Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D14355g7.125ON58858828000.0
SAKL0F05390g7.125ON59559919530.0
KLTH0F12540g7.125ON59561118360.0
TDEL0H028707.125ON58755418330.0
NCAS0E021307.125ON52652618240.0
Smik_6.4677.125ON54851617760.0
YPL260W7.125ON55151617670.0
Suva_16.447.125ON54951617610.0
Kwal_55.208327.125ON57560617620.0
Skud_16.187.125ON55051917450.0
Ecym_83527.125ON57959317340.0
NDAI0E036707.125ON52251217020.0
CAGL0H09108g7.125ON53251016970.0
ZYRO0C05192g7.125ON58852716900.0
KNAG0L009407.125ON54951816280.0
TBLA0A009307.125ON58652715440.0
Kpol_322.77.125ON53449915170.0
TPHA0C016107.125ON55155314610.0
KAFR0L004607.125ON51150014510.0
ADL019W7.125ON52551714420.0
Kpol_1062.587.125ON4914383753e-38
NDAI0G043201.397ON48361741.9
Smik_7.2854.118ON279145732.0
TBLA0G001802.16ON1016107742.4
NCAS0C049001.397ON47561706.2
NDAI0F045901.19ON409228706.4
YDR121W (DPB4)8.275ON19662679.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D14355g
         (588 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...  1083   0.0  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   756   0.0  
KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...   711   0.0  
TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...   710   0.0  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   707   0.0  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...   688   0.0  
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...   685   0.0  
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...   682   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   683   0.0  
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...   676   0.0  
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...   672   0.0  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   660   0.0  
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   658   0.0  
ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...   655   0.0  
KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....   631   0.0  
TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...   599   0.0  
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   588   0.0  
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   567   0.0  
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   563   0.0  
ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   560   0.0  
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   149   3e-38
NDAI0G04320 Chr7 (1039571..1041022) [1452 bp, 483 aa] {ON} Anc_1...    33   1.9  
Smik_7.285 Chr7 complement(481661..482500) [840 bp, 279 aa] {ON}...    33   2.0  
TBLA0G00180 Chr7 complement(28577..31627) [3051 bp, 1016 aa] {ON...    33   2.4  
NCAS0C04900 Chr3 complement(999764..1001191) [1428 bp, 475 aa] {...    32   6.2  
NDAI0F04590 Chr6 (1114283..1115512) [1230 bp, 409 aa] {ON} Anc_1...    32   6.4  
YDR121W Chr4 (693585..694175) [591 bp, 196 aa] {ON}  DPB4Shared ...    30   9.9  

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score = 1083 bits (2800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/588 (92%), Positives = 545/588 (92%)

Query: 1   MSVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDE 60
           MSVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDE
Sbjct: 1   MSVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDE 60

Query: 61  LRKNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTV 120
           LRKNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTV
Sbjct: 61  LRKNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTV 120

Query: 121 QSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQK 180
           QSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQK
Sbjct: 121 QSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQK 180

Query: 181 DEELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASS 240
           DEELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASS
Sbjct: 181 DEELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASS 240

Query: 241 TKRPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDINGKFKS 300
           TKRPHQKQLVPDPAVLSVESEASEKKNVLPDQVID              SHRDINGKFKS
Sbjct: 241 TKRPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDEKLKQLQEQLEKLESHRDINGKFKS 300

Query: 301 LETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLL 360
           LETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLL
Sbjct: 301 LETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLL 360

Query: 361 VTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKXXX 420
           VTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYK   
Sbjct: 361 VTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKLLE 420

Query: 421 XXXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFYDT 480
                    QRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFYDT
Sbjct: 421 SSEPVSESLQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFYDT 480

Query: 481 DGNIPEGQGTLNALLAECFDIIHELKIEAEERVEERVDIHDDGEESVEMTKDPTMRDVQE 540
           DGNIPEGQGTLNALLAECFDIIHELKIEAEERVEERVDIHDDGEESVEMTKDPTMRDVQE
Sbjct: 481 DGNIPEGQGTLNALLAECFDIIHELKIEAEERVEERVDIHDDGEESVEMTKDPTMRDVQE 540

Query: 541 RPTARYMDVYAHXXXXXXXXXXXXXXXXXFSEHSYDEEEYTTTSYADD 588
           RPTARYMDVYAH                 FSEHSYDEEEYTTTSYADD
Sbjct: 541 RPTARYMDVYAHDDEGNDDDDEDDADDNNFSEHSYDEEEYTTTSYADD 588

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/599 (68%), Positives = 464/599 (77%), Gaps = 25/599 (4%)

Query: 1   MSVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDE 60
           MS N HP  VP EEEEIL YFLDVRSFLSK+KQNRSQFLNSKDVM+TYQ+VLTKVRELD+
Sbjct: 1   MSSN-HPQEVPKEEEEILNYFLDVRSFLSKLKQNRSQFLNSKDVMETYQQVLTKVRELDD 59

Query: 61  LRKNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTV 120
            RK+SH TP++SATTLIHS +LHNRVDSV+DDVFQLLSLSFLTVGLKNSAPATYASLSTV
Sbjct: 60  TRKSSHNTPASSATTLIHSVDLHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTV 119

Query: 121 QSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVS---NSDTQSVNADA-DDIGEF 176
           Q LLEHLNESNV+THHDLRPIKERL+EVS IVE+N Y +   N+  +    +A +D  + 
Sbjct: 120 QRLLEHLNESNVFTHHDLRPIKERLDEVSEIVEKNSYRNEPENNKGKPQEPEAQEDEQDI 179

Query: 177 ALQK-DEELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLL 235
            L+K D E +KNK+EEDLLLRAKLKHC+ EY  IESKLEEI P LQS ME LFQIRRGLL
Sbjct: 180 ELKKADIEKDKNKVEEDLLLRAKLKHCLQEYFNIESKLEEIDPALQSIMEKLFQIRRGLL 239

Query: 236 SLASSTKRPHQKQLVPDPAVLSVES-EASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDI 294
           SLA+STKR  +          S ES E  ++ + +    ++              SHRD 
Sbjct: 240 SLAASTKRNAR----------SKESLEDKKRTHTVSPNFVNSKLNELQVELSELESHRDP 289

Query: 295 NGKFKSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKT 354
           +GKFKSLETDKVEE+GQ+VLNGLLDDCHDL+NDLSHQ   GISLD KLQPIYD L+DIKT
Sbjct: 290 SGKFKSLETDKVEERGQSVLNGLLDDCHDLINDLSHQTSRGISLDHKLQPIYDNLIDIKT 349

Query: 355 TLENLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAI 414
           TLENLLVTRRWTLRETDLFTYQK+LGEIDNLRV+GKFPT+  DSKGQSILLYLLRRCYAI
Sbjct: 350 TLENLLVTRRWTLRETDLFTYQKRLGEIDNLRVHGKFPTESGDSKGQSILLYLLRRCYAI 409

Query: 415 IYKXXXXXXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVD 474
           IYK            QR+HNQLSTVRRCLLELKRMGGV+NDRELYPYQMKLASLDNMRVD
Sbjct: 410 IYKLLESSEPVSEALQRIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDNMRVD 469

Query: 475 GKFYDTDGNIPEGQGTLNALLAECFDIIHELKIEAEERVEERVDIHDDGEESVEMTKDPT 534
           GKFYD DGNIPEGQGTLNALLAECFDI+HELKIEAEER EE  D +   +E +E+TKDP 
Sbjct: 470 GKFYDADGNIPEGQGTLNALLAECFDILHELKIEAEEREEESGDNNATSDE-LELTKDPE 528

