Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0D14333g7.126ON20520510621e-149
SAKL0F05368g7.126ON2312236862e-91
Suva_9.1947.126ON2152086461e-85
Skud_9.1627.126ON2172106392e-84
KNAG0G010207.126ON2072076252e-82
Smik_9.1847.126ON2142076252e-82
Kpol_1062.577.126ON2192186062e-79
YIL010W (DOT5)7.126ON2152056035e-79
KAFR0K012007.126ON2022015991e-78
TDEL0H028807.126ON3541626104e-78
CAGL0C03850g7.126ON2092095922e-77
Ecym_83517.126ON2242185932e-77
ADL018W7.126ON2442325891e-76
NDAI0H013107.126ON2612575885e-76
NCAS0F008107.126ON2312315821e-75
TBLA0A009407.126ON2881525611e-71
ZYRO0C05214g7.126ON2701475564e-71
Kwal_55.208397.126ON3051815385e-68
TPHA0C043307.126ON2092165114e-65
KLTH0F12562g7.126ON2932045012e-62
Suva_10.1998.300ON176117740.28
Smik_12.1698.300ON176126720.42
YLR109W (AHP1)8.300ON176126720.42
Skud_12.1778.300ON176115720.44
KLTH0F09702g2.340ON60950691.9
TDEL0D039503.229ON49359673.2
TDEL0D034803.277ON29980663.9
KNAG0C002201.5ON116149665.6
CAGL0M08536g5.646ON40871646.6
TDEL0A003603.17ON42328647.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0D14333g
         (205 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   413   e-149
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   268   2e-91
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   253   1e-85
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   250   2e-84
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   245   2e-82
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   245   2e-82
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   238   2e-79
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   236   5e-79
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   235   1e-78
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   239   4e-78
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   232   2e-77
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   233   2e-77
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   231   1e-76
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   231   5e-76
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   228   1e-75
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   220   1e-71
ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   218   4e-71
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   211   5e-68
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   201   4e-65
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   197   2e-62
Suva_10.199 Chr10 (377104..377634) [531 bp, 176 aa] {ON} YLR109W...    33   0.28 
Smik_12.169 Chr12 (348877..349407) [531 bp, 176 aa] {ON} YLR109W...    32   0.42 
YLR109W Chr12 (368781..369311) [531 bp, 176 aa] {ON}  AHP1Thiol-...    32   0.42 
Skud_12.177 Chr12 (351533..352063) [531 bp, 176 aa] {ON} YLR109W...    32   0.44 
KLTH0F09702g Chr6 (840760..842589) [1830 bp, 609 aa] {ON} simila...    31   1.9  
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    30   3.2  
TDEL0D03480 Chr4 (639066..639965) [900 bp, 299 aa] {ON} Anc_3.27...    30   3.9  
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...    30   5.6  
CAGL0M08536g Chr13 complement(852150..853376) [1227 bp, 408 aa] ...    29   6.6  
TDEL0A00360 Chr1 (62714..63985) [1272 bp, 423 aa] {ON} Anc_3.17 ...    29   7.5  

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  413 bits (1062), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MVELRRSNRISAKKEPLDSESAEPIKVKAKTESKVTKPNGKKEVKNEDSANKLAELQIGD 60
           MVELRRSNRISAKKEPLDSESAEPIKVKAKTESKVTKPNGKKEVKNEDSANKLAELQIGD
Sbjct: 1   MVELRRSNRISAKKEPLDSESAEPIKVKAKTESKVTKPNGKKEVKNEDSANKLAELQIGD 60

Query: 61  DIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELKEHAAV 120
           DIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELKEHAAV
Sbjct: 61  DIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELKEHAAV 120

Query: 121 FGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKNGKLEV 180
           FGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKNGKLEV
Sbjct: 121 FGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKNGKLEV 180

Query: 181 KRVQVSPEVSIEEGKKEVLELAKSL 205
           KRVQVSPEVSIEEGKKEVLELAKSL
Sbjct: 181 KRVQVSPEVSIEEGKKEVLELAKSL 205

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  268 bits (686), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 167/223 (74%), Gaps = 18/223 (8%)

