389C (REAL)
          Length = 1023

 Score =  123 bits (308), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 128/246 (52%), Gaps = 15/246 (6%)

Query: 4   ATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEV 63
           A  +T D+    P  +  R+++F++L N + ALLI DP    A+    V  G+  DP+ +
Sbjct: 56  ANFKTFDLDFLKPDLDE-RSYRFIELPNKLKALLIQDPKADKAAASLDVNVGAFEDPENL 114

Query: 64  PGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGK 123
           PGLAH CEH++    S+KFP  + Y   L ++ G+ NA+T  + T+++FE+   N++   
Sbjct: 115 PGLAHFCEHLLFMG-SEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEV---NHQHLL 170

Query: 124 PIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSK--ALYHGTKKLATQRS 181
              D   G  +     P+FQ    +KEI A+++  EN KNL +    +Y   K L   + 
Sbjct: 171 GALDRFSGFFS----CPLFQKDSTDKEINAVNS--ENKKNLQNDIWRIYQLDKSLTNSKH 224

Query: 182 KFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLV 241
            + +FSTGNI TL + P   G  +N+++ L K +   + A  + + I G + L  L +  
Sbjct: 225 PYHKFSTGNIETLGESPKENG--LNIRDELLKFHKHFYSANIMKLCILGREDLDTLSEWT 282

Query: 242 QTTFGD 247
              F D
Sbjct: 283 YDLFKD 288

 Score = 35.8 bits (81), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 89/208 (42%), Gaps = 20/208 (9%)

Query: 781 YMNLVIQGDLSIAETVNQYMDGIIHHLSGPNVN--QTSVFRLREPETIKLAQGSNFFIEM 838
           +   ++ G++   E +   +D +I  L   N++  Q S  RLR   +  L +G +F  E 
Sbjct: 735 FFETLVHGNIKHEEAIE--VDSLIKSLIANNIDNLQVSNNRLR---SYLLPKGKSFRYE- 788

Query: 839 TSFKEDP--TNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVXXXX 896
           T  K DP   NS +  +   D  +     +S LF   +       LR K+Q+GYVV    
Sbjct: 789 TDLK-DPKNVNSCIQHVTQLDVYSEELSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSS 847

Query: 897 XXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKS 956
                   I I + S      +E RI  + Y      L  MT+ +F      K+ + +  
Sbjct: 848 LNNHGTANIRILIQSEHTTPYLEWRINNF-YETFGQHLKDMTQEDF-----DKHKEAL-C 900

Query: 957 NSLEKLIKNAGPANLMAQIEASVHSGNY 984
           NSL +  KN    +  A+  A+++ G+Y
Sbjct: 901 NSLLQKFKNMSEES--ARYTAAIYLGDY 926

>AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR389C
           (STE23)
          Length = 1013

 Score =  122 bits (307), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/256 (30%), Positives = 129/256 (50%), Gaps = 18/256 (7%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R +++++L N +  LL+ D     ++    V  G+  DP+++PGLAH CEH++    SK
Sbjct: 66  DRKYRYIELPNHLRVLLVHDKNTDKSAASLDVNVGAFEDPEDLPGLAHFCEHLLFMG-SK 124

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           KFP  + Y   L ++ G  NA+T  + T++YF + + N      ++D L    +     P
Sbjct: 125 KFPNENEYASFLSKHGGASNAYTASQNTNYYFHVNHEN------LYDAL-DRFSGFFSCP 177

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSKA--LYHGTKKLATQRSKFSRFSTGNIYTLTQFP 198
           +F  +   KEI+A+D+  EN KNL +    LY   K L      + +FSTGN  TL   P
Sbjct: 178 LFNESSTEKEIKAVDS--ENKKNLQNDMWRLYQLGKSLTNPIHPYHKFSTGNFETLWSIP 235

Query: 199 IVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFRTKST----I 254
              G  +N+++ L K Y  ++ A  + +VI G + L  L +     F D     T     
Sbjct: 236 RSKG--VNVRDELLKFYNRSYSANLMKLVILGREDLDTLAQWAYELFKDVPNHGTKVPEY 293

Query: 255 KSQSFSIESFKKLQKV 270
            +Q+F+ E   K+ KV
Sbjct: 294 HAQAFTPEHLMKVIKV 309

>KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa]
           {ON} similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 1001

 Score =  121 bits (304), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/229 (31%), Positives = 118/229 (51%), Gaps = 14/229 (6%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R ++F++L N + ALLI DP    A+    V  GS  DP+++PGLAH CEH++    S 
Sbjct: 55  DRNYRFIELPNKLKALLIQDPTTDKAAAALDVNVGSFEDPEDLPGLAHFCEHLLFMG-SS 113

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           KFP  + Y   L ++ G  NA+T+   T+++F++   N ++         G  +     P
Sbjct: 114 KFPNENEYSSYLSKHGGGSNAYTSARNTNYFFQV---NQESLHGALLRFSGFFS----CP 166

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSK--ALYHGTKKLATQRSKFSRFSTGNIYTLTQFP 198
           +F     +KEI A+D+  EN KNL S    LY   K  +     F +FSTGN+ TL   P
Sbjct: 167 LFNKESTDKEINAVDS--ENKKNLQSDLWRLYQLDKSQSNPEHPFHKFSTGNLKTLGDIP 224

Query: 199 IVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGD 247
               K +++++ L K Y  ++ A  + + + G + L  + + V   F D
Sbjct: 225 --KSKDVDIRDELLKFYDSSYSANLMKLCVLGREDLDTMSQWVYDLFKD 271

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 66/384 (17%), Positives = 153/384 (39%), Gaps = 46/384 (11%)

Query: 594 PRLMSKNENYELWVKEENSLEYSSRSVITIELINMGMEPSAKNTMNLEILTQLLYFYINE 653
           P L+ ++   ++W K+++   +  +  I + +       S  N+M   +  +L+  Y+ +
Sbjct: 542 PLLLKQDRQSKVWYKKDDRF-WVPKGHIYVSMKLAHTYSSVVNSMLTTLYVELINDYLKD 600

Query: 654 SLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMVDIGKPDFD----- 708
             Y ++           N+G   L ++++G+ + +A++L+  ++ + +  +P  D     
Sbjct: 601 LEYDAQVASLHISFRKTNQG---LDLSLSGYNEKMAILLKRYLEGIANF-QPAEDRFKIY 656

Query: 709 -------ITNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXXXXXXXXXXXDALED 761
                  + N ++      V   +       + T+A+                  + ++ 
Sbjct: 657 QDKLLQKLNNHLYEVPYSQVSDVFNSVINERAWTIAN----------------KLEVVKQ 700

Query: 762 IDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMDGIIHHLSGPNVNQTSVFRLR 821
           +  E  K+F   ++   S    +++ G+ S    +    D ++  L+  +V Q    +  
Sbjct: 701 LKFEHLKLFIPAIFEQFS--FEILVHGNFSCEAALE--ADNLVRALAPRDV-QNFQLKSS 755

Query: 822 EPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPD 881
           +P ++ L QG  F  +     +   NS +  +      +      +SLF   +       
Sbjct: 756 KPRSVLLPQGKTFCYQQMLADDKNINSCIQHVTQFGSYSEELSAKASLFAQLIDEPAFDT 815

Query: 882 LRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAE 941
           LR K+Q+GYVV            + + + S      +E RI+ +L  +   VL  M++ E
Sbjct: 816 LRTKEQLGYVVFSSALNTHGTVNLRLLIQSERDTAYLESRIDAFLVKM-GQVLQEMSDEE 874

Query: 942 FQDN-------ILQKYMQLIKSNS 958
           F+ +       +LQ+Y  L + N+
Sbjct: 875 FERHKVALCKTLLQRYKNLSEENT 898

>Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON}
           (216511..219573) [3063 nt, 1021 aa]
          Length = 1020

 Score =  120 bits (302), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 72/227 (31%), Positives = 120/227 (52%), Gaps = 14/227 (6%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R+++F++L N   ALLI D     ++    V  G+  DP  + GLAH CEH++    SK
Sbjct: 72  DRSYRFIELPNKFKALLIHDASTDKSAASLDVNIGAFQDPKNLQGLAHFCEHLLFMG-SK 130

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           KFP  + Y   L ++ G+ NA+T  + T+++FEI   N++      D   G        P
Sbjct: 131 KFPNENEYSSYLNKHGGSSNAYTGAQNTNYFFEI---NHEHLHGALDRFSGFFT----CP 183