Query: 535 MRDVQE-----RPTARYMDVYAHXXXXXXXXXXXXXXXXXFSEHSYDEE--EYTTTSYA 586
            RD  E     +  A+++DV                    +SEHSY++E  +YTTTSYA
Sbjct: 529 SRDEFEDDKTAQHKAKFLDVPKQYDDEEEDEEEDEDDLANYSEHSYEDEDDDYTTTSYA 587

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/611 (62%), Positives = 442/611 (72%), Gaps = 47/611 (7%)

Query: 6   HPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELRKNS 65
           HP  VP EEE  L YFL+VR+FLS++KQNRSQ+LNSKDVM TYQ+VLTKVRELD +RK+S
Sbjct: 4   HPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSS 63

Query: 66  HATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQSLLE 125
           H  P+NSATTLIH+ ELHNRVDSV+DDVFQLLSLSFLTVGLKNSAPATYASLSTVQ LLE
Sbjct: 64  HHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 123

Query: 126 HLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKDEELN 185
           HL+ESNV+THHDLRPIKERL+E+S IV Q+ Y+  ++      D      FA  +DE+ +
Sbjct: 124 HLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEISDGRID------FAKIQDEK-D 176

Query: 186 KNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTKR-P 244
           +NKIEEDLLLRAKL+HC+ EY  IESKLEEI P LQSTME LFQ+RRGLLSLA+STKR  
Sbjct: 177 RNKIEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNA 236

Query: 245 HQKQLVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDINGKFKSLETD 304
             KQ V  P             ++LP + I               SHRD +GKF SLET 
Sbjct: 237 MSKQGVKTP------------DSLLPQEGIKQRLHELEAELTEIESHRDSSGKFVSLETG 284

Query: 305 KVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLLVTRR 364
           ++  KGQNVLNGLLDDCHDL+NDLSH  +  +SLD+KLQPIYD L+DIKTTLENLLVTRR
Sbjct: 285 EIAGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRR 344

Query: 365 WTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKXXXXXXX 424
           WTLRETDLF+YQK+L EID LRV GKFPT++ D+KGQ+ILLYLLRRCYAIIYK       
Sbjct: 345 WTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEP 404

Query: 425 XXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFYDTDGNI 484
                Q++HNQLSTVRRCLLELKRMGGV+NDRELYPYQMKLASLDN+RVDGKFYD DGNI
Sbjct: 405 VSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNI 464

Query: 485 PEGQGTLNALLAECFDIIHELKIEAEER---------------VEERVDIHDDGEESVEM 529
           PEGQGTLNALLAECFDI+HELKIEAEER                +    IH+      E 
Sbjct: 465 PEGQGTLNALLAECFDILHELKIEAEERETPEDPQDDEEADDDHDHAGSIHEGSSAKGEA 524

Query: 530 TKDPT-----MRDVQERPTARYMDV---YAHXXXXXXXXXXXXXX--XXXFSEHSY--DE 577
           T   +          ++P ARY+D    Y+H                   +SEHSY  DE
Sbjct: 525 TTADSHAAAAAAAAPKKPKARYLDASRPYSHDDDDEGDGDGDGDDEYTTNYSEHSYEDDE 584

Query: 578 EEYTTTSYADD 588
           ++Y TTS+A+D
Sbjct: 585 DDYATTSHAED 595

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/554 (65%), Positives = 425/554 (76%), Gaps = 26/554 (4%)

Query: 2   SVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDEL 61
           S + HP  VP EEE IL Y L VR+ L ++KQNR Q+LNSK+V + YQ+VLTKVRELD++
Sbjct: 10  SNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQI 69

Query: 62  RKNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQ 121
           RK++H TPSNSATTLIHS+ELHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTVQ
Sbjct: 70  RKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQ 129

Query: 122 SLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNAD-ADDIGEFALQK 180
            LLEHLNESNV+T HDLRPI+ERL E+S IVE + Y        V+ D  +DI E   + 
Sbjct: 130 RLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSY-----KNEVSGDNLEDIDEKLPEA 184

Query: 181 D----EELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLS 236
           D    EE NKNKIEEDLLLRAKL+HC+DEY++ ESK+EEI P L + ME LF+IRRGLLS
Sbjct: 185 DRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLS 244

Query: 237 LASSTKRPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDING 296
           LA+S+KR                S  S +K+ L  + +               SHRD NG
Sbjct: 245 LAASSKR----------------SNPSLEKSPLSQEHVHEQVEKLESQLTELESHRDENG 288

Query: 297 KFKSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTL 356
           KFKSLETDKVE+KGQNVLNGLLDDCHDL++DLSHQK+GGI LD KLQPIY+QL+DIKT+L
Sbjct: 289 KFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSL 348

Query: 357 ENLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIY 416
           ENLLVTRRWTLRETDLFT+QK+L EID+LRV+GKFPTD   SKGQSILLYLLRRC+AIIY
Sbjct: 349 ENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIY 408

Query: 417 KXXXXXXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGK 476
           K            Q +HNQLSTVRRCLLELKRMGGV+NDRELYPYQMKLASLD++R DGK
Sbjct: 409 KLLESSEPVSESLQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGK 468

Query: 477 FYDTDGNIPEGQGTLNALLAECFDIIHELKIEAEERVEERVDIHDDGEESVEMTKDPTMR 536
           FYD+DGNIPEGQGTLNALLAECFDI+HELKIEA+ER E       + E+   +  D    
Sbjct: 469 FYDSDGNIPEGQGTLNALLAECFDIVHELKIEAQERAETESAQQSEAEQDDGLVNDTDND 528

Query: 537 DVQERPTARYMDVY 550
           +  ++P ARY+DV+
Sbjct: 529 NDGDQPVARYLDVH 542

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/526 (68%), Positives = 416/526 (79%), Gaps = 15/526 (2%)

Query: 2   SVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDEL 61
           S  +HP  VP EEE+IL Y LDVRSFLSK+KQNR+Q+LNSKDV  TYQ VLTKVRELDE+
Sbjct: 6   SNTTHPQEVPKEEEDILNYLLDVRSFLSKLKQNRTQYLNSKDVQITYQNVLTKVRELDEI 65

Query: 62  RKNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQ 121
           RKNSH TPS SATTLIHS+ELHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTVQ
Sbjct: 66  RKNSHDTPSKSATTLIHSNELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQ 125

Query: 122 SLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKD 181
           SLLEHL+ESN++THHDL PIK+RLNE+S IVE  K       + +N   DD  +     D
Sbjct: 126 SLLEHLSESNIFTHHDLSPIKDRLNEISKIVE--KSCGKLPDEQLN---DDEEQNLKDID 180

Query: 182 EELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASST 241
            E NKNKIE+DLLLRAKL+HC+DEY  IESKLEEI P L STME LFQIRRGLLSLA+ST
Sbjct: 181 TERNKNKIEQDLLLRAKLQHCLDEYKQIESKLEEIDPSLTSTMEKLFQIRRGLLSLAAST 240

Query: 242 KRPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDINGKFKSL 301
           K+   +        L+ E E  E K+++  + ++              ++RD +GKFKSL
Sbjct: 241 KKNMNQ------GSLTSEKEL-ENKHLVSQEYVNKKLHALEAEVQALEANRDESGKFKSL 293

Query: 302 ETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLLV 361
           ET++V E GQNVLNGLLDDC DL+NDLSHQ +G ++LD  LQPIY+ L+DIKTTLENL++
Sbjct: 294 ETNEVAENGQNVLNGLLDDCLDLINDLSHQTNGHLNLDPTLQPIYEMLIDIKTTLENLMI 353

Query: 362 TRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKXXXX 421
           TRRWTLRETDLFTYQK+LGEIDN+RV G+FPT H DSKGQ ILLYLLRRCYAIIYK    
Sbjct: 354 TRRWTLRETDLFTYQKQLGEIDNMRVEGRFPTKHIDSKGQFILLYLLRRCYAIIYKLLES 413