Query: 1   MVELRRSNRISAKKEPLDSE--SAEPI--------------KVKAKTESKVT-KPNGKKE 43
           MVELRRSNR++A K+    E  S EP               K++ KTE +V  KP  K E
Sbjct: 1   MVELRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSE 60

Query: 44  VKNEDSANKLA-ELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTR 102
            +  +  N  + EL++GDDIPDL L NQDD+ ISLKE+A KN++VVFFAYPKASTPGCTR
Sbjct: 61  DEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTR 120

Query: 103 QACGYRDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTA 162
           Q CGYRDNY +LKEHAAVFGLSAD  K+QK+FQTKQ+LP+DLLSDPKREFIG LGAKKT 
Sbjct: 121 QVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTP 180

Query: 163 VSGVVRSHWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELAKSL 205
            SGV+RSHW+F  GKL  KRV++SPE S+ +GKKEVLELAK L
Sbjct: 181 QSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKDL 223

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  253 bits (646), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 130/208 (62%), Positives = 163/208 (78%), Gaps = 12/208 (5%)

Query: 4   LRRSNRISAKKEPLDSESA--------EPIKVKAKTESKVTKPNGKKEVKNEDSANKLA- 54
           LRRS RI+  K  L++E +        EP K K KT   V K + ++ VK ED ++  A 
Sbjct: 5   LRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKT---VPKLDIEEPVKREDHSSLGAN 61

Query: 55  ELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSEL 114
           EL++GDDIPDL+LLN+D++P+SLKE+A +NK+VVFF YPKASTPGCTRQACG+RDNY +L
Sbjct: 62  ELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121

Query: 115 KEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFK 174
           KEHAAVFGLSAD+  SQK FQTKQ LP+ LLSDPKREFIG LGAKKT +SG +RSH++F 
Sbjct: 122 KEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFV 181

Query: 175 NGKLEVKRVQVSPEVSIEEGKKEVLELA 202
           +GKL  KRV++SPEVS+ + KKEV+ELA
Sbjct: 182 DGKLRFKRVKISPEVSVGDAKKEVMELA 209

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  250 bits (639), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 128/210 (60%), Positives = 161/210 (76%), Gaps = 16/210 (7%)

Query: 4   LRRSNRISAKKEPLDSESAE--PI--------KVKAKTESKVTKPNGKKEVKNED-SANK 52
           LRRS RI+A K  L+ E ++  PI        KVK   + K ++P     VK+ED S + 
Sbjct: 5   LRRSTRIAASKRLLEDEESKLVPISPPEVPKKKVKTAPKVKTSEP-----VKSEDDSLSA 59

Query: 53  LAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYS 112
             EL+IGD IPDL+LL++D++PISLKE+A +NK+VVFF YPKASTPGCTRQACG+RDNY 
Sbjct: 60  ATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYE 119

Query: 113 ELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWI 172
           +LK+HAAVFGLSAD   SQK FQTKQ LP+ L+SDPKREFIG LGAKKT +SG +RSH++
Sbjct: 120 DLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFV 179

Query: 173 FKNGKLEVKRVQVSPEVSIEEGKKEVLELA 202
           F NGKL  KR+++SPEVS+ + KKEVLE+A
Sbjct: 180 FVNGKLRFKRIKISPEVSVSDAKKEVLEIA 209

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  245 bits (625), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 157/207 (75%), Gaps = 2/207 (0%)

Query: 1   MVELRRSNRIS-AKKEPLDSESAEPIKVKAKTESKVTKPNGKKEVKNEDSANKLAE-LQI 58
           MVELR+S R++  KK+   +  A   K+  KT +  +    K   + ED     A+ L+I
Sbjct: 1   MVELRKSARVANIKKQTTLTTPATSNKIVKKTSNAASHKKVKIVAETEDKPLVDAKVLEI 60

Query: 59  GDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELKEHA 118
           GD+IPDLTL++Q+ E +SL EVAS NK++V FAYP+ASTPGCTRQACG+RDNY+ELK+HA
Sbjct: 61  GDEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCTRQACGFRDNYAELKKHA 120

Query: 119 AVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKNGKL 178
           AV+GLSAD   SQK FQTKQ LP++LLSDPKREFIG LGAKKT+ SG++RS+WIF NGKL
Sbjct: 121 AVYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKTSQSGIIRSYWIFFNGKL 180