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSKA--LYHGTKKLATQRSKFSRFSTGNIYTLTQFP 198
           +F     +KEI A+D+  EN KNL +    +Y   K L+ ++  + +FSTGN+ TL + P
Sbjct: 184 LFNPNSTSKEINAVDS--ENKKNLQNDVWRMYQLDKSLSNEKHPYHKFSTGNLKTLDEMP 241

Query: 199 IVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTF 245
              G  ++++N L K Y+D++ A  + + + G + L  +   V   F
Sbjct: 242 KKEG--LDIRNELLKFYSDSYSANLMKLCVLGREDLDTMSDWVYNLF 286

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 93/407 (22%), Positives = 161/407 (39%), Gaps = 49/407 (12%)

Query: 594 PRLMSKNENYELWVKEENSLEYSSRSVITIELINMGMEPSAKNTMNLEILTQLLYFYINE 653
           P L+  +   +LW K+++   +  R  I    I M +  +  + +N  +LT L    +N+
Sbjct: 559 PLLLKDSPVSKLWYKKDDRF-WQPRGFI---YITMKLPHTQASVIN-NLLTSLYVQLVND 613

Query: 654 SL----YPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMVDIGKPDFDI 709
           SL    Y +         +  N+G   L +TI+GF   + ++LQ  +   V + +P   +
Sbjct: 614 SLKDLQYDAACANLHLSFSKTNQG---LDITISGFNDKLIVLLQRFI-YGVSVYQPS-KL 668

Query: 710 TNSMFRHSRI--LVRTKYEEAARANSCTLASLGVXXXXXXXXXXXXXXXDALEDIDIESF 767
              +F+   I  L    YE      S   +SL                   +E I  E F
Sbjct: 669 RFKIFKEKTIQNLKNCLYEVPYSQISTLYSSL-----INERTWSVKQKLSIIEKITYEQF 723

Query: 768 KMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMDGIIHHLSGPNVNQTSV--FRLREPET 825
             F   ++  +  Y + ++ G+    E V   +D ++  L   ++    V   RLR   +
Sbjct: 724 LAFLPTIY--EECYFDGLVHGNFRNEEAVE--IDSLVQSLITTDIVNLHVKNTRLR---S 776

Query: 826 IKLAQGSNFFIEMTSFKEDPTNSVV-YFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRN 884
             +  G  +  E+     +  NS V + ++ G  +  +   MS LF   ++      LR 
Sbjct: 777 YVIPNGETYRFEIDLEDAENVNSCVQHVVQLGGYSEELS-AMSGLFAQILNEPCFDTLRT 835

Query: 885 KKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQD 944
           K+Q+GYVV            I I V S      +E RI+E+ Y      L  M++ E + 
Sbjct: 836 KEQLGYVVFSSSLNNHGTANIRILVQSEHSTPYLEWRIDEF-YKSFGETLRNMSDDELEK 894

Query: 945 N-------ILQKYMQLIKSNSLEKLIKNAG---------PANLMAQI 975
           +       ++QKY  + + NS        G          ANL+AQI
Sbjct: 895 HKDALCKSLMQKYKNMKEENSRYTAAIYLGDYNFTHRQKKANLVAQI 941

>CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389c STE23
          Length = 1008

 Score =  120 bits (301), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 124/231 (53%), Gaps = 14/231 (6%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R ++++QL N + AL+I D     A+    V  G+  DP+ +PGLAH CEH++    S+
Sbjct: 60  DRQYRYIQLPNNLKALIIQDATTDKAAAALDVNIGAFQDPENLPGLAHFCEHLLFMG-SE 118

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           KFP  + Y   L ++ G+ NA+T  + T+++FE+ N+++  G    D   G  +     P
Sbjct: 119 KFPDENEYSSYLSKHGGSSNAYTGSQNTNYFFEV-NADHLHG--ALDRFSGFFS----CP 171

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSK--ALYHGTKKLATQRSKFSRFSTGNIYTLTQFP 198
           +F     +KEI A+D+  EN KNL +    +Y   K L+ Q   + +FSTGN+ TL   P
Sbjct: 172 LFNQNSTDKEINAVDS--ENKKNLQNDIWRMYQLDKSLSNQDHPYHKFSTGNLETLGDKP 229

Query: 199 IVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFR 249
             AG  ++++  L K Y +N+ A  + + I G + L  L +     F D +
Sbjct: 230 KAAG--LDIREELLKFYNENYSANLMKLCILGKEDLDTLSEWAWELFKDVK 278

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 47/115 (40%), Gaps = 1/115 (0%)

Query: 828 LAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQ 887
           + +G ++  E   + E+  NS +  +   D  N     +S LF   +       LR K+Q
Sbjct: 769 IPKGKSYAYETDLYDENNVNSCIQHVVQLDVYNEKLSALSGLFAQMLHEPCFDILRTKEQ 828

Query: 888 IGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEF 942
           +GYVV            I I V S      +E RI+E+ Y      L  M E +F
Sbjct: 829 LGYVVFSSSLNNHGTANIRILVQSEHTTPYLEWRIDEF-YKTFGEKLRNMDEEDF 882

>Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa]
           {ON} YLR389C (REAL)
          Length = 1025

 Score =  120 bits (301), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 121/226 (53%), Gaps = 14/226 (6%)

Query: 22  RAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKK 81
           R++++++L N + ALLI DP    A+    V  G+  DP+++PGLAH CEH++    S+K
Sbjct: 72  RSYRYIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPEKLPGLAHFCEHLLFMG-SEK 130

Query: 82  FPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPI 141
           FP  + Y   L ++ G+ NA+T  + T+++FE+ + +      +FD L    +     P+
Sbjct: 131 FPDENEYSSFLSKHGGSSNAYTASQNTNYFFEVNHQH------LFDAL-DRFSGFFSCPL 183

Query: 142 FQSADINKEIQAIDNEHENNKNLVSK--ALYHGTKKLATQRSKFSRFSTGNIYTLTQFPI 199
           F     +KEI A+++  EN KNL +    +Y   K L   +  + +FSTGNI TL   P 
Sbjct: 184 FNKDSTDKEINAVNS--ENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIETLGTSPK 241

Query: 200 VAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTF 245
             G  +N+++ L K + D + A  + + I G + L  L   V   F
Sbjct: 242 ENG--LNIRDELLKFHKDFYSANLMKLCILGREDLDTLSDWVYDLF 285

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 87/206 (42%), Gaps = 16/206 (7%)

Query: 781 YMNLVIQGDLSIAETVNQYMDGIIHHLSGPNVN--QTSVFRLREPETIKLAQGSNFFIEM 838
           +   +I G++   E V   +D +I  L   N+N  Q +  RLR   +  L +G +F  E 
Sbjct: 734 FFETLIHGNIKHEEAVE--VDSLIKSLITNNINNLQVANNRLR---SYLLPKGKSFRYET 788

Query: 839 TSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVXXXXXX 898
                   NS +  +   D  +     +S LF   +       LR K+Q+GYVV      
Sbjct: 789 ALKDSQNVNSCIQHVTQLDVYSEELSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLN 848

Query: 899 XXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNS 958
                 I I + S      +E RI  + Y     +L  MT+ +F     +K+ + +  NS
Sbjct: 849 NHGTANIRILIQSEHTTPYLEWRINNF-YETFGQILRDMTKEDF-----EKHKEAL-CNS 901

Query: 959 LEKLIKNAGPANLMAQIEASVHSGNY 984
           L +  KN   A   A+  A+++ G+Y
Sbjct: 902 LLQKFKNM--AEESARYTAAIYLGDY 925

>YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}
           STE23Metalloprotease involved, with homolog Axl1p, in
           N-terminal processing of pro-a-factor to the mature
           form; expressed in both haploids and diploids; member of
           the insulin-degrading enzyme family
          Length = 1027

 Score =  118 bits (295), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 118/228 (51%), Gaps = 14/228 (6%)

Query: 22  RAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKK 81
           R+++F++L N + ALLI DP    A+    V  G+  DP  +PGLAH CEH++    S+K
Sbjct: 72  RSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPKNLPGLAHFCEHLLFMG-SEK 130

Query: 82  FPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPI 141
           FP  + Y   L ++ G+ NA+T  + T+++FE+   N++      D   G  +     P+
Sbjct: 131 FPDENEYSSYLSKHGGSSNAYTASQNTNYFFEV---NHQHLFGALDRFSGFFS----CPL 183