Query: 422 XXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFYDTD 481
                   Q +HNQLSTVRRCL+ELKRMGGVDNDRELYPYQMKLASLDN+RVDGKFYD++
Sbjct: 414 SEPVSESLQPIHNQLSTVRRCLMELKRMGGVDNDRELYPYQMKLASLDNLRVDGKFYDSE 473

Query: 482 GNIPEGQGTLNALLAECFDIIHELKIEAEERVEER---VDIHDDGE 524
           GNIPEGQGTLNALLA CFDI+HELK+EAEER E+     + +DDG+
Sbjct: 474 GNIPEGQGTLNALLAACFDIMHELKVEAEEREEQSKSDAENNDDGQ 519

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/516 (67%), Positives = 402/516 (77%), Gaps = 14/516 (2%)

Query: 6   HPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELRKNS 65
           HP  VP EEE IL Y L+VRS L+K+KQNR+Q+LNSKDV  TYQ VLTKVRELD++RKNS
Sbjct: 9   HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68

Query: 66  HATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQSLLE 125
           H TP+ SA TLIH++ELHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTV+SLLE
Sbjct: 69  HETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLE 128

Query: 126 HLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKDEELN 185
           HLNESNV+THHDL PIKERL+E+S IVEQ    ++S T + + + D + E     D E  
Sbjct: 129 HLNESNVFTHHDLSPIKERLDEISKIVEQK---NSSSTYNEDGNDDRLREI----DNERK 181

Query: 186 KNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTKRPH 245
           KNKIEEDLLLRAKLKHC DEY+ +ESKLEEI P L S ME LF+IRRGLLSL +S K+  
Sbjct: 182 KNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVASAKKTM 241

Query: 246 QKQLVPDPAVLSVESEASEKKNVLPD-------QVIDXXXXXXXXXXXXXXSHRDINGKF 298
            K      ++L  ++++    N L D       + +               S+RD +GKF
Sbjct: 242 SKSSANINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGKF 301

Query: 299 KSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLEN 358
           KSLET +V   GQ+VLNGLLDDCHDL+NDLSHQ +GG+SLD  LQPIY+QL+DIKTTLEN
Sbjct: 302 KSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLEN 361

Query: 359 LLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKX 418
           L++TRRWTLRETDLF+YQKKL EIDN R+NGKFPT   DSKGQSILLYLLRRCYAIIYK 
Sbjct: 362 LMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKL 421

Query: 419 XXXXXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFY 478
                      Q +HNQLSTVRRCLLELKRMGGV+N+RELYPYQMKLASLDN+R DG FY
Sbjct: 422 LESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFY 481

Query: 479 DTDGNIPEGQGTLNALLAECFDIIHELKIEAEERVE 514
           D+DGNIPEGQG LNALLAECFDI+HELK+EAEER +
Sbjct: 482 DSDGNIPEGQGILNALLAECFDILHELKVEAEERAQ 517

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/516 (66%), Positives = 404/516 (78%), Gaps = 14/516 (2%)

Query: 6   HPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELRKNS 65
           HP  VP EEE IL Y L+VRS L+K+KQNR+Q+LNSKDV  TYQ VLTKVRELD++RKNS
Sbjct: 9   HPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68

Query: 66  HATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQSLLE 125
           H TP+ SA TLIHS+ELHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTV+SLLE
Sbjct: 69  HETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLE 128

Query: 126 HLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKDEELN 185
           HLNESNV+THHDL PIKERL E+S IVEQ    ++S     + + D + E     D E  
Sbjct: 129 HLNESNVFTHHDLSPIKERLEEISKIVEQK---NSSPAYDEDGNDDRLREI----DNERK 181

Query: 186 KNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTKRPH 245
           KNKIEEDLLLRAKLKHC DEY+ +E KLEEI P L + ME LF+IRRGLLSL +S K+  
Sbjct: 182 KNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTM 241

Query: 246 QKQLVPDPAVLSVESEA-------SEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDINGKF 298
            K  +   ++L  +++        ++ K+++  + +               S+RD +GKF
Sbjct: 242 SKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKF 301

Query: 299 KSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLEN 358
           KSLE+ +V EKGQ+VLNGLLDDCHDLVNDLSHQK+GG++LD  LQPIY+QL+DIKTTLEN
Sbjct: 302 KSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLEN 361

Query: 359 LLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKX 418
           L++TRRWTLRETDLF+YQKKL EIDN R+NGKFPT   DSKGQSILLYLLRRCYAIIYK 
Sbjct: 362 LMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKL 421

Query: 419 XXXXXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFY 478
                      Q +HNQLSTVRRCLLELKRMGGV+N+RELYPYQMKLASLDN+R +G FY
Sbjct: 422 LESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIFY 481

Query: 479 DTDGNIPEGQGTLNALLAECFDIIHELKIEAEERVE 514
           D+DGNIPEGQG LNALLAECFDI+HELK+EAEE+ +
Sbjct: 482 DSDGNIPEGQGILNALLAECFDILHELKVEAEEKAQ 517

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/516 (66%), Positives = 397/516 (76%), Gaps = 15/516 (2%)

Query: 6   HPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELRKNS 65
           HP  VP EEE IL Y L+VRS L+K+KQNR+Q+LNSKDV  TYQ VLTKVRELD++RKNS
Sbjct: 9   HPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNS 68

Query: 66  HATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQSLLE 125
           H TP+ SA TLIHS+ELHNRVDSV+DDVFQL+SL FLTVGLKNSAPATYASLSTV+SLLE
Sbjct: 69  HDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLLE 128

Query: 126 HLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKDEELN 185
           HLNESNV+THHDL PIKERL E+  IVE+N           N D D   +   + D E N
Sbjct: 129 HLNESNVFTHHDLSPIKERLEEIRKIVEKNT--------GPNYDEDGNDDQLREIDNERN 180

Query: 186 KNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTKRPH 245
           KN+IEEDLLLRAKLKHC DEY+ +ESKLEEI P L + ME LF+IRRGLLSL +S K+  
Sbjct: 181 KNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKTM 240

Query: 246 QKQLVPDPAVLSVESEASEKKNVLPD-------QVIDXXXXXXXXXXXXXXSHRDINGKF 298
            +  V   ++L   ++     N L D       + ++              S+RD +GKF
Sbjct: 241 SQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKF 300

Query: 299 KSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLEN 358
           KSLE+ KV E GQ+VLNGLLDDCHDLVNDLSHQ +GG++LD  LQPIY+QL+DIKTTLEN
Sbjct: 301 KSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLEN 360

Query: 359 LLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKX 418
           L++TRRWTLRETDLF+YQKKL EID+ RV GKFPT   DSKGQSILLYLLRRCYAIIYK 
Sbjct: 361 LMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYKL 420

Query: 419 XXXXXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFY 478
                      Q VHNQLSTVRRCLLELKRMGGV+N+RELYPYQMKLASLDN+R DG FY
Sbjct: 421 LESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFY 480

Query: 479 DTDGNIPEGQGTLNALLAECFDIIHELKIEAEERVE 514
           D+DGNIPEGQG LNALLAECFDI+HELK+EAEER +
Sbjct: 481 DSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQ 516

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/606 (59%), Positives = 431/606 (71%), Gaps = 51/606 (8%)

Query: 3   VNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELR 62
           ++ HP  VP EEE  L YFL+VR++LS++KQNRSQ+LNSK+VM  YQ+VLTKVRELDE+R
Sbjct: 1   MHKHPQEVPAEEEASLAYFLEVRNYLSRLKQNRSQYLNSKEVMSAYQQVLTKVRELDEIR 60

Query: 63  KNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQS 122
           K SH+ P NSATTLIH+ ELHNRVDSV+DDVFQLLSLSFLTVGLKNSAPATYASLSTVQ 
Sbjct: 61  KRSHSAPRNSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQR 120