Query: 179 EVKRVQVSPEVSIEEGKKEVLELAKSL 205
            +K+++VSPE S+ E K EVLEL K L
Sbjct: 181 RIKKIKVSPEASVAESKAEVLELVKEL 207

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  245 bits (625), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 122/207 (58%), Positives = 160/207 (77%), Gaps = 10/207 (4%)

Query: 4   LRRSNRISAKKEPLDSESA--------EPIKVKAKTESKVTKPNGKKEVKNEDSANKLAE 55
           LRRS RI+A K  L+ E +        E +K + KT+ KV     + E + ++SA+   E
Sbjct: 5   LRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKV--SETEDQGDNSASTSTE 62

Query: 56  LQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELK 115
           L+IGD IPDL+LL++D++ ISLK++A +NK+VVFF YPKASTPGCTRQACG+RDNY +LK
Sbjct: 63  LKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDDLK 122

Query: 116 EHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKN 175
           +H+AVFGLS+D+  SQK FQTKQ LP+ LLSDPKREFIG LGAKKT +SG +RSH++F +
Sbjct: 123 KHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVD 182

Query: 176 GKLEVKRVQVSPEVSIEEGKKEVLELA 202
           GKL  KRV++SPEVS+ + KKE+LELA
Sbjct: 183 GKLRFKRVKISPEVSVNDAKKEILELA 209

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  238 bits (606), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 158/218 (72%), Gaps = 14/218 (6%)

Query: 1   MVELRRSNRISAKKEPLDSESAE-------------PIKVKAKTESKVTKPNGKKEVKNE 47
           MV +RRS RI+  K  L+++ AE               K+K + + +VTK + K E K E
Sbjct: 1   MVAVRRSTRIANSKRKLEADEAERDVASKSGEETTSSKKLKKEKDVRVTKVDDK-ESKAE 59

Query: 48  DSANKLAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGY 107
           +  + + E++IGD+IPDL L NQD   ISL+++A  N ++VFFAYP+A TPGCTRQACG+
Sbjct: 60  NKPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGF 119

Query: 108 RDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVV 167
           RD Y +LK+HAAVFGLSAD+  SQK FQ K +LP+DLLSDPKREFIG LGAKKT  SG++
Sbjct: 120 RDTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGII 179

Query: 168 RSHWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELAKSL 205
           RSH+IF +GKL  KR+++SPE+S+ +GKKEVLE+ +  
Sbjct: 180 RSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEF 217

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  236 bits (603), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 156/205 (76%), Gaps = 6/205 (2%)

Query: 4   LRRSNRISAKKEPLDSESAE--PIKVKAKTESKVT---KPNGKKEVKNE-DSANKLAELQ 57
           LRRS RI+  K  L+ E ++  PI      + K+    K N  + V  E + ++ + EL+
Sbjct: 5   LRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANRSSDVNELE 64

Query: 58  IGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELKEH 117
           IGD IPDL+LLN+D++ ISLK++   N++VVFF YP+ASTPGCTRQACG+RDNY ELK++
Sbjct: 65  IGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQELKKY 124

Query: 118 AAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKNGK 177
           AAVFGLSAD+  SQK FQ+KQ LP+ LLSDPKREFIG LGAKKT +SG +RSH+IF +GK
Sbjct: 125 AAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIFVDGK 184

Query: 178 LEVKRVQVSPEVSIEEGKKEVLELA 202
           L+ KRV++SPEVS+ + KKEVLE+A
Sbjct: 185 LKFKRVKISPEVSVNDAKKEVLEVA 209

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  235 bits (599), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 118/201 (58%), Positives = 148/201 (73%), Gaps = 4/201 (1%)

Query: 2   VELRRSNRISAKKEPLDSESAEPIKVKAKTESKVTKPNGKKEVKNEDSANKLAELQIGDD 61
           ++LR S RI AK    D E  +  + + K    ++K    +   N  S+    ELQIGD 
Sbjct: 1   MQLRNSTRIKAKVLFEDIEDDKERRPEKKRRVTISKEETVESSGNVSSS----ELQIGDI 56