Query: 142 FQSADINKEIQAIDNEHENNKNLVSK--ALYHGTKKLATQRSKFSRFSTGNIYTLTQFPI 199
           F     +KEI A+++  EN KNL +    +Y   K L   +  + +FSTGNI TL   P 
Sbjct: 184 FNKDSTDKEINAVNS--ENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIETLGTLPK 241

Query: 200 VAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGD 247
             G  +N+++ L K + + + A  + + I G + L  L       F D
Sbjct: 242 ENG--LNVRDELLKFHKNFYSANLMKLCILGREDLDTLSDWTYDLFKD 287

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 86/397 (21%), Positives = 153/397 (38%), Gaps = 35/397 (8%)

Query: 594 PRLMSKNENYELWVKEENSLEYSSRSVITIELINMGMEPSAKNTMNLEILTQLLYFYINE 653
           P L+  ++  +LW K+++   +  R  I +         S  N+M   + TQL    + +
Sbjct: 558 PVLLLSDDVSKLWYKKDDRF-WQPRGYIYLSFKLPHTHASIINSMLSTLYTQLANDALKD 616

Query: 654 SLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKM--VDIGKPDFDI-T 710
             Y +            N+G   LA+T +GF + + ++L   +  +   +  K  F+I  
Sbjct: 617 VQYDAACADLRISFNKTNQG---LAITASGFNEKLIILLTRFLQGVNSFEPKKDRFEILK 673

Query: 711 NSMFRHSR-ILVRTKYEEAARANSCTLASLGVXXXXXXXXXXXXXXXDALEDIDIESFKM 769
           +   RH + +L    Y + +   +  +                       E +  E    
Sbjct: 674 DKTIRHLKNLLYEVPYSQMSNYYNAIINE---------RSWSTAEKLQVFEKLTFEQLIN 724

Query: 770 FCKDLWIPKSNYMNLVIQGDLSIAETVNQYMDGIIHHLSGPNVN--QTSVFRLREPETIK 827
           F   ++  +  Y   +I G++   E +   +D +I  L   N++  Q S  RLR   +  
Sbjct: 725 FIPTIY--EGVYFETLIHGNIKHEEALE--VDSLIKSLIPNNIHNLQVSNNRLR---SYL 777

Query: 828 LAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQ 887
           L +G  F  E         NS +  +   D  +     +S LF   +       LR K+Q
Sbjct: 778 LPKGKTFRYETALKDSQNVNSCIQHVTQLDVYSEDLSALSGLFAQLIHEPCFDTLRTKEQ 837

Query: 888 IGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQDNIL 947
           +GYVV            I I + S      +E RI  + Y     VL  M E +F     
Sbjct: 838 LGYVVFSSSLNNHGTANIRILIQSEHTTPYLEWRINNF-YETFGQVLRDMPEEDF----- 891

Query: 948 QKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNY 984
           +K+ + +  NSL +  KN   A   A+  A+++ G+Y
Sbjct: 892 EKHKEAL-CNSLLQKFKNM--AEESARYTAAIYLGDY 925

>Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389C
           (STE23) - involved in a-factor processing [contig 1]
           FULL
          Length = 1001

 Score =  117 bits (294), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 119/229 (51%), Gaps = 14/229 (6%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R ++F++L N +  LLI D     A+    V  GS  DP+ +PGLAH CEH++    S 
Sbjct: 55  DREYRFIELPNKLKVLLIQDVNTDKAAAALDVNVGSFEDPENLPGLAHFCEHLLFMG-SS 113

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           K+P  + Y   L ++ G  NA+T+ + T+++F++ N  N  G    D   G  +     P
Sbjct: 114 KYPNENEYSSYLSKHGGGSNAYTSSQNTNYFFQV-NQGNLHG--ALDRFSGFFS----CP 166

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSK--ALYHGTKKLATQRSKFSRFSTGNIYTLTQFP 198
           +F     +KEI A+D+  EN KNL S    LY   K  ++    + +FSTGN+ TL + P
Sbjct: 167 LFNKDSTDKEINAVDS--ENKKNLQSDLWRLYQLDKSQSSPEHPYHKFSTGNLKTLGELP 224

Query: 199 IVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGD 247
               + +++++ L K Y  ++ A  + + + G + L  L + V   F D
Sbjct: 225 --KSQNLDVRDELLKFYNRSYSANLMKLCVLGREDLDVLSQWVYDLFKD 271

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 75/188 (39%), Gaps = 17/188 (9%)

Query: 781 YMNLVIQGDLSIAETVNQYMDGIIHHLS---GPNVNQTSVFRLREPETIKLAQGSNFFIE 837
           +   ++ G+ S    V       IH L     PN  +  + +  +P ++ +  G  ++ E
Sbjct: 718 FFEALVHGNFSYETAVE------IHKLVKALAPNDIKNCLLKSSKPRSLHIPPGRAYYYE 771

Query: 838 MTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVXXXXX 897
                E   NS +  +      +      ++LF   +       LR K+Q+GYVV     
Sbjct: 772 QRLADEKNINSCIQHVNQFGTYSEELAAKAALFAQLIDEPAFDTLRTKEQLGYVVFSSAL 831

Query: 898 XXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQDN-------ILQKY 950
                  + I + S      +E RI+ +L  +   +L  M+E EF+ +       +LQ+Y
Sbjct: 832 NTHGTVNLRILIQSERDTAFLESRIDAFLAKM-GQILQDMSEEEFERHRTALCKTLLQRY 890

Query: 951 MQLIKSNS 958
             L + NS
Sbjct: 891 KNLSEENS 898

>Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa]
           {ON} YLR389C (REAL)
          Length = 1022

 Score =  117 bits (293), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 125/246 (50%), Gaps = 15/246 (6%)

Query: 4   ATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEV 63
           +  +T D+    P  +  R+++F++L N + ALLI DP    A+    V  G+  DP+ +
Sbjct: 55  SNFKTFDLDFLKPDLDE-RSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPESL 113

Query: 64  PGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGK 123
           PGLAH CEH++    S+KFP  + Y   L ++ G+ NA+T  + T+++FEI   N++   
Sbjct: 114 PGLAHFCEHLLFMG-SEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEI---NHQHLF 169

Query: 124 PIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSK--ALYHGTKKLATQRS 181
              D   G  +     P+F     +KEI A+++  EN KNL +    +Y   K L     
Sbjct: 170 GALDRFAGFFS----CPLFNKDSTDKEINAVNS--ENKKNLQNDIWRIYQLDKSLTNPNH 223

Query: 182 KFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLV 241
            + +FSTGNI TL   P   G+  N+++ L + + + + A  + + I G + L  L    
Sbjct: 224 PYHKFSTGNIETLGTLPKENGQ--NVRDELLQFHNNFYSANLMKLCILGREDLDTLSDWT 281

Query: 242 QTTFGD 247
              F D
Sbjct: 282 YNLFKD 287

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 86/397 (21%), Positives = 157/397 (39%), Gaps = 35/397 (8%)

Query: 594 PRLMSKNENYELWVKEENSLEYSSRSVITIELINMGMEPSAKNTMNLEILTQLLYFYINE 653
           P L+  +    LW K+++   +  R  I +         S  N+M   +  Q++   + +
Sbjct: 558 PMLLLSDGVSRLWYKKDDRF-WQPRGYIYLSFKLPHTHASIINSMLSTLYIQMVNDALKD 616

Query: 654 SLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMVDI--GKPDFDI-T 710
             Y ++  G        N+G   L +T +G+ + + ++L   +  ++     K  F+I  
Sbjct: 617 LQYDADCAGLRISFNKTNQG---LDITASGYNEKLIILLTRFLQGVISFEPKKNRFEILK 673

Query: 711 NSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXXXXXXXXXXXDALEDIDIESFKMF 770
           +   RH + L+   YE      S    SL                    E +  E    F
Sbjct: 674 DKTIRHLKNLL---YEVPYSQMSNYYNSL-----INERSWSTAEKLQVFEKLSYEQLINF 725

Query: 771 CKDLWIPKSNYMNLVIQGDLSIAETVNQYMDGIIHHLSGPNVN--QTSVFRLREPETIKL 828
              ++  +  +   +I G++   E +   +D +I  +   N+N  Q S  RLR   +  L
Sbjct: 726 IPTIY--EGAFFETLIHGNIKREEAME--VDSLIKSMITVNINNLQVSNNRLR---SYLL 778