Query: 123 LLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKDE 182
           LLEHL+ESNV+THHDLRPIKERL+E+S IV Q+ +    +   +N  + D  + + +KD 
Sbjct: 121 LLEHLDESNVFTHHDLRPIKERLDEISEIVTQSSFFK--EGGEINNGSIDFTKISDEKD- 177

Query: 183 ELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTK 242
              +NKIEEDLLLRAKLKHC+ EY  IESKLEEI P LQ TME LF++RRGLLSLA+STK
Sbjct: 178 ---RNKIEEDLLLRAKLKHCLQEYAHIESKLEEIDPRLQKTMEKLFELRRGLLSLAASTK 234

Query: 243 RPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDINGKFKSLE 302
           R          A+L    +A E  + L  + +               S R+ +G F S +
Sbjct: 235 RN---------AMLKDGHKAPE--SPLSQESVKEKLHSLEAKLTQIESQRNASGYFVSAD 283

Query: 303 TDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLLVT 362
           T ++ E+GQ+VLNGLLDDCHDL+NDLSH  +  ++LD+KLQPIYD L++IKTTLENLLVT
Sbjct: 284 TGEIVERGQSVLNGLLDDCHDLINDLSHHANNVVTLDSKLQPIYDNLIEIKTTLENLLVT 343

Query: 363 RRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKXXXXX 422
           RRWTLRETDLF YQK+L EID LRV GKFPT+  D+KGQ+ILLYLLRRCYAIIYK     
Sbjct: 344 RRWTLRETDLFAYQKRLSEIDKLRVGGKFPTESGDAKGQAILLYLLRRCYAIIYKLLECS 403

Query: 423 XXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFYDTDG 482
                  Q++HNQLSTVRRCLLELKRMGGV+NDRELYPYQMKLASLDN+RVDGKFYD DG
Sbjct: 404 EPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDG 463

Query: 483 NIPEGQGTLNALLAECFDIIHELKIEAEERVEERVDIHDDGEESVEMTKDPTMRDVQE-- 540
           NIPEGQGTLNALLAECFDI+HELKIEAE R         DG  + +   D          
Sbjct: 464 NIPEGQGTLNALLAECFDILHELKIEAEYR---------DGSGAEDAESDAGFEAASSTA 514

Query: 541 ------------RPTARYMD----VYAHXXXXXXXXXXXXXXXXXFSEHSY--DEEEYTT 582
                       +  A ++D     YAH                 +SEHSY  DE++Y T
Sbjct: 515 TATATATATDHGKVKATFLDDSKHQYAH-----DDDDDDDEYTTNYSEHSYEDDEDDYAT 569

Query: 583 TSYADD 588
           TS+A+D
Sbjct: 570 TSHAED 575

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/519 (65%), Positives = 403/519 (77%), Gaps = 14/519 (2%)

Query: 2   SVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDEL 61
           S   HP  VP EEE IL Y L+VRS L+K+KQNR+Q+LNSKDV  TYQ VLTKVRELD++
Sbjct: 4   SAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDI 63

Query: 62  RKNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQ 121
           RKNSH TP+ SA TLIHS+ELHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTV+
Sbjct: 64  RKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVE 123

Query: 122 SLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKD 181
           SLLEHLNESNV+THHDL PIKERL+E+S IVEQ    ++S     +A+   I E     D
Sbjct: 124 SLLEHLNESNVFTHHDLSPIKERLDEISKIVEQK---NSSPMYEEDANDARIREI----D 176

Query: 182 EELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASST 241
            E  +NKIEEDLLLRAKLKHC DEY+ +ESKLEEI P L + ME LF+IRRGLLSL +S 
Sbjct: 177 NERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVASA 236

Query: 242 KRPHQKQLVPDPAVL-------SVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDI 294
           K+   K      ++L       + +++  + K+++  + +               S+RD 
Sbjct: 237 KKTMSKSSANINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDD 296

Query: 295 NGKFKSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKT 354
           +GKFKSLET +V EKGQ+VLNGLLDDCHDL++DLSHQ +GG++LD  LQP Y+QL+DIKT
Sbjct: 297 SGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKT 356

Query: 355 TLENLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAI 414
           TLENL++TRRWTLRETDLF+YQKKL EID+ R+NGKFPT   DSKGQSILLYLLRRCYAI
Sbjct: 357 TLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAI 416

Query: 415 IYKXXXXXXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVD 474
           IYK            Q +HNQLSTVRRCLLELKRMGGV+N+RELYPYQMKLASLDN+R +
Sbjct: 417 IYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTN 476

Query: 475 GKFYDTDGNIPEGQGTLNALLAECFDIIHELKIEAEERV 513
           G FYD+DGNIPEGQG LNALLAECFDI+HELK+EAEER 
Sbjct: 477 GIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAEERA 515

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/593 (60%), Positives = 432/593 (72%), Gaps = 33/593 (5%)

Query: 2   SVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDEL 61
           S N     +P EEE+IL+YFL++R++LS++KQNR+QFL SKDV+ TYQ+VLTKVRELD++
Sbjct: 3   SANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKI 62

Query: 62  RKNSHATPSNSA--TTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLST 119
           RK +H +  N    TTLIHS +LHNRVDSVIDDVFQLLSL FLTVGLKNSAPATYASLST
Sbjct: 63  RKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLST 122

Query: 120 VQSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQ 179
           VQSLL+HLNESNVYTH+DL+PIKERL+E+S IVE+N Y       ++  D  D   FA  
Sbjct: 123 VQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSY------WNIPTDGGDGNAFADD 176

Query: 180 KDEELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLAS 239
            +++  +N IEE+LLLRAKL++C+  YN IE+KLE I  DLQ  ME LFQIRRGLLSLA+
Sbjct: 177 LEDKRKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAA 236

Query: 240 STK-RPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDINGKF 298
           S K R  Q++          + E  ++  +L  + I+              SHR+ +GKF
Sbjct: 237 SAKSRVEQEE----------QDENDDELCILSHEKINERLKALETELADVRSHRNESGKF 286

Query: 299 KSL-ETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLE 357
            S+ + + V EKGQ VLNGLLDDCHDL+ DLSHQ   G+ LD  +QPIYD LV IKT LE
Sbjct: 287 VSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILE 346

Query: 358 NLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYK 417
           NLLVTRRWTLRETDLFTYQKKL E+D+LRVNGKFP++  DSKGQ+ILLYLLRRCYAIIYK
Sbjct: 347 NLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYK 406

Query: 418 XXXXXXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKF 477
                       +R+HNQLSTVR CLLELKRMGGVDN+RELYPYQMKLASLDNMRVDGKF
Sbjct: 407 LLESSEPVSESLERIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKF 466

Query: 478 YDTDGNIPEGQGTLNALLAECFDIIHELKIEAEERVEERVDIHDDGE--------ESVEM 529
           YD DGNIPEGQGTLNALLAECFDI+HE+KIEAE R EE    ++ GE        ++++M
Sbjct: 467 YDPDGNIPEGQGTLNALLAECFDILHEMKIEAEVR-EEAAQSNEAGEKPPNNINNQTIQM 525

Query: 530 TKDPTMRDVQE-RPTARYMDVYAHXXXXXXXXXXXXXXXXXFSEHSYDEEEYT 581
           TKD T RDV E RP  RY+DVY                   +S+HSY+E+E T
Sbjct: 526 TKDGTNRDVAEVRPNIRYLDVY---NPNREDDGIYDDVYTHYSDHSYEEDETT 575

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/512 (65%), Positives = 399/512 (77%), Gaps = 20/512 (3%)

Query: 2   SVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDEL 61
           S ++HP  VP EEE IL Y LDVR++L  +K+NR+Q+LNS+ V  TYQ+VLTKVRELDE+
Sbjct: 10  SNSTHPQLVPKEEEGILKYLLDVRNYLQNLKRNRTQYLNSQAVQKTYQEVLTKVRELDEI 69