Query: 62  IPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELKEHAAVF 121
           +PD+TL+NQD++ ISL+EVA  NK++V FAYPKASTPGCTRQACG+RDNY E+K+HAAVF
Sbjct: 57  MPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEIKKHAAVF 116

Query: 122 GLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKNGKLEVK 181
           GLSAD+  SQK FQ KQ LPF+LLSDPKRE IG LGAKKT  SG++RSHW+F +GKL  +
Sbjct: 117 GLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVFLDGKLRFR 176

Query: 182 RVQVSPEVSIEEGKKEVLELA 202
            ++VSPE SI E KKEV+ELA
Sbjct: 177 NIKVSPERSISESKKEVMELA 197

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  239 bits (610), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 110/162 (67%), Positives = 133/162 (82%)

Query: 44  VKNEDSANKLAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQ 103
            ++ D   +  EL IGD+IPD+TL NQD + +SL++VA ++K+++ FAYPKASTPGCTRQ
Sbjct: 190 AEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQ 249

Query: 104 ACGYRDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAV 163
           ACGYRDNY ELKEHAAVFGLS D   +QK FQTKQ+LPFDLL DP R  IG LGAKKTA 
Sbjct: 250 ACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQ 309

Query: 164 SGVVRSHWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELAKSL 205
           SG +RSHW+F +GKL+ KRV+VSPEVSI++GKKEVLELA SL
Sbjct: 310 SGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAASL 351

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  232 bits (592), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 114/209 (54%), Positives = 152/209 (72%), Gaps = 11/209 (5%)

Query: 2   VELRRSNRISAK-------KEPLDSESAEPIKVKAKTESKVTKPNGKKEVKNEDSANKLA 54
           +ELRRS R+SAK       + P+  ++   +K K  T+  V KPN K+E  + D A    
Sbjct: 1   MELRRSTRLSAKHGNEVKDEGPIKKKAKSVLKEKVNTKEPVKKPNTKEEKVSSDEAI--- 57

Query: 55  ELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSEL 114
            L++GDDIPD+TL NQD + +SLK +A +NK+++ F YPKASTPGCTRQACG+RDN+ +L
Sbjct: 58  -LEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDL 116

Query: 115 KEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFK 174
           KEH  V GLS D P +Q  F+ K +LP+DLL DP REFIG LGAKKT  SG +RSH++F 
Sbjct: 117 KEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFA 176

Query: 175 NGKLEVKRVQVSPEVSIEEGKKEVLELAK 203
           +GKL+ KR+++SPE+S+ +GKKEVLELAK
Sbjct: 177 DGKLKFKRLKISPEISVADGKKEVLELAK 205

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  233 bits (593), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 121/218 (55%), Positives = 155/218 (71%), Gaps = 18/218 (8%)

Query: 2   VELRRSNRISAKK--EPLDSESAEPIKVKAKTESKVTKPNGKKEVKNEDSANKLA----- 54
            ELRRS R++ +K  E  + E     + K KT S V+    KK+  N  S   L      
Sbjct: 3   TELRRSTRLATRKANEKPEFEEIRFSQKKIKTSSGVS--GVKKKSNNGGSVGVLKADSVL 60

Query: 55  ---------ELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQAC 105
                    EL++GD++P++ L NQDD+ ++LK+VA KNK+V+ FAYPKA+TPGCTRQAC
Sbjct: 61  KSEKVGGPKELEVGDNVPEIALKNQDDKEVNLKDVAKKNKIVLIFAYPKANTPGCTRQAC 120

Query: 106 GYRDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSG 165
           G+RDNY EL++HA +FG+S+D+ KSQK+FQ+KQ LPFDLLSDP RE IG LGAKKTA +G
Sbjct: 121 GFRDNYEELQKHAVIFGISSDSVKSQKAFQSKQHLPFDLLSDPDRELIGMLGAKKTAQAG 180

Query: 166 VVRSHWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELAK 203
           V+RSHWIF NGKL+ KRV+VSPE SI EG +EVL L K
Sbjct: 181 VIRSHWIFCNGKLKYKRVKVSPETSISEGLEEVLGLIK 218