Query: 829 AQGSNFFIEMTSFKED-PTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQ 887
            +G +F  E T+ K+    NS +  +   D  +     +S LF   +       LR K+Q
Sbjct: 779 PKGKSFRYE-TALKDSLNVNSCIQHVTQLDVYSEELSALSGLFTQLIHEPCFDTLRTKEQ 837

Query: 888 IGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQDNIL 947
           +GYVV            I I + S      +E RI  + Y      L  M + +F     
Sbjct: 838 LGYVVFSSSLNNHGTANIRILIQSEHTTPYLEWRITNF-YETFGQTLKDMKQEDF----- 891

Query: 948 QKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNY 984
           +K+ + +  NSL +  KN G  +  A+  A+++ G+Y
Sbjct: 892 EKHKEAL-CNSLLQKFKNMGEES--ARYTAAIYLGDY 925

>TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {ON}
           Anc_4.246 YLR389C
          Length = 965

 Score =  117 bits (292), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 73/231 (31%), Positives = 119/231 (51%), Gaps = 14/231 (6%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R ++F++L N +  LLI D     A+    V  G+  DP+ +PGLAH CEH++    S+
Sbjct: 19  DRNYRFIELPNSLKVLLIQDATTDKAAASLDVNIGAFEDPEGLPGLAHFCEHLLFMG-SE 77

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           K+P  + Y   L    G+ NA+T    T+++FEI   N +  +   D   G  +     P
Sbjct: 78  KYPDENEYSSFLSTNGGSYNAYTGALNTNYFFEI---NYEHLEGALDRFSGFFS----RP 130

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSKA--LYHGTKKLATQRSKFSRFSTGNIYTLTQFP 198
           +F     +KEI A+D+  EN KNL S    +Y   K L+ ++  + +FSTGNI TL   P
Sbjct: 131 LFSKDSTDKEINAVDS--ENKKNLQSDVWRMYQLDKSLSNRKHPYHKFSTGNIQTLGTIP 188

Query: 199 IVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFR 249
              G  +++++ L K Y +++ A  + + I G + L  L     + F D +
Sbjct: 189 NEQG--LDIRDELLKFYNNSYSANLMKLTILGREDLDILGDWAYSMFKDVK 237

 Score = 39.7 bits (91), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 83/193 (43%), Gaps = 27/193 (13%)

Query: 781 YMNLVIQGDL--SIAETVNQ----YMDGIIHHLSGPNVNQTSVFRLREPETIKLAQGSNF 834
           Y   ++ G+   S A  VNQ    Y+ G IH+   P +      RLR   +  L +G  +
Sbjct: 682 YFESLVHGNFEKSDAAEVNQLVEKYISGSIHN---PQIRND---RLR---SYVLQKGETY 732

Query: 835 FIEMTSFKEDP--TNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVV 892
             E  +  EDP   NS +  +      N     +SSLF   ++      LR K+Q+GYVV
Sbjct: 733 RYE--TLLEDPENVNSCIQHVTQIGLYNDRLAALSSLFAQIINEPCFNILRTKEQLGYVV 790

Query: 893 XXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQDN------- 945
                       I I V S      +E RI+E+   ++T +L  M    F+++       
Sbjct: 791 FSSSLNNYGTTNIRILVQSEHTTEYLEWRIDEFYKSVKT-ILTQMAPETFENHKDALCKT 849

Query: 946 ILQKYMQLIKSNS 958
           +LQKY  + + +S
Sbjct: 850 LLQKYKNMKEESS 862

>ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {ON}
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 994

 Score =  117 bits (293), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 118/229 (51%), Gaps = 14/229 (6%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R+++++QL N + ALLI D     A+    V  G+  DP+ +PGLAH CEH++    S+
Sbjct: 46  DRSYRYIQLPNDLKALLIHDSKADKAAAALDVNVGAFEDPEGLPGLAHFCEHLLFMG-SE 104

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           K+P  + Y   L ++ G  NA+T  + T++YFE+   N++      D   G        P
Sbjct: 105 KYPDENEYSSYLSKHGGASNAYTGSQNTNYYFEV---NHEHLFGALDRFAGFFT----CP 157

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSK--ALYHGTKKLATQRSKFSRFSTGNIYTLTQFP 198
           +F     +KEI+A+D+  EN KNL S    LY   K L  +   + +FSTGN  TL + P
Sbjct: 158 LFNRDSTDKEIKAVDS--ENKKNLQSDLWRLYQLDKSLTNEEHPYHKFSTGNFITLHEIP 215

Query: 199 IVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGD 247
              G  I+++  L K Y  ++ A  + + + G + L  L     + F D
Sbjct: 216 TSNG--IDVREELLKFYKKSYSANLMKLCVLGREDLDTLSNWACSLFQD 262

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 77/378 (20%), Positives = 146/378 (38%), Gaps = 34/378 (8%)

Query: 594 PRLMSKNENYELWVKEENSLEYSSRSVITIELINMGMEPSAKNTMNLEILTQLLYFYINE 653
           P L+  ++  +LW K+++   +  R  I I       + S  N+M   +  QL+  YI +
Sbjct: 533 PLLLKDDKISKLWYKKDDRF-WQPRGYIYISFKLPHTQASIVNSMLSTLYVQLINDYIKD 591

Query: 654 SLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMVDIGKPD---FDIT 710
             Y +         +  N+G   L +T+ GF   + ++L   ++ +    KP+   F I 
Sbjct: 592 LQYDAACADLHLSFSKTNQG---LDITVVGFNDKLTILLTRFLEGLKSF-KPEKNRFQIF 647

Query: 711 NSMFRHSRILVRTKYEEAARANSCTLASLGVXXXXXXXXXXXXXXXDALEDIDIESFKMF 770
               + +R L    YE          +SL                 + L+ +  E    +
Sbjct: 648 KD--KCTRQLTNQLYEVPYLQVFPVYSSL-----INERTWSVKEKLEVLKRLTFEQLVTY 700

Query: 771 CKDLWIPKSNYMNLVIQGDLSIAETVNQYMDGIIHHLSGPNVN--QTSVFRLREPETIKL 828
              ++  +  +    + G++   E +   +D ++  L   ++   QT   +LR   +  L
Sbjct: 701 LPTIY--EEMFFEAFVHGNMKYEEAIE--VDSLVQMLVPNDIRNFQTKNGKLR---SYFL 753

Query: 829 AQGSNFFIEMTSFKEDPTNSVV-YFIETGDRTNPVDYTMSSLFEYFMSMTLVPDLRNKKQ 887
            QG  +  E         NS + +  + G  +  +    +SLF   +       LR K+Q
Sbjct: 754 PQGETYRYETKLQDSQNLNSCIQHVTQLGVYSEEIS-AKASLFAQMIHEPCFDTLRTKEQ 812

Query: 888 IGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMTEAEFQDN-- 945
           +GYVV            I I V S      +E RIE +L      +L  M++ +F+ +  
Sbjct: 813 LGYVVFSSSLNNHGTANIRILVQSEHTTPFLEWRIESFLQGF-GKILQDMSDKDFEGHKD 871

Query: 946 -----ILQKYMQLIKSNS 958
                + QKY  + + +S
Sbjct: 872 ALCKSLAQKYKNMKEESS 889

>Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar to
           Ashbya gossypii AER053C
          Length = 1023

 Score =  112 bits (279), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 114/233 (48%), Gaps = 14/233 (6%)

Query: 21  NRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESK 80
           +R ++++QL N +   LI D     A+    V  G   DP+++PGLAH CEH++    S+
Sbjct: 77  DRNYRYIQLPNRLKVFLIQDKSTDKAAAALDVNVGFFQDPEDLPGLAHFCEHLLFMG-SE 135

Query: 81  KFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSP 140
           KFP  + Y   L  + G  NA+T+ + T++YF + + N      ++D L    +    SP
Sbjct: 136 KFPNENEYSSYLSHHGGASNAYTSTQNTNYYFMVNHGN------LYDAL-DRFSGFFTSP 188

Query: 141 IFQSADINKEIQAIDNEHENNKNLVSK--ALYHGTKKLATQRSKFSRFSTGNIYTLTQFP 198
           +F  +  NKE+ A+D+  EN KNL S    +    + L      F +FSTGN  TL + P
Sbjct: 189 LFSVSSTNKEVNAVDS--ENKKNLQSDLWRMQQLDRSLTNPGHPFHKFSTGNYQTLYKEP 246