Query: 62  RKNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQ 121
           RKN+HATPSNSATTLIHS ELHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTVQ
Sbjct: 70  RKNNHATPSNSATTLIHSMELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQ 129

Query: 122 SLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKD 181
           SLLEHLNESN++THHDL PIKERL+++S IVE+      S +Q +  D +   +F    D
Sbjct: 130 SLLEHLNESNIFTHHDLGPIKERLDQISKIVEE------SCSQEIKLDNEGDDQFNQYLD 183

Query: 182 E---ELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLA 238
           E   E N+NKIE+DLLLRAKL+HC+DEY+ IESKLEEI P L S +E LFQIRRGLLSL 
Sbjct: 184 ETELEQNQNKIEQDLLLRAKLQHCLDEYHEIESKLEEIDPSLNSILEKLFQIRRGLLSLV 243

Query: 239 SSTKRPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDINGKF 298
           +S K+          ++LS + E  EK  + P + ++              S+RD  GKF
Sbjct: 244 ASAKKN---------SLLS-QKELDEKHLISP-EYLNKKLLELEKEFKDLESNRDEFGKF 292

Query: 299 KSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLEN 358
           KSLET ++ E GQNVL GL DDC+DL+NDLSHQ +G ++LD  LQP+Y+QL++IKTTLE 
Sbjct: 293 KSLETGEIPENGQNVLKGLEDDCNDLINDLSHQTNGRLTLDPDLQPVYEQLIEIKTTLEK 352

Query: 359 LLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKX 418
           L++TRRWTLRETDLFTYQKKLGEIDNLRV GKFP+   DSKGQ I+LYLLRRCYAIIYK 
Sbjct: 353 LMITRRWTLRETDLFTYQKKLGEIDNLRVKGKFPSKSSDSKGQFIILYLLRRCYAIIYKL 412

Query: 419 XXXXXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFY 478
                      Q +HNQLSTVRRCLL++KR+GGV N+RELYPYQMKLASLDN+R DG FY
Sbjct: 413 LECSEPVSESLQPIHNQLSTVRRCLLDIKRLGGVSNERELYPYQMKLASLDNLRKDGIFY 472

Query: 479 DTDGNIPEGQGTLNALLAECFDIIHELKIEAE 510
           D+DGNIPEGQGTLNALLA CFDI+HE+K+EAE
Sbjct: 473 DSDGNIPEGQGTLNALLAACFDIVHEMKVEAE 504

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 475 GKFYDTD-GNIPE-GQGTLNALLAECFDIIHELKIEAEERVEERVDIHDDGEESVEMTKD 532
           GKF   + G IPE GQ  L  L  +C D+I++L  +   R+    D+    E+ +E+   
Sbjct: 290 GKFKSLETGEIPENGQNVLKGLEDDCNDLINDLSHQTNGRLTLDPDLQPVYEQLIEIKTT 349

Query: 533 PTMRDVQERPTARYMDVYAH 552
                +  R T R  D++ +
Sbjct: 350 LEKLMITRRWTLRETDLFTY 369

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/510 (65%), Positives = 398/510 (78%), Gaps = 20/510 (3%)

Query: 1   MSVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDE 60
           +S  +HP  VP EEE IL Y L+VRSFLSK+K+NR+Q+LNSKDV++TYQ+VLT+VRELD 
Sbjct: 8   VSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDG 67

Query: 61  LRKNSHATP--SNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLS 118
           +RK+S         ATTLIH +++HNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLS
Sbjct: 68  IRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS 127

Query: 119 TVQSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADD-IGEFA 177
           TVQ LLEHL ESNV+THHDLRPIKERL+E+S IVE+          SV +  +D + EF 
Sbjct: 128 TVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEK----------SVESRPEDEVAEFK 177

Query: 178 LQKDEELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSL 237
            + D E NKN+IE+DLLL+AKL+HCIDEYN +ESKLEEI PDL   ME LF++RRGLLSL
Sbjct: 178 -EIDTERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSL 236

Query: 238 ASSTKRPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDINGK 297
           A+S+K+    +   +PA L       + K+VL  + +               + RD NG+
Sbjct: 237 AASSKKNIPDENYKEPAKLD------DSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQ 290

Query: 298 FKSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLE 357
           F S  T K E++GQN+LNGLLDDC+DL+NDLSHQ +GG++LD  LQPIY++L+DIKTTLE
Sbjct: 291 FVSKSTGKAEQRGQNILNGLLDDCNDLINDLSHQTNGGLTLDPYLQPIYEKLIDIKTTLE 350

Query: 358 NLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYK 417
           NL++TRRWTLRETDLFTYQK+L EIDN+RV+GKFPT  PDSKGQSI+LYLLRRCYAIIYK
Sbjct: 351 NLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYK 410

Query: 418 XXXXXXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKF 477
                       Q VHNQLSTVRRCLLELKRMGGV+N+RELYPYQMKLASLDN+R DGKF
Sbjct: 411 LLESSEPVSESLQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKF 470

Query: 478 YDTDGNIPEGQGTLNALLAECFDIIHELKI 507
           YD+DGNIPEGQG LNALLA CFDI+HELK+
Sbjct: 471 YDSDGNIPEGQGILNALLAGCFDILHELKV 500

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/527 (62%), Positives = 401/527 (76%), Gaps = 12/527 (2%)

Query: 1   MSVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDE 60
           ++ + HP  VP EEE +L YFL++R+ LS++KQNR+++L+SK V  TY++VLT+VRELD+
Sbjct: 10  ITSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDD 69

Query: 61  LRKNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTV 120
           +RK++H TPS+SATTLIH++ELHNRVDSV+DDVFQLLSL FLTVGLKNSAPA Y+SLSTV
Sbjct: 70  VRKSNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTV 129

Query: 121 QSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNA---DADDIGEFA 177
           Q LLEHLNESNV+T HDLRPIKERL E+  IVE++   +    +       +A D+ E  
Sbjct: 130 QRLLEHLNESNVFTMHDLRPIKERLIEIKKIVEKSCEKNKEAAKEEEEYLKNAPDLDEAD 189

Query: 178 LQKDEELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSL 237
               EE  +NKIEEDLLLRAKL+HC+DEY + E+K+E + P L + M+ LFQIRR LLSL
Sbjct: 190 RNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRELLSL 249

Query: 238 ASSTKRPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDINGK 297
           A+S K+          +  S E E  E K+VL  + ++              S+RD  GK
Sbjct: 250 AASAKKT--------TSSASAEKEL-ENKHVLAPESVNTRVELLQKELNEIESYRDETGK 300

Query: 298 FKSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLE 357
           FKS E+++  EKGQNVLNGLL DC+DL+ DLSHQK+GGI LD +LQPIY +L+DIKTTLE
Sbjct: 301 FKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLE 360

Query: 358 NLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYK 417
           NLL+TRRWTLRETDLFTYQK+LGEID+LRVN KFPTD  D+KGQ+ILLYLLRRCYAIIYK
Sbjct: 361 NLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYK 420

Query: 418 XXXXXXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKF 477
                       Q +HNQLSTVRRCLL L+RMGG++N RELYPYQMKLASLD +RVDGKF
Sbjct: 421 LLESSEPVSESLQPLHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKF 480

Query: 478 YDTDGNIPEGQGTLNALLAECFDIIHELKIEAEERVEERVDIHDDGE 524
           YD DGNIPEGQ TLNALLAECFDIIHE+KIEAEE+ E       +G+
Sbjct: 481 YDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTESETQSEAEGD 527

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/518 (61%), Positives = 394/518 (76%), Gaps = 26/518 (5%)