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  231 bits (589), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 148/232 (63%), Gaps = 30/232 (12%)

Query: 2   VELRRSNRISAKKEPLDSESAE-----------------PIKVKAKTESKVTKPNGKKEV 44
            ELRRS R++ +K    SE AE                 P KV      KV     KKE 
Sbjct: 3   TELRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKKVATDAPKKVVTEAPKKEA 62

Query: 45  -------------KNEDSANKLAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFA 91
                          E S     ELQ+GD +P++TL NQD   + L +V  KNK+VV FA
Sbjct: 63  GAAKKVETPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFA 122

Query: 92  YPKASTPGCTRQACGYRDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKRE 151
           YPKASTPGCTRQACG+RDNY EL++HA VFG+SAD+ KSQKSFQ KQ LPFDLLSDPKRE
Sbjct: 123 YPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVKSQKSFQQKQKLPFDLLSDPKRE 182

Query: 152 FIGALGAKKTAVSGVVRSHWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELAK 203
            IGALGA+KTA +GV+RSHW+F +GKL  KR+++SPE+SI +G  EVL  AK
Sbjct: 183 LIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAK 234

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  231 bits (588), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 126/257 (49%), Positives = 161/257 (62%), Gaps = 52/257 (20%)

Query: 1   MVELRRSNRISAKKEPLDSESAEPIKVKAK----------------TESKVTKPNG---- 40
           ++ELRRS R++A K   D ++   ++ + K                +E KV K  G    
Sbjct: 2   VMELRRSGRVTAGKRTFDEDTDNHVEKRKKIATQKAKKSPSKKLLVSEKKVIKNAGSING 61

Query: 41  ---KKEVK---------------------------NEDSANK--LAELQIGDDIPDLTLL 68
              KKE K                           ++ SAN   + EL+IGDDIPD+TL 
Sbjct: 62  RETKKETKPRSVVEDKVDGIEHEEVKKVKFDEQQVSDKSANNDSIIELEIGDDIPDITLS 121

Query: 69  NQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELKEHAAVFGLSADAP 128
           NQ+ + ISLKE+A  NK++V FA+P+ASTPGCTRQACG+RDNY ELK++A VFGLSADA 
Sbjct: 122 NQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNAIVFGLSADAI 181

Query: 129 KSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKNGKLEVKRVQVSPE 188
            SQK F+ KQ LP+DLLSDPKR+ IG LGAKKT  SG VRS+WIF  GKL +KR++VSPE
Sbjct: 182 SSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSPE 241

Query: 189 VSIEEGKKEVLELAKSL 205
           +S+ E KKEV+E AK L
Sbjct: 242 ISVAESKKEVIEFAKKL 258

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  228 bits (582), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 126/231 (54%), Positives = 160/231 (69%), Gaps = 31/231 (13%)

Query: 1   MVELRRSNRISAKKEP--LDSESAEPIK--VKAKTESK-----VTKPNGKKE-------- 43
           MVELRRS RIS  K+   L  E +E +K  +K +  SK     + K NGK +        
Sbjct: 1   MVELRRSGRISTLKKTHFLTEEDSEEVKPAIKKQRVSKTKKIVIKKSNGKMKPKLDGKEE 60

Query: 44  ------------VKNEDSANKLAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFA 91
                       VKN DS  K  ELQIGDDIPD+ L +++   +SLK+V  +NK+VVFFA
Sbjct: 61  IVKSVKELDSTAVKNTDSIYK--ELQIGDDIPDIILPDEEGVSVSLKKVVEENKIVVFFA 118

Query: 92  YPKASTPGCTRQACGYRDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKRE 151
           +PKA+TPGCTRQACG+RDNY ELKEHAAV+G+SAD   +QK F+TKQ LP+ LLSD KR+
Sbjct: 119 FPKANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRD 178

Query: 152 FIGALGAKKTAVSGVVRSHWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELA 202
           FIG LGAKKT  SGV+RS++IF +GKL+VKRV++SPE+S+EE +KEV   A
Sbjct: 179 FIGLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAFA 229

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  220 bits (561), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 97/152 (63%), Positives = 127/152 (83%)