Query: 199 IVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFRTK 251
              G  I ++  L K Y   + A  + +VI G + L  L       F D   K
Sbjct: 247 KSRG--IEIREELLKFYDKTYSANLMRLVILGMEDLDTLSAWAYELFKDVPDK 297

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 69/339 (20%), Positives = 136/339 (40%), Gaps = 35/339 (10%)

Query: 633 SAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMIL 692
           S  N+M   +  +++   + + LY +E   +       N+G   L +++ G+   + ++L
Sbjct: 602 SVVNSMLSTLYVEMVKDSLKDLLYNAECANFEVSFVKTNQG---LDLSLTGYNDKMTLLL 658

Query: 693 QIIMD--KMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVXXXX--XXX 748
             I++  +  D  K  FD+        ++L +  Y    R  +   + +GV         
Sbjct: 659 TSILEGIRNFDPKKERFDVLQ------KLLCQKLYN---RLYNVPYSQIGVLYNSLINDR 709

Query: 749 XXXXXXXXDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETV--NQYMDGIIHH 806
                      + +  E FK F   ++  +  Y   ++ G+    + +  N Y+  +I  
Sbjct: 710 SWTPSEKLKVTKQLTFEHFKAFVPSIY--EQMYFETLVHGNFPENQAIELNSYICSLI-- 765

Query: 807 LSGPNVNQTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVV-YFIETGDRTNPVDYT 865
              PN  + S  R   P +  L +G  +  E T F E+  NS     I+ G  +  ++  
Sbjct: 766 ---PNQIKHSGARNNRPRSYMLPEGKTYRYETTLFDEENVNSCFEMVIQLGMYSEDMN-A 821

Query: 866 MSSLFEYFMSMTLVPDLRNKKQIGYVVXXXXXXXXXXXXIHISVMSNLPPHTIEDRIEEY 925
             SL    ++      LR ++Q+GYVV            + I V S      IE R++++
Sbjct: 822 KGSLLAQLINEPCFNTLRTEEQLGYVVWSSKQNTHASTNLRILVQSESDTVYIESRVDKF 881

Query: 926 LYYLETNVLGAMTEAEFQ-------DNILQKYMQLIKSN 957
           L     + L +M+E  F+       + +LQK+  + + N
Sbjct: 882 LNNF-ADTLRSMSEQAFEKHKGALCNTLLQKFKNMREEN 919

>TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON}
           Anc_4.246 YLR389C
          Length = 995

 Score =  111 bits (278), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 105/370 (28%), Positives = 171/370 (46%), Gaps = 33/370 (8%)

Query: 7   QTIDVPIYTPISNSNRAHQFVQLS-NGITALLISDPGESFASLCASVATGSHNDPDEVPG 65
           QTI   I  PI++  R +QF++L+ N + AL+I D     A+    V  G+  DP  +PG
Sbjct: 25  QTISSNILKPITDE-RNYQFIKLNKNNLHALIIQDKTTDKAAAALDVNAGAFMDPSNLPG 83

Query: 66  LAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPI 125
           LAH CEH++    SK FP  + Y   L +  G  NA+T    T+++FEI ++N      +
Sbjct: 84  LAHFCEHLLFMG-SKNFPNENDYSSYLNQNGGFSNAYTGSMNTNYHFEINHAN------L 136

Query: 126 FDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSR 185
           F E +   +    +P+F +    KEI AID+E++ N       LY   K L+     + +
Sbjct: 137 F-EALRRFSCFFKTPLFNNDSTIKEIHAIDSENKKNLQNDYWRLYQLGKSLSNHEHPYHK 195

Query: 186 FSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTF 245
           FSTG+  TL +        +N++  L K Y   + +  +++ I G + L  L +  +  F
Sbjct: 196 FSTGSKLTLLENTETLN--LNIREELIKFYNKWYSSNIMNLCIIGREDLGTLSRWAKILF 253

Query: 246 GDFRTKSTIKSQSFSIESFKKLQKVWAARYTEPLFSKQEPETPNSILIQSSKAPILRLVF 305
            +   K+ I   +FS       Q VW     + + S +    P   L Q      L L F
Sbjct: 254 ENVPNKNVILP-TFS-------QPVWTIADKKKVISVK----PVKDLKQ------LELTF 295

Query: 306 PVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKFSARNILTRQVTQLSKFTIDDEGL 365
            +   E    +S+    S + S LFG + +GSI S    + ++T   +     + ++   
Sbjct: 296 HIKEDELTTWKSKP---SYILSHLFGHKGNGSISSLLKNQQLITGISSGSENISKENSLF 352

Query: 366 VLQFELTNSG 375
            L F+LT  G
Sbjct: 353 SLNFDLTEDG 362

>SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 461

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 91/231 (39%), Gaps = 30/231 (12%)

Query: 25  QFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPK 84
           Q   L+NG+T      P  S A++   V  GS  +  +  G AH  EH+      K    
Sbjct: 26  QISVLANGLTVASERIPNTSTATVGIFVDAGSRAENAKNNGTAHFLEHLAF----KGTQN 81

Query: 85  RSHYH-DLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIF 142
           R+    +L IE  G+  NA+T+ E T +Y        K+ +    + V +++D L   + 
Sbjct: 82  RTQTGIELEIENIGSHLNAYTSRENTVYYA-------KSLENDIPQAVDILSDILTRSVL 134

Query: 143 QSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIVAG 202
               I +E   I  E E    +  + ++     +  Q     R              + G
Sbjct: 135 DPRAIERERDVIIRESEEVDKMYDEVVFDHLHAIVYQDQPLGR-------------TILG 181

Query: 203 KIINLKNV----LQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFR 249
            I N+K +    LQ + + N+  + + +V  G+   H L    QT FG  R
Sbjct: 182 PIKNIKTIQRDDLQAYISKNYSGDRMVLVGAGAVDHHKLVDYAQTYFGHIR 232

>TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.376
           YLR163C
          Length = 469

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 94/224 (41%), Gaps = 22/224 (9%)

Query: 25  QFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPK 84
           +  +LSNG+T      P  S A++   V  GS  +  +  G AH  EH+     SK+  K
Sbjct: 28  EISKLSNGLTVATEYMPNTSTATVGIYVNAGSRAENVKNNGTAHFLEHLAFKGTSKRSQK 87

Query: 85  RSHYHDLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQ 143
           +    +L IE  G+  NA+T+ E T +Y        KT K      V +++D L +   +
Sbjct: 88  QI---ELDIENIGSHLNAYTSRENTVYYA-------KTLKENLPLAVDILSDILTNSKLE 137

Query: 144 SADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIVAGK 203
              I +E   I  E E    +  + ++    ++A +     R   G        PI   K
Sbjct: 138 KNAIERERDVIVRESEEVDKMYDEVVFDHLHEIAYKDQPLGRTILG--------PIKNIK 189

Query: 204 IINLKNVLQKHY-ADNFVAENISIVIRGSQSLHYLKKLVQTTFG 246
            IN  +++  HY   N+  + + +   G  +   L KL +  FG
Sbjct: 190 SINRSDLV--HYITSNYKGDRMVLAGAGDINHQDLIKLAEKYFG 231

>Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar to
           Ashbya gossypii AGL138C
          Length = 462

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 91/231 (39%), Gaps = 30/231 (12%)

Query: 25  QFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPK 84
           Q  QLSNGIT      P  S A++   V  GS  +     G AH  EH+      K    
Sbjct: 26  QISQLSNGITVASEVLPNTSTATVGIFVDAGSRAENSRNNGTAHFLEHLAF----KGTTN 81

Query: 85  RSHYH-DLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIF 142
           RS    +L IE  G+  NA+T+ E T +Y        K+ K    + + +++D L     
Sbjct: 82  RSQVGIELEIENIGSHLNAYTSRENTVYYA-------KSLKEDIPKAMDILSDILTRSTL 134

Query: 143 QSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIVAG 202
               I +E   I  E E    +  + ++     +  +     R              + G
Sbjct: 135 NPKAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQALGR-------------TILG 181

Query: 203 KIINLKNVLQKHYAD----NFVAENISIVIRGSQSLHYLKKLVQTTFGDFR 249
            I N+K++ +K  A+    N+  + +++V  GS     L +  +  FG  R
Sbjct: 182 PIENIKSIQRKDLAEYISTNYTGDRMALVGAGSVDHDKLVEYGERYFGHIR 232

>TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.376
           YLR163C
          Length = 499

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 85/223 (38%), Gaps = 22/223 (9%)

Query: 29  LSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSHY 88
           LSNG+T      P  S AS+   V  GS  +  +  G AH  EH+      K    RS  
Sbjct: 65  LSNGLTVASEYIPNTSTASIGIYVDAGSRAENSKNNGTAHFLEHLAF----KGTTTRSQR 120

Query: 89  H-DLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSAD 146
             +L+IE  G+  NA+T+ E T +Y        KT K      + +++D L         
Sbjct: 121 DIELVIENLGSHLNAYTSRENTVYYA-------KTLKDNIPNAIDILSDILTKSTLDKNA 173

Query: 147 INKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIVAGKIIN 206
           I +E   I  E E    +  + ++    ++  +     R   G I  +            
Sbjct: 174 IERERSVIIRESEEVDQMYDEVVFDHLHEIVYKDQPLGRTILGPIKNINTIQ-------- 225

Query: 207 LKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFR 249
            +N LQ +   N+  + + +   G  +   L K  +  FG  +
Sbjct: 226 -RNDLQNYITTNYKGDRMVLAGAGDVNHEELVKYAEKYFGHVK 267

>Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF}
           (68467..69831) [1365 nt, 455 aa]
          Length = 454

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 49/224 (21%), Positives = 89/224 (39%), Gaps = 28/224 (12%)

Query: 28  QLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSH 87
           +LSNG+T      P    A++   V  GS  +  +  G AH  EH+      K+  K+  
Sbjct: 15  RLSNGLTIATEYIPNTPTATVGIYVDAGSRAENTKNNGTAHFLEHLAFKGTEKRSQKKI- 73

Query: 88  YHDLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSAD 146
             +L IE  G+  NA+T+ E T +Y        KT K    + + +++D L       + 
Sbjct: 74  --ELDIENIGSHLNAYTSRENTVYYA-------KTLKENVPQAIDILSDILTKSTLDKSA 124

Query: 147 INKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIVAGKIIN 206
           I +E   I  E E    +  + ++    ++A       R              + G I N
Sbjct: 125 IERERDVIIRESEEVDKMYDEVVFDHLHEIAYSDQSLGR-------------TILGPIKN 171

Query: 207 LKNV----LQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFG 246
           +K++    L+ +   N+  + + +   G    + + K  +  FG
Sbjct: 172 IKSITRDDLKNYITQNYKGDRMVLASAGDIDHNEIVKYAEKYFG 215

>Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 464

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 49/224 (21%), Positives = 89/224 (39%), Gaps = 28/224 (12%)

Query: 28  QLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSH 87
           +LSNG+T      P    A++   V  GS  +  +  G AH  EH+      K+  K+  
Sbjct: 25  RLSNGLTIATEYIPNTPTATVGIYVDAGSRAENTKNNGTAHFLEHLAFKGTEKRSQKKI- 83

Query: 88  YHDLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSAD 146
             +L IE  G+  NA+T+ E T +Y        KT K    + + +++D L       + 
Sbjct: 84  --ELDIENIGSHLNAYTSRENTVYYA-------KTLKENVPQAIDILSDILTKSTLDKSA 134

Query: 147 INKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIVAGKIIN 206
           I +E   I  E E    +  + ++    ++A       R              + G I N
Sbjct: 135 IERERDVIIRESEEVDKMYDEVVFDHLHEIAYSDQSLGR-------------TILGPIKN 181

Query: 207 LKNV----LQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFG 246
           +K++    L+ +   N+  + + +   G    + + K  +  FG
Sbjct: 182 IKSITRDDLKNYITQNYKGDRMVLASAGDIDHNEIVKYAEKYFG 225

>NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.376
           YLR163C
          Length = 463

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 85/219 (38%), Gaps = 20/219 (9%)

Query: 29  LSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSHY 88
           L NG+T      P  S A++   V  GS  + ++  G AH  EH+       +  K    
Sbjct: 32  LPNGLTVATEWMPNTSSATVGIFVDAGSRAENEKNNGTAHFLEHLAFKGTKNRSQKGI-- 89

Query: 89  HDLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSADI 147
            +L IE  G+  NA+T+ E T +Y        K+ K    + V +++D L   +     I
Sbjct: 90  -ELEIENIGSHLNAYTSRENTVYYA-------KSLKEDIPKAVDILSDILTRSVLDPEAI 141

Query: 148 NKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIVAGKIINL 207
            +E   I  E E    +  + ++    ++  +     R   G I  +             
Sbjct: 142 ERERDVIIRESEEVDKMYDEVVFDHLHEVTYKDQPLGRTILGPIKNIQSI---------T 192

Query: 208 KNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFG 246
           ++ L K+  DN+  + + +   G+     L +  Q  FG
Sbjct: 193 RDDLSKYITDNYKGDRMVLAGAGAVDHEKLVEYAQRCFG 231

>KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]
           {ON} highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 469

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 89/223 (39%), Gaps = 22/223 (9%)

Query: 29  LSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSHY 88
           L NG+T    S P  + A++   V TGS  + ++  G AH  EH+      K    RS  
Sbjct: 38  LPNGLTVASESLPNTNTATVGIFVDTGSRAENEKNNGTAHFLEHLAF----KGTQNRSQT 93

Query: 89  H-DLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSAD 146
             +L IE  G+  NA+T+ E T +Y        K+ K    + V ++AD L   +     
Sbjct: 94  GIELEIENIGSHLNAYTSRENTVYYA-------KSLKQDIPKAVDILADILTRSVLDPKA 146

Query: 147 INKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIVAGKIIN 206
           I +E   I  E E    +  + ++     +  +     R   G I  +        +  +
Sbjct: 147 IERERDVIIRESEEVDKMYDEVVFDHLHTITYKNQPLGRTILGPIKNIKSI-----QRSD 201

Query: 207 LKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFR 249
           L+  ++KHY      + + +V  G+     L +     FG  R
Sbjct: 202 LQEFIEKHY----TGDRMVLVGTGAVDHDKLVEYAGKYFGHVR 240

>TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa]
           {ON} Anc_5.541 YDR430C
          Length = 991

 Score = 40.0 bits (92), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 64/145 (44%), Gaps = 12/145 (8%)

Query: 53  ATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGN-QNAFTTGEQTSFY 111
             G   +P +  G+AH+ EH  +   SKK+P R  +  +L     N  NA T  + T + 
Sbjct: 70  CVGFKTNPPDSTGVAHILEHTTLCG-SKKYPVRDPFFKMLNRSLSNFMNAMTGHDYTMYP 128

Query: 112 FEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNK--NLVSKAL 169
           F   NS +      F  L  V  D   SP+ +  D  +E   ++N+   +K  +L+ K +
Sbjct: 129 FATTNSKD------FKNLQDVYLDATFSPLLKQEDFFQEGWRLENKDATDKDSDLIFKGV 182

Query: 170 YHGTKKLATQRSKFSRFST--GNIY 192
            +   K     + +  +S   G+IY
Sbjct: 183 VYNEMKGQNSNADYYFWSNFLGSIY 207

>CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163c MAS1
          Length = 465

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 89/220 (40%), Gaps = 22/220 (10%)

Query: 29  LSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSHY 88
           L NG+T      P +S A++   V  GS  + +   G AH  EH+      K    RS  
Sbjct: 33  LPNGLTVASEFIPNKSTATVGIFVDAGSRAENERNNGTAHFLEHLAF----KGTQNRSQT 88

Query: 89  H-DLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSAD 146
             +L IE  G+  NA+T+ E T +Y        K+ +    + V +++D L   +     
Sbjct: 89  DIELEIENIGSHLNAYTSRENTVYYA-------KSLEGDVPKAVNILSDILTRSVLDPKA 141

Query: 147 INKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIVAGKIIN 206
           I +E   I  E E    +  + ++    ++A ++    R   G        PI   K I+
Sbjct: 142 IERERDVIIRESEEVDKMYDEVVFDHLHEIAYKQQPLGRTILG--------PIKNIKSIS 193

Query: 207 LKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFG 246
            K+ L+ +  +N+  + + +   G+     L    Q   G
Sbjct: 194 RKD-LKSYITENYKGDRMVLAAAGAVDHEKLVDYAQKYLG 232

>Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 96/226 (42%), Gaps = 32/226 (14%)