Query: 10  VPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELRKNSHATP 69
           VP EEE IL YFLDVR+ LS++K+NR+Q+LNS +V  TYQ+VLTKVRELD +RK +H   
Sbjct: 15  VPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAIRKKNHDAV 74

Query: 70  SNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQSLLEHLNE 129
           + +  TLIH+++LHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTV+SLL+HL E
Sbjct: 75  ATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLQHLEE 134

Query: 130 SNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQK-DEELNKNK 188
           + +YTHHDL+PIK+RLNE+S IVE+    S + T ++    ++  E A++  D E  +NK
Sbjct: 135 AKIYTHHDLKPIKDRLNEISKIVEE----SCAQTNAIQDALENDEEQAIKDIDAERTRNK 190

Query: 189 IEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTK------ 242
           +E++LLL+AKLKHC+D YN +ESKLE+I P L S ME LFQIRRGLLSL +S++      
Sbjct: 191 LEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSRNMDSQI 250

Query: 243 ---------RPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRD 293
                    R   +  + +P  L  E  + +KKN +  +++               +HRD
Sbjct: 251 SEEDLDTSSRTSSQSNIANP--LGNELGSEQKKNAISHKLVREKFEVLRNDLKNLEAHRD 308

Query: 294 INGKFKSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGG----ISLDTKLQPIYDQL 349
            +GKFKSLETDKV E GQ VLNGLLDDC+DLV+DLSHQ + G    +S+D  LQP+Y++L
Sbjct: 309 EDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERL 368

Query: 350 VDIKTTLENLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLR 409
           ++IKTTLENL++TRRWTLRETDLF+YQKKL EIDNLRVNG+FPT+  DS+GQSILLYLLR
Sbjct: 369 LEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLR 428

Query: 410 RCYAIIYKXXXXXXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLD 469
           RCYAIIYK            Q +HNQLSTVRRCLLELKRMGGV+N+RELYPYQMKLASLD
Sbjct: 429 RCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLD 488

Query: 470 NMRVDGKFYDTDGNIPEGQGTLNALLAECFDIIHELKI 507
           N+R DG FYD+DGNIPEGQG LNALLA CFDIIHELK+
Sbjct: 489 NLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/527 (57%), Positives = 385/527 (73%), Gaps = 10/527 (1%)

Query: 2   SVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDEL 61
           S N+HP  VP+EEE+IL + L+VR+ L+K+KQNR+QFLN+K V  TYQ VLTKVRELDE+
Sbjct: 10  SRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEI 69

Query: 62  RKNSHATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQ 121
           RKNS  TP+ +ATTLIH S+LHNRVDSV+DDVFQLLSL FLTVG+KNSAPATY+SLSTVQ
Sbjct: 70  RKNSLTTPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQ 129

Query: 122 SLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKD 181
            LLEHLNES ++T HDLRPIKERL+E+  IVE++ Y ++    S            ++ +
Sbjct: 130 CLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSKQEHELIEIE 189

Query: 182 EELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASST 241
            E  +N+IEEDLL+RAKL+ CI+++N +ES+LE+I+P+L S ++ L+ IRRGLLSLAS T
Sbjct: 190 NERTRNRIEEDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPT 249

Query: 242 KRPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDINGKFKSL 301
                K    +  + S     S+K +       +              S RD NG +KSL
Sbjct: 250 NDTLSKS--DNNHIASTNHNVSDKSHK------ELVLLKMKKQLVEIESQRDENGYYKSL 301

Query: 302 ETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLLV 361
           ET+KVE +GQ ++N L+DDC+DL+NDLSH ++G I  D  LQ IY  L+DIKT L NL+V
Sbjct: 302 ETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLMV 361

Query: 362 TRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKXXXX 421
           TRRWTLRETDLF+YQKKL EID+LRVNGKF +   D+KGQSI+LYLLRRCYAIIYK    
Sbjct: 362 TRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKLLES 421

Query: 422 XXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFYDTD 481
                   Q +H QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD +R+DGKFYD +
Sbjct: 422 SEPISESLQSIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDAN 481

Query: 482 GNIPEGQGTLNALLAECFDIIHELKIEAE--ERVEERVDIHDDGEES 526
           G+IPEGQG LNA+LAECFD++HELK +AE     E    I+ D E+S
Sbjct: 482 GDIPEGQGILNAMLAECFDMVHELKCDAEAYSSSENATPINTDKEDS 528

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/499 (60%), Positives = 369/499 (73%), Gaps = 24/499 (4%)

Query: 9   AVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELRKNSHAT 68
            VP EEE IL Y LDVR+ L+K+K NRSQFLNSK+V + +Q+VLTKVRELD++RK     
Sbjct: 19  GVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGE 78

Query: 69  PSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQSLLEHLN 128
            +  + T+IH+  LHN+VDS++DDVFQLLSL FLTVGLKNSAPATY+SLSTVQ LLEHL+
Sbjct: 79  DAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLD 138

Query: 129 ESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKDEELNKNK 188
           ESN++T+HDLRPIK+RL+E+S IVE N Y  N D         D+   A + +E+ NKNK
Sbjct: 139 ESNIFTNHDLRPIKDRLDEISTIVENNSY-RNYDF--------DLTNPADETEEKRNKNK 189

Query: 189 IEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTKRPHQKQ 248
           IEEDLLLRAKLKHC+DEYN I SKLEEI P+L S ME L+ IRR LLSLAS +++   ++
Sbjct: 190 IEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIRRSLLSLASPSRKIDTRE 249

Query: 249 LVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDINGKFKSLETDKVEE 308
              D +  +   E+ E                         SHRD NG FKSLET +V  
Sbjct: 250 ---DFSQFNSSKESQEAL------------SSLEQELEELESHRDENGNFKSLETGEVVL 294

Query: 309 KGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLLVTRRWTLR 368
           KGQNVL GL+D+CHDL+ND ++  +G   +D +L+PIYD+L++IKT L NL++TRRWTLR
Sbjct: 295 KGQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLR 354

Query: 369 ETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKXXXXXXXXXXX 428
           +TDLF YQKKL  IDN RVNGKFPT   D+KGQ+ILLYLLRRCYAIIYK           
Sbjct: 355 DTDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKLLESSVPVSES 414

Query: 429 XQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFYDTDGNIPEGQ 488
            Q +HNQLST RRCLL LKRMGGV+++RELYPYQ+KLASLD +R+DGKF+D +G IPEGQ
Sbjct: 415 LQSIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQ 474

Query: 489 GTLNALLAECFDIIHELKI 507
           GTLNALLAECFDI+HEL+I
Sbjct: 475 GTLNALLAECFDIMHELEI 493

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/553 (54%), Positives = 389/553 (70%), Gaps = 39/553 (7%)

Query: 9   AVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELRKNSHA- 67
            VP  E +IL Y +DVR  L+++K NRS++LNSK+V   +Q+VLTKVRELD++RK+    
Sbjct: 16  GVPESEHDILKYLIDVRVRLTQLKTNRSKYLNSKEVRLLHQEVLTKVRELDDIRKSKLKD 75

Query: 68  -----TPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQS 122
                + +   TTL+ +  LHN+VDS++DDVFQLLSL FLTVGLKNSAPATY SLSTVQ 
Sbjct: 76  DGQDDSQTQQITTLLCNLTLHNKVDSLVDDVFQLLSLCFLTVGLKNSAPATYTSLSTVQK 135

Query: 123 LLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKDE 182
           LLEHL+ESN++T+HDLRPIKERL+E+S IV+ N Y      ++   + D+I    +  D+
Sbjct: 136 LLEHLDESNIFTNHDLRPIKERLDEISKIVQNNSY------KNYEFNEDEINPNQVD-DD 188