Query: 53  LAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYS 112
           + EL++GD++PD  L NQ++E ISLK+V  +N++VV FAYPKA+TPGCTRQACG RDNY+
Sbjct: 124 VKELEVGDEVPDFELKNQNNETISLKKVMEENRIVVIFAYPKANTPGCTRQACGMRDNYN 183

Query: 113 ELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWI 172
           +LK++A VFG+SAD+  +QKSFQ KQ LP+DLLSD  RE IGALG KKT  SG++RSH+I
Sbjct: 184 DLKKYAVVFGISADSVSAQKSFQEKQNLPYDLLSDKNRELIGALGCKKTPTSGIIRSHFI 243

Query: 173 FKNGKLEVKRVQVSPEVSIEEGKKEVLELAKS 204
             NGKL+ KRV++SPEVS+ + KKEVLE++KS
Sbjct: 244 IVNGKLKFKRVKISPEVSVSDCKKEVLEISKS 275

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  218 bits (556), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 121/147 (82%)

Query: 59  GDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELKEHA 118
           GD IPD+ L NQD + ISLK+V+ ++K+VV F YPKASTPGCTRQACG+RDNY ++KEHA
Sbjct: 95  GDPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHA 154

Query: 119 AVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKNGKL 178
           AVFGLSAD   +QK FQ KQ LPFDLLSDP+R  +G LGAKK+  SG++RSHW+F +G L
Sbjct: 155 AVFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVL 214

Query: 179 EVKRVQVSPEVSIEEGKKEVLELAKSL 205
           + KRV++SPEVSIEEGKKEVLEL K  
Sbjct: 215 KHKRVKISPEVSIEEGKKEVLELVKQF 241

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  211 bits (538), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 106/181 (58%), Positives = 131/181 (72%), Gaps = 6/181 (3%)

Query: 24  PIKVKAKTESKVTKPNGKKEVKNEDSANKLAELQIGDDIPDLTLLNQDDEPISLKEVASK 83
           P     + E +V KP   K  K+ DS+    EL++GD++PD+ L NQD+E +SLK+VA +
Sbjct: 20  PEDETTQKEPEVKKP---KTAKSSDSSQ--GELEVGDEVPDVVLKNQDEEEVSLKKVAQE 74

Query: 84  NKLVVFFAYPKASTPGCTRQACGYRDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFD 143
           NK+V+ F+YPKASTPGCT QACG+RDNY +LKE  AVFGLSAD P +Q+ FQ   +LPFD
Sbjct: 75  NKVVIIFSYPKASTPGCTTQACGFRDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFD 134

Query: 144 LLSDPKREFIGALGAKKTAVSGVVRSHWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELAK 203
           LLSDPKRE IG LGAKK+  SG  RSHW+F NGKL  KR+ VSPEVSI + K E  E AK
Sbjct: 135 LLSDPKRELIGLLGAKKSP-SGTKRSHWVFANGKLINKRIAVSPEVSIRDAKTEAHEAAK 193

Query: 204 S 204
            
Sbjct: 194 G 194

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  201 bits (511), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 105/216 (48%), Positives = 148/216 (68%), Gaps = 18/216 (8%)

Query: 1   MVELRRSNRISAKKEPLDSESAEPIKVKAKTESKVTKPNGKKEVK-----------NEDS 49
           M E+RRS+RI+ KK    ++      VKA+  SKV+K       K            E  
Sbjct: 1   MTEVRRSSRIANKKIIHQAD------VKAEHSSKVSKKAKTTVKKTLSVSKIETDLKETQ 54

Query: 50  ANKLAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRD 109
            +   E+Q+GD+IPDLTL NQ+ E +SL+++A KNK++  F YP+ASTPGCTRQACG+RD
Sbjct: 55  KDDYEEIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRD 114

Query: 110 NYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRS 169
           N+ +LK+++ + GLS D+  +QK F+TKQ LP+DLL D +++ I  LG KK   SG++RS
Sbjct: 115 NFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRS 173

Query: 170 HWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELAKSL 205
           ++IF +GKL++KRV+VSPEVSI E KKE+L+L K L
Sbjct: 174 YFIFVDGKLKLKRVKVSPEVSITESKKEILDLVKEL 209