Query: 28  QLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSH 87
           +L NG+T      P  S A++   V  GS  +  +  G AH  EH+      K    RS 
Sbjct: 30  RLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAF----KGTQNRSQ 85

Query: 88  YH-DLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSA 145
              +L IE  G+  NA+T+ E T +Y        K+ +    + VG+++D L   +  + 
Sbjct: 86  QGIELEIENIGSHLNAYTSRENTVYYA-------KSLQEDIPKAVGILSDILTKSVLDNN 138

Query: 146 DINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTG---NIYTLTQFPIVAG 202
            I +E   I  E E    +  + ++    ++  +     R   G   NI ++T+      
Sbjct: 139 AIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPIKNIKSITRS----- 193

Query: 203 KIINLKNVLQKHYADNFVAENISIVIRGSQSLHY--LKKLVQTTFG 246
              +LKN + ++Y  +       +V+ G+ ++ +  L +  Q  FG
Sbjct: 194 ---DLKNYITRNYKGD------RMVLAGAGAVDHEELVEYAQKYFG 230

>KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.376
           YLR163C
          Length = 467

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 88/227 (38%), Gaps = 30/227 (13%)

Query: 29  LSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSHY 88
           L NG+T      P  + A++   V  GS  +  +  G AH  EH+      K    RS  
Sbjct: 34  LDNGLTVATEFIPNTASATVGIFVDAGSRAENVKNNGTAHFLEHLAF----KGTKNRSQR 89

Query: 89  H-DLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSAD 146
             +L IE  G+  NA+T+ E T +Y        K+ +    + V +++D L   +     
Sbjct: 90  GIELEIENIGSHLNAYTSRENTVYYA-------KSLREDIPKAVDILSDILTKSVLDPKA 142

Query: 147 INKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIVAGKIIN 206
           I +E   I  E E    +  + ++    ++A +     R              + G I N
Sbjct: 143 IERERDVIIRESEEVDKMYDEVVFDHLHEIAYRDQPLGR-------------TILGPIKN 189

Query: 207 LKNV----LQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFR 249
           +K++    LQ +   N+  + + +   GS     L    Q  FG  +
Sbjct: 190 IKSIKRTDLQNYIMTNYKGDRMVLASAGSVDHDNLVAYAQKYFGHLK 236

>KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 458

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 92/242 (38%), Gaps = 40/242 (16%)

Query: 16  PISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMII 75
           P++ +  + +   L NG+T      P  S A++   V  GS  +     G AH  EH+  
Sbjct: 14  PLATAASSTRTSVLRNGLTVATEHIPNTSSATVGIFVDAGSRAENTRNNGTAHFLEHLAF 73

Query: 76  SSESKKFPKRSHYH-DLLIEYNGNQ-NAFTTGEQTSFYFE-----IPNSNNKTGKPIFDE 128
               K    R+    +L IE  G+  NA+T+ E T +Y +     IPN+           
Sbjct: 74  ----KGTKNRTQVGIELEIENIGSHLNAYTSRENTVYYAKTLTQNIPNA----------- 118

Query: 129 LVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFST 188
            V V++D L   +  +  I +E   I  E E    +  + ++     +  +     R   
Sbjct: 119 -VDVLSDILTRSVLDARAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQPLGR--- 174

Query: 189 GNIYTLTQFPIVAGKIINLKNV----LQKHYADNFVAENISIVIRGSQSLHYLKKLVQTT 244
                      + G I N+K +    LQ + + N+  + + +   G+     L +     
Sbjct: 175 ----------TILGPIENIKTIQRRDLQDYISKNYKGDRMVLAGAGAVDHEKLVEYADKY 224

Query: 245 FG 246
           FG
Sbjct: 225 FG 226

>ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {ON}
           highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 465

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 92/225 (40%), Gaps = 32/225 (14%)

Query: 29  LSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSHY 88
           L NG+T      P  S A++   V  GS  +     G AH  EH+      K    RS  
Sbjct: 34  LPNGLTVASERLPNVSSATVGIFVDAGSRAENARNNGTAHFLEHLAF----KGTKNRSQT 89

Query: 89  H-DLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSAD 146
             +L IE  G+  NA+T+ E T ++        K+ +      V +++D L   +     
Sbjct: 90  GIELEIENIGSHLNAYTSRENTVYFA-------KSLEEDVPRAVEILSDILTRSVLDPKA 142

Query: 147 INKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTG---NIYTLTQFPIVAGK 203
           I +E   I  E E    +  + ++     +A +     R   G   NI T+T+       
Sbjct: 143 IERERDVIIRESEEVDKMYDEVVFDHLHDVAYKNQALGRTILGPIKNIKTITRE------ 196

Query: 204 IINLKNVLQKHYADNFVAENISIVIRGSQSLHYLK--KLVQTTFG 246
             +LKN + K+Y  +       +V+ G+ ++ + K  +  Q +FG
Sbjct: 197 --DLKNYIDKNYKGD------RMVLAGAGAIDHEKLIEYAQKSFG 233

>AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR163C
           (MAS1)
          Length = 470

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 91/225 (40%), Gaps = 30/225 (13%)

Query: 28  QLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSH 87
           QL NG+T    + P  + AS+   V  GS  +     G AH  EH+      K    R+ 
Sbjct: 33  QLPNGLTVASEAMPNTATASVGIFVDAGSRAENVRNNGTAHFLEHLAF----KGTKNRTQ 88

Query: 88  YH-DLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSA 145
              +L IE  G+  NA+T+ E T +Y        K+ +      + V++D L   +    
Sbjct: 89  VGIELEIENLGSHLNAYTSRENTVYYA-------KSLQEDIPRALDVLSDILTRSVLDPK 141

Query: 146 DINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIVAGKII 205
            + +E   I  E E    +  + ++     ++ +     R              + G I 
Sbjct: 142 AVERERDVIIRESEEVDKMYDEVVFDHLHAISYENQPLGR-------------TILGPIE 188

Query: 206 NLKNV----LQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFG 246
           N+K++    L+++ + N+  + +++V  G+     L +  +  FG
Sbjct: 189 NIKSIQQRDLKEYISTNYKGDRMALVGAGAVDHDELVRYGEKYFG 233

>TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {ON}
           Anc_8.376 YLR163C
          Length = 456

 Score = 36.6 bits (83), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 91/227 (40%), Gaps = 36/227 (15%)

Query: 29  LSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSHY 88
           L+NG+T      P  S A++   V  GS  + ++  G AH  EH+      K    R+  
Sbjct: 25  LNNGLTVATERIPEMSTATVGIFVDAGSRAENEKNNGTAHFLEHLAF----KGTKDRTQS 80

Query: 89  H-DLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDEL---VGVIADKLGSPIFQ 143
             +L IE  G+  NA+T+ E T +Y           K + D++   V +++D L   +  
Sbjct: 81  GIELEIENIGSHLNAYTSRENTVYY----------AKSLRDDIPRAVDILSDILTRSVLD 130

Query: 144 SADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIVAGK 203
              I +E   I  E E    +  + ++    ++A +     R              + G 
Sbjct: 131 PRAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYKDQSLGR-------------TILGP 177

Query: 204 IINLKNVLQKHYAD----NFVAENISIVIRGSQSLHYLKKLVQTTFG 246
           + N+K++ +K   D    N+  + + +   G+     L K  +  FG
Sbjct: 178 VKNIKSITRKDLKDYITKNYKGDRMVLAGAGAVDHDDLVKQAERFFG 224

>YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON}
           MAS1Smaller subunit of the mitochondrial processing
           protease (MPP), essential processing enzyme that cleaves
           the N-terminal targeting sequences from mitochondrially
           imported proteins
          Length = 462

 Score = 36.2 bits (82), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 96/220 (43%), Gaps = 31/220 (14%)

Query: 28  QLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSH 87
           +L NG+T      P  S A++   V  GS  +  +  G AH  EH+      K    RS 
Sbjct: 30  KLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAF----KGTQNRSQ 85

Query: 88  YH-DLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSA 145
              +L IE  G+  NA+T+ E T +Y        K+ +    + V +++D L   +  ++
Sbjct: 86  QGIELEIENIGSHLNAYTSRENTVYYA-------KSLQEDIPKAVDILSDILTKSVLDNS 138

Query: 146 DINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTG---NIYTLTQFPIVAG 202
            I +E   I  E E    +  + ++    ++  +     R   G   NI ++T+      
Sbjct: 139 AIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPIKNIKSITR------ 192