Query: 183 ELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTK 242
           E+ +N IEEDLLLRAKLK C DE+  I SKLEEI P+L S ME L+ IRR LLSLAS T 
Sbjct: 189 EIKQNLIEEDLLLRAKLKFCNDEFARIHSKLEEIDPELNSIMEKLYHIRRNLLSLASPT- 247

Query: 243 RPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDINGKFKSLE 302
             H+     + ++ +   E+ +    L D++ +              +HRD +G FKSLE
Sbjct: 248 --HKIDTTENISIFNNNEESRKMLKHLSDELTELE------------THRDEDGNFKSLE 293

Query: 303 TDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLLVT 362
           T++V+ KGQN L GL+D+CHDL+ND ++       LD  LQPIY+ L++IKT L NL++T
Sbjct: 294 TNEVKLKGQNALAGLVDNCHDLINDFTNSSGDNQILDKNLQPIYNNLINIKTNLANLMIT 353

Query: 363 RRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKXXXXX 422
           RRWTLRETDLF YQK+L EID+ RVNGKFP++  ++KGQSILLYLLRRCYAIIYK     
Sbjct: 354 RRWTLRETDLFQYQKRLKEIDDQRVNGKFPSESGNTKGQSILLYLLRRCYAIIYKLLESS 413

Query: 423 XXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFYDTDG 482
                  Q +HNQLST RRCLL LKRMGGV++ RELYPYQ+KLASLD +R+DGKFYD+ G
Sbjct: 414 EPVSESLQPIHNQLSTTRRCLLALKRMGGVNSPRELYPYQLKLASLDELRIDGKFYDSSG 473

Query: 483 NIPEGQGTLNALLAECFDIIHELKIEAEERVEERVD----IHDDGEESVEMTKDPTMRDV 538
            IPEGQGTLNALLAECFD++HEL+IE+EE V+   D    I DD E+  +++ D      
Sbjct: 474 EIPEGQGTLNALLAECFDMLHELEIESEESVDNENDTADSIQDDNEDYRDVSDD------ 527

Query: 539 QERPTARYMDVYA 551
            +RP AR ++  A
Sbjct: 528 -DRPAARSLNTIA 539

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/500 (59%), Positives = 352/500 (70%), Gaps = 29/500 (5%)

Query: 9   AVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELRKNSHAT 68
           AVP EEE  L Y L VR  LS +KQNRSQFLNSKD+  TYQ+VLTKVRELDE+R+  H  
Sbjct: 11  AVPKEEEVFLDYLLKVRQNLSDLKQNRSQFLNSKDIQFTYQRVLTKVRELDEIRRQKHGN 70

Query: 69  PSNSAT-TLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQSLLEHL 127
              +   T +HS ELHNRVD+V+DDVFQLLSL F+T GLKNSAPATYASLSTVQSLLEHL
Sbjct: 71  SQETEIKTFVHSPELHNRVDNVLDDVFQLLSLCFITCGLKNSAPATYASLSTVQSLLEHL 130

Query: 128 NESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKDEELNKN 187
            ES +YTHHDL+PIKERL+E++ IV+QN     S+T    +  DD      + D E NKN
Sbjct: 131 IESKIYTHHDLKPIKERLDEIAKIVDQN---CESNTYQDASTLDDDDNEVSRIDNERNKN 187

Query: 188 KIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTKRPHQK 247
           KIE++LLL+AKL HC+ EYN IES+LEE+ P   S +E LFQIRR L+SL          
Sbjct: 188 KIEQNLLLQAKLNHCLHEYNYIESQLEEVDPSSNSLVEKLFQIRRNLVSLV--------- 238

Query: 248 QLVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDINGKFKSLETDKVE 307
                        E S+    + DQ ID              ++RD +G F S+E+    
Sbjct: 239 -------------EISKSNTGVQDQ-IDKKLKHLQLQLNEIENNRDPDGNFVSIESGNPI 284

Query: 308 EKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLLVTRRWTL 367
            KG NVLNGL DDCHDL++DL+H       LD  LQ +YD L+D+K +LENL+VTRRWTL
Sbjct: 285 IKGSNVLNGLSDDCHDLISDLTHHT--KTFLDPDLQNVYDNLIDVKGSLENLMVTRRWTL 342

Query: 368 RETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKXXXXXXXXXX 427
           RETDLF+Y KKL EIDNLRV+GKFPT    +KGQ+ILLYLLRRCY +IYK          
Sbjct: 343 RETDLFSYLKKLNEIDNLRVDGKFPTKSGSTKGQAILLYLLRRCYTLIYKLLESSEPVSE 402

Query: 428 XXQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFYDTDGNIPEG 487
             Q +HNQLSTVRRCLL+LKRMGGV+N+RELYPYQMKLASLDN+R DGKFYD+ GNIPEG
Sbjct: 403 ALQPIHNQLSTVRRCLLDLKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSKGNIPEG 462

Query: 488 QGTLNALLAECFDIIHELKI 507
           QG LNALLA CFDI+HELKI
Sbjct: 463 QGILNALLAGCFDILHELKI 482

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/517 (58%), Positives = 362/517 (70%), Gaps = 34/517 (6%)

Query: 45  MDTYQKVLTKVRELDELRKNSH-ATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLT 103
           M TYQ VLTKVR LD++RK  H A  +    TLIHS+ LHNRVDSV+DDVFQLLSLSFLT
Sbjct: 1   MATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLT 60

Query: 104 VGLKNSAPATYASLSTVQSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDT 163
           VGLKN+APATYASLSTVQ LLEH+ E+NVYT+ DLRPIKERL+E+  IVE+N Y+S  + 
Sbjct: 61  VGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVE- 119

Query: 164 QSVNADADDIGEFALQKDEELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQST 223
                D   + E A    EE   NK+EEDLL+RAKL+HC+D Y  ++SK   I P+LQ  
Sbjct: 120 -----DEAPLDELA----EEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPL 170

Query: 224 MEALFQIRRGLLSLASSTKRPHQKQLVPDPAVLSVESEASEKKNVLP--DQVIDXXXXXX 281
            + LF IRR LLSLA+S K                  E S +++  P     +       
Sbjct: 171 SDKLFHIRRELLSLAASAKTDR------------AAGEGSTERSTTPASPNTLASRLKDL 218

Query: 282 XXXXXXXXSHRDINGKFKSLE-TDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDT 340
                   SHRD +GKF S +  D V +KGQ+ LNGLLDDC +L  DLSHQ  G + LD 
Sbjct: 219 ESMILEVESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDP 278

Query: 341 KLQPIYDQLVDIKTTLENLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKG 400
           +LQPIY++L++IKTTLENLLVTRRWTLRETDLF YQK+L E+DNLRVN K P+    SKG
Sbjct: 279 QLQPIYEELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKG 338

Query: 401 QSILLYLLRRCYAIIYKXXXXXXXXXXXXQRVHNQLSTVRRCLLELKRMGGVDNDRELYP 460
           Q+++LYLLRRCYA IYK            Q++HNQLSTVRRCL ELKRMGGVD++R+LYP
Sbjct: 339 QALILYLLRRCYATIYKLLESSEPVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYP 398

Query: 461 YQMKLASLDNMRVDGKFYDTDGNIPEGQGTLNALLAECFDIIHELKIEAEERVEERVDIH 520
           YQMKLASLDNMRVDGKFYD DGNIPEGQGTLNALLAECFDI+HE+KIEAE R E+   ++
Sbjct: 399 YQMKLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVN 458

Query: 521 DD--GE----ESVEMTKDPTMRDVQE--RPTARYMDV 549
           +D  GE      +EMTKDPT RDV      T+RY+ V
Sbjct: 459 EDDAGEYNSSPCIEMTKDPTDRDVAADTSSTSRYLSV 495

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  149 bits (375), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 125/438 (28%), Positives = 213/438 (48%), Gaps = 57/438 (13%)