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  197 bits (501), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 108/204 (52%), Positives = 138/204 (67%), Gaps = 13/204 (6%)

Query: 1   MVELRRSNRISAKKEPLDSESAEPIKVKAKTESKVTKPNGKKEVKNEDSANKLAELQIGD 60
           MVELRRS R  +   P  +   E +   A  E+K  K NG K            EL+ GD
Sbjct: 1   MVELRRSTRKKSSDAPKRAPEEEEVAPNA-PETKKAKTNGSK-----------GELEEGD 48

Query: 61  DIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELKEHAAV 120
           ++PD+ L NQ+ E +SLK V  +NK+VV FAYPKASTPGCT+QACG+RDNY ELK++AAV
Sbjct: 49  EVPDVVLKNQEGEEVSLKSVVQQNKVVVVFAYPKASTPGCTKQACGFRDNYEELKKNAAV 108

Query: 121 FGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKNGKLEV 180
           FGLS D P +Q+ F+ K +LPFDLLSDP+R+ IG LGA K+  SG  RS+W+F  GKL  
Sbjct: 109 FGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFVQGKLRT 167

Query: 181 KRVQVSPEVSIEEGKKEVLELAKS 204
           KR+ VSPE S+ E KKE +E A++
Sbjct: 168 KRISVSPEASVSEAKKEAIEAAQT 191

>Suva_10.199 Chr10 (377104..377634) [531 bp, 176 aa] {ON} YLR109W
           (REAL)
          Length = 176

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 11/117 (9%)

Query: 73  EPISLKEVASKNKLVVFFAYPKASTPGCT-RQACGYRDNYSEL---KEHAAVFGLSADAP 128
           + +   ++ S+NK V+    P A +P CT     GY +   EL   KE   V  ++ D P
Sbjct: 35  QTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNP 94

Query: 129 KSQ----KSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRS-HW--IFKNGKL 178
            +     KS   K        SDP   F  ++G +     GV  S  W  I +NG +
Sbjct: 95  FANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVFWSGRWAIIVENGVI 151

>Smik_12.169 Chr12 (348877..349407) [531 bp, 176 aa] {ON} YLR109W
           (REAL)
          Length = 176

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 52/126 (41%), Gaps = 11/126 (8%)

Query: 73  EPISLKEVASKNKLVVFFAYPKASTPGCT-RQACGYRDNYSEL---KEHAAVFGLSADAP 128
           + +   ++ S+NK V+    P A +P CT     GY +   EL   KE   V  ++ D P
Sbjct: 35  QTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNP 94

Query: 129 KSQ----KSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRS-HW--IFKNGKLEVK 181
            +     KS   K        SDP   F  ++G +     GV  S  W  + +NG +   
Sbjct: 95  FANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVFWSGRWAMVVENGVVTYA 154

Query: 182 RVQVSP 187
             + +P
Sbjct: 155 AKETNP 160

>YLR109W Chr12 (368781..369311) [531 bp, 176 aa] {ON}
           AHP1Thiol-specific peroxiredoxin, reduces hydroperoxides
           to protect against oxidative damage; function in vivo
           requires covalent conjugation to Urm1p
          Length = 176

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 52/126 (41%), Gaps = 11/126 (8%)

Query: 73  EPISLKEVASKNKLVVFFAYPKASTPGCT-RQACGYRDNYSEL---KEHAAVFGLSADAP 128
           + +   ++ S+NK V+    P A +P CT     GY +   EL   KE   V  ++ D P
Sbjct: 35  QTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNP 94

Query: 129 KSQ----KSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRS-HW--IFKNGKLEVK 181
            +     KS   K        SDP   F  ++G +     GV  S  W  + +NG +   
Sbjct: 95  FANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYA 154

Query: 182 RVQVSP 187
             + +P
Sbjct: 155 AKETNP 160

>Skud_12.177 Chr12 (351533..352063) [531 bp, 176 aa] {ON} YLR109W
           (REAL)
          Length = 176

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 47/115 (40%), Gaps = 11/115 (9%)

Query: 73  EPISLKEVASKNKLVVFFAYPKASTPGCT-RQACGYRDNYSEL---KEHAAVFGLSADAP 128
           + +   ++ S+NK V+    P A +P CT     GY     EL   KE   V  ++ D P
Sbjct: 35  QTVEWSKLISENKKVIITGAPAAFSPTCTISHIPGYISYLDELVKEKEVDQVIVVTVDNP 94

Query: 129 KSQ----KSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRS-HW--IFKNG 176
            +     KS   K        SDP   F  ++G +     GV  S  W  I +NG
Sbjct: 95  FANQAWAKSLGVKDTTHIKFASDPNCAFTKSIGFELAVGDGVYWSGRWAMIVENG 149

>KLTH0F09702g Chr6 (840760..842589) [1830 bp, 609 aa] {ON} similar
           to uniprot|P40969 Saccharomyces cerevisiae YMR168C CEP3
           Essential kinetochore protein component of the CBF3
           complex that binds the CDEIII region of the centromere
           contains an N-terminal Zn2Cys6 type zinc finger domain a
           C-terminal acidic domain and a putative coiled coil
           dimerization domain
          Length = 609

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query: 133 SFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKNGKLEVKR 182
           S++TK     DLLS+ K EF+    A    V G+     IF+NG L  KR
Sbjct: 45  SYRTKLDRAGDLLSESKHEFLTTWQAYDYWVFGIG----IFQNGALNKKR 90

>TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.229
           YBR028C
          Length = 493

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 46  NEDSANKLAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQA 104
           +EDS+ +   + I D+  D+  L    EPI  K+  ++ +  V   +P  STP CTR+ 
Sbjct: 17  SEDSSLRQGPIAIFDERDDVDHLTVRTEPIPFKDGRTRRRSSVLEKFP-VSTPPCTRRV 74

>TDEL0D03480 Chr4 (639066..639965) [900 bp, 299 aa] {ON} Anc_3.277
           YBR061C
          Length = 299

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 17  LDSESAEPIKVKAKTESKVTKPNGKKEVKNEDSANKLAELQIGDDIPDLTLLNQDDEPIS 76
           +D ++  PI      ++ +T P   + +  +   ++ A+L I D  PD+T L+  DE + 
Sbjct: 79  VDLQTMSPIDHVTTLQADITHPRTLQRIL-QLFGDEPADLVISDGAPDVTGLHDLDEYVQ 137

Query: 77  LKEVASKNKLVVFFAYPKAS 96
            + V S  +L      PK S
Sbjct: 138 QQLVMSALQLACCVLKPKGS 157

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%)

Query: 53   LAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCT 101
            LA LQ  DD+ DL  L +     S K V SKN+++   A   + T   T
Sbjct: 1025 LARLQHDDDVSDLYTLKKQSSVKSFKSVGSKNEIINVDANDNSGTAVAT 1073

>CAGL0M08536g Chr13 complement(852150..853376) [1227 bp, 408 aa]
           {ON} weakly similar to uniprot|P36052 Saccharomyces
           cerevisiae YKL162c
          Length = 408

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 7/71 (9%)

Query: 73  EPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELKEHAAVFGLSADAPKSQK 132
           EP+  +++ S+ K+ +   YP    PG TRQ     +N   L +  AVFG     P + +
Sbjct: 96  EPVVDRQLLSRVKVYMMPLYPSPQHPGETRQV---SENVWVLGDDQAVFG----TPATLQ 148

Query: 133 SFQTKQALPFD 143
             +    LP +
Sbjct: 149 DMRLADLLPLE 159

>TDEL0A00360 Chr1 (62714..63985) [1272 bp, 423 aa] {ON} Anc_3.17
           YOL140W
          Length = 423

 Score = 29.3 bits (64), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 58  IGDDIPDLTLLNQDDEPISLKEVASKNK 85
            GD IP+++ LN +DE   LK+  S NK
Sbjct: 176 FGDLIPNVSFLNVNDELTKLKDYISSNK 203

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.128    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,837,722
Number of extensions: 869298
Number of successful extensions: 3542
Number of sequences better than 10.0: 103
Number of HSP's gapped: 3526
Number of HSP's successfully gapped: 103
Length of query: 205
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 101
Effective length of database: 41,556,135
Effective search space: 4197169635
Effective search space used: 4197169635
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 63 (28.9 bits)