Query: 203 KIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQ 242
              +LK+ + K+Y  +       +V+ G+ ++ + +KLVQ
Sbjct: 193 --TDLKDYITKNYKGD------RMVLAGAGAVDH-EKLVQ 223

>Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 35.4 bits (80), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 89/225 (39%), Gaps = 30/225 (13%)

Query: 28  QLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSH 87
           +L NG+T      P  S A++   V  GS  +  +  G AH  EH+      K    RS 
Sbjct: 30  KLPNGLTIATEYIPNTSSATVGIFVDAGSRAENLKNNGTAHFLEHLAF----KGTQNRSQ 85

Query: 88  YH-DLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSA 145
              +L IE  G+  NA+T+ E T +Y        K+ +    + V +++D L   +  S 
Sbjct: 86  QGIELEIENIGSHLNAYTSRENTVYYA-------KSLEEDIPKAVDILSDILTKSVLDSN 138

Query: 146 DINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIVAGKII 205
            I +E   I  E E    +  + ++    ++  +     R              + G I 
Sbjct: 139 AIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGR-------------TILGPIK 185

Query: 206 NLKNV----LQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFG 246
           N+K++    L+ +   N+  + + +   G+     L +  Q  FG
Sbjct: 186 NIKSITRSDLKDYITKNYKGDRMVLAGAGAVDHERLVQYAQKYFG 230

>Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 35.4 bits (80), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 95/220 (43%), Gaps = 31/220 (14%)

Query: 28  QLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSH 87
           +L NG+T      P  S A++   V  GS  +  +  G AH  EH+      K    RS 
Sbjct: 30  KLPNGLTIASEYIPNTSSATVGIFVDAGSRAENIKNNGTAHFLEHLAF----KGTQNRSQ 85

Query: 88  YH-DLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSA 145
              +L IE  G+  NA+T+ E T +Y        K+ +    + V +++D L   +  S 
Sbjct: 86  QGIELEIENIGSHLNAYTSRENTVYYA-------KSLQEDIPKAVEILSDILTKSVLDSN 138

Query: 146 DINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTG---NIYTLTQFPIVAG 202
            I +E   I  E E    +  + ++    ++  +     R   G   NI ++T+      
Sbjct: 139 AIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPIKNIKSITRS----- 193

Query: 203 KIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQ 242
              +LKN + K+Y  +       +V+ G+ ++ + +KLV+
Sbjct: 194 ---DLKNYITKNYKGD------RMVLAGAGAVDH-EKLVE 223

>NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376
          Length = 461

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 84/219 (38%), Gaps = 20/219 (9%)

Query: 29  LSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSHY 88
           L NG+T      P  S A++   V  GS  +  +  G AH  EH+       +  K    
Sbjct: 30  LPNGLTVATELIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFKGTQNRSQKGI-- 87

Query: 89  HDLLIEYNGNQ-NAFTTGEQTSFYFEIPNSNNKTGKPIFDELVGVIADKLGSPIFQSADI 147
            +L IE  G+  NA+T+ E T +Y        K+ K    + V +++D L   +     I
Sbjct: 88  -ELEIENIGSHLNAYTSRENTVYYA-------KSLKEDIPKAVDILSDILTKSVLDPRAI 139

Query: 148 NKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQFPIVAGKIINL 207
            +E   I  E E    +  + ++     +  +     R   G I  +             
Sbjct: 140 ERERDVIIRESEEVDKMHDEVVFDHLHAITYKDQPLGRTILGPIKNIKSI---------T 190

Query: 208 KNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFG 246
           +N L+++   N+  + + +   G+ +   L +  Q  FG
Sbjct: 191 RNDLREYITKNYKGDRMVLAGAGAVNHDELVEYAQKYFG 229

>Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C
           (MAS1) - mitochondrial processing protease subunit
           [contig 252] FULL
          Length = 458

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 72/178 (40%), Gaps = 26/178 (14%)

Query: 29  LSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHLCEHMIISSESKKFPKRSHY 88
           L NG+T    + P  S A++   V  GS  +  +  G AH  EH+      K    R+  
Sbjct: 27  LPNGLTVATEAIPNTSSATVGIFVDAGSRAENSKNNGTAHFLEHLAF----KGTKNRTQV 82

Query: 89  H-DLLIEYNGNQ-NAFTTGEQTSFYFE-----IPNSNNKTGKPIFDELVGVIADKLGSPI 141
             ++ IE  G+  NA+T+ E T +Y +     IPN+            V +++D L   +
Sbjct: 83  GIEMEIENIGSHLNAYTSRENTVYYAKTLTQNIPNA------------VDILSDILTKSV 130

Query: 142 FQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTG---NIYTLTQ 196
             +  I +E   I  E E    +  + ++     +  +     R   G   NI T+ Q
Sbjct: 131 LDTNAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQPLGRTILGPIKNIKTIQQ 188

>Skud_3.144 Chr3 complement(224763..225236) [474 bp, 157 aa] {ON}
           YCR071C (REAL)
          Length = 157

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 55/114 (48%), Gaps = 15/114 (13%)

Query: 139 SPIFQSADINKEIQAID-NEHENNKNLVSKALYHGTKKLATQRSKFSRFSTGNIYTLTQF 197
           +PIF       +++ +D NE   N N   K  YH  +        +S +  G   T+T+ 
Sbjct: 52  TPIF------PKLEDVDMNELIGNNNF-GKGTYHVERSSTGNLPVYSAYRNGGNKTITEI 104

Query: 198 PIVAGKIINLKNVLQKHY------ADNFVAENISIVIRGSQSLHYLKKLVQTTF 245
             + G II L+N LQ+H       + + V ++  I+I+G+ ++  +K+++   F
Sbjct: 105 RKIQGDIIQLRNDLQEHLHFIPKESWSIVMQSKKIIIKGN-AVEAVKRILTKKF 157

>YMR204C Chr13 complement(670063..671325) [1263 bp, 420 aa] {ON}
           INP1Peripheral membrane protein of peroxisomes involved
           in peroxisomal inheritance; recruitment to peroxisomes
           is mediated by interaction with Pex3p at the peroxisomal
           membrane
          Length = 420

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 8/94 (8%)

Query: 148 NKEIQAIDNEHENNKNLVSKALYHGT--KKLATQRSK-----FSRFSTGNIYTLTQFPIV 200
           NK+++    +H N+ N   KA  +GT  KK  TQR +     FS F+ GN+  +  F  +
Sbjct: 39  NKKLKQDSTQHSNDTNKSVKAKKNGTSSKKTGTQRKRISTQRFSLFTYGNVQVMNSFVPI 98

Query: 201 AGKIINLKNVLQK-HYADNFVAENISIVIRGSQS 233
              I N   + +    + N V E+  +    +QS
Sbjct: 99  HNDIPNSSCIRRNSQVSANNVTESSGVFFNDTQS 132

>Skud_5.315 Chr5 (526724..530029) [3306 bp, 1101 aa] {ON} YER176W
            (REAL)
          Length = 1101

 Score = 32.7 bits (73), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 59/138 (42%), Gaps = 18/138 (13%)

Query: 967  GPANLMAQIEASVHSGNYPSNLQSQGYTVGQHKKLKDEISFRTYAFSETKVDVCLLSKLT 1026
            G  NL +Q  A     N P++ Q++ + VG   +   E S            VCL  K+T
Sbjct: 341  GNLNLNSQKNALNRKRNSPADEQTKKWKVGSDAEYSKEPS------------VCLNEKIT 388

Query: 1027 LQEFKRLFMEKISILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDEL 1086
            + E KR    K +  S+    L  +F +PM +    IS  + Q     K+K   +  +E 
Sbjct: 389  ITEEKRNHQRKTNDESV----LKDKFPSPMIRRKSEIS--SHQGKDVEKTKDGKLIYEEG 442

Query: 1087 QEIVTKTAGKPTSLFKEL 1104
            + +    + KPT  + +L
Sbjct: 443  EPLTKYNSFKPTLSYPDL 460

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 118,511,698
Number of extensions: 5214292
Number of successful extensions: 16458
Number of sequences better than 10.0: 98
Number of HSP's gapped: 16648
Number of HSP's successfully gapped: 122
Length of query: 1170
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1049
Effective length of database: 39,606,813
Effective search space: 41547546837
Effective search space used: 41547546837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)