Query: 112 ATYASLSTVQSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYV------------- 158
           + Y+S+  ++ LL  LN+SN++T +DL P+K RL+E+  I+E +  +             
Sbjct: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECEENDNEDNE 132

Query: 159 ----SNSDTQSVNADADDIGEFA------------LQKDEELNKNKIEEDLLLRAKLKHC 202
               ++ + Q VN    + G+              LQK ++ N  K      +  +L  C
Sbjct: 133 DNEDNDENIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKK-----YIFQELDDC 187

Query: 203 IDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTKRPHQKQ--LVPDPAVLSVES 260
              +N IE K + I  +L S ++ +  +R+ LL +  S  +    Q  ++ DP  +S  S
Sbjct: 188 YKVHNVIELKTDNIDVNLSSLLDKVLVVRKDLLYIVFSRVKSVFPQCFVLKDPNHMS-NS 246

Query: 261 EASEKKNVLP---DQVIDXXXXXXXXXXXXXXSHRDINGKFKSLETDKVEEKGQNVLNGL 317
              +K N +    D + +              +  +IN              GQ +LNGL
Sbjct: 247 TFDKKLNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNIN--------------GQRILNGL 292

Query: 318 LDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLLVTRRWTLRETDLFTYQK 377
           +D C ++++D+       I  D K   ++++ + +K  LE +LVT R +L+  DLF   K
Sbjct: 293 VDYCQEVIHDVKLLAIDKID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHK 351

Query: 378 KLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKXXXXXXXXXXXXQRVHNQLS 437
           +L +++   +      D   +K  SI+++ LRRC+ IIYK            + ++NQLS
Sbjct: 352 ELSKLEKRTIRHYNIEDSFQAK--SIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLS 409

Query: 438 TVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFYDTDGNIPEGQGTLNALLAE 497
           T+ R LL+LK  GGV+   +L P ++KL ++ + R++  F D  GNIP GQ  LNALL E
Sbjct: 410 TLARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHE 469

Query: 498 CFDIIHELKIEAEERVEE 515
           C +++  L+I+ E R  E
Sbjct: 470 CMELLKILEIDFEGRTRE 487

>NDAI0G04320 Chr7 (1039571..1041022) [1452 bp, 483 aa] {ON}
           Anc_1.397 YLR175W
          Length = 483

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 17/61 (27%)

Query: 433 HNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASL----DNMRVDG---KFYDTDGNIP 485
           H  ++TV+RC++E          R+LYP +  L  +      M+ DG   KF  T+ N P
Sbjct: 329 HGVVATVKRCIME----------RDLYPRRWGLGPIAQKKKQMKADGKLDKFGRTNENTP 378

Query: 486 E 486
           E
Sbjct: 379 E 379

>Smik_7.285 Chr7 complement(481661..482500) [840 bp, 279 aa] {ON}
           YGL005C (REAL)
          Length = 279

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 64/145 (44%), Gaps = 22/145 (15%)

Query: 45  MDTYQKVLTKVRE--LDELRKNSHATPSNSATTLIHSSELHNRVDSVIDDV----FQLLS 98
           +D Y K LTK  E  +  L K S   P    +T  H        +SV DD      +LL 
Sbjct: 53  LDFYTKNLTKELENTIWNLNKLSQTLPRTWVSTKYHE-------ESVKDDFPLYSNELLR 105

Query: 99  LSFLTVGLKNSAPATYASLSTVQSLLEHL------NESNVYTHHDLRP---IKERLNEVS 149
            S L   L   A A  A  + +Q++ E L      N+ N+     L+    IKER+ +V 
Sbjct: 106 SSKLEYYLDTLASAVRALETGMQNVTERLGEIDQENDDNISVRQQLQSLMLIKERIEKVI 165

Query: 150 AIVEQNKYVSNSDTQSVNADADDIG 174
             +EQ K V+N    S N +A ++G
Sbjct: 166 YYLEQIKTVTNISATSENENATNVG 190

>TBLA0G00180 Chr7 complement(28577..31627) [3051 bp, 1016 aa] {ON}
           Anc_2.16 YNL225C
          Length = 1016

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 50/107 (46%), Gaps = 22/107 (20%)

Query: 290 SHRDINGKFKSLETDKVE-----EKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQP 344
           S R++N   K LE +K       EK Q++L  +        N+L H K    + + KL+ 
Sbjct: 444 SKRELNANLKKLEEEKNAYKSKYEKSQDILKSV-------NNELYHLKRQNENTEEKLKN 496

Query: 345 IYDQLVDIKTTLENLLVTRRWTLRETDLFTYQKKLGEIDN-LRVNGK 390
           I          LEN ++T R  L E D  TY K+L  I + L++N K
Sbjct: 497 IL---------LENKILTDRLELLEKDKLTYSKELQMISSKLKINNK 534

>NCAS0C04900 Chr3 complement(999764..1001191) [1428 bp, 475 aa] {ON}
           Anc_1.397 YLR175W
          Length = 475

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 17/61 (27%)

Query: 433 HNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASL----DNMRVDG---KFYDTDGNIP 485
           H  ++TV+RC++E          R+LYP +  L  +      M+ DG   K+  T+ N P
Sbjct: 329 HGVVATVKRCIME----------RDLYPRRWGLGPVAQKKKQMKADGKLDKYGRTNENTP 378

Query: 486 E 486
           E
Sbjct: 379 E 379

>NDAI0F04590 Chr6 (1114283..1115512) [1230 bp, 409 aa] {ON} Anc_1.19
           YDR532C
          Length = 409

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 98/228 (42%), Gaps = 43/228 (18%)

Query: 123 LLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKDE 182
           L+E    S  + H   R +   LNE++  VE  K  +N+  ++ ++ A    + A+    
Sbjct: 26  LMEITQMSEQFLHEQERKVDSTLNEITQSVETMKQDNNTLIETQSSGAGTGTDTAM---- 81

Query: 183 ELNKNKIEEDLLLRAK-LKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASST 241
                     +++  K     I+++N +   L+ +H D Q +++  + +R  +LS   S 
Sbjct: 82  ----------MMIDIKDFPSNIEKFNKLLELLKMVHLD-QDSLD--YFLRYTVLSNDGSK 128

Query: 242 KRPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDXXXXXXXXXXXXXXSHRDING-KFKS 300
            +P   + + DP  +S+E E    +N    Q ++                 +ING K K 
Sbjct: 129 NKPLSLKSIDDPQFVSLEREVDNLQNNEIAQQLN-----------------EINGTKLKI 171

Query: 301 LETDKVEEKGQNVLNGL-------LDDCHDLVNDLSHQKDGGISLDTK 341
            + +    +  N LN L       +D+C DL+N+ +  KD  ++  TK
Sbjct: 172 FKINDTIFQSNNELNELSLNLGNEIDECWDLLNEFNDLKDKKLNSTTK 219

>YDR121W Chr4 (693585..694175) [591 bp, 196 aa] {ON}  DPB4Shared
           subunit of DNA polymerase (II) epsilon and of
           ISW2/yCHRAC chromatin accessibility complex; involved in
           both chromosomal DNA replication and in inheritance of
           telomeric silencing
          Length = 196

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 115 ASLSTVQSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADAD-DI 173
            S+  V S L+H+  S +       P++++L+E  A VEQ K     D+  V+AD D D+
Sbjct: 90  CSVDDVLSALDHIGHSALKG-----PVRDKLDEYQAAVEQRKK-EKLDSGEVDADGDIDM 143

Query: 174 GE 175
           GE
Sbjct: 144 GE 145

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,603,300
Number of extensions: 2599071
Number of successful extensions: 10123
Number of sequences better than 10.0: 236
Number of HSP's gapped: 10465
Number of HSP's successfully gapped: 254
Length of query: 588
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 473
Effective length of database: 40,294,809
Effective search space: 19059444657
Effective search space used: 19059444657
